Placenta specific protein 8

Overview
NamePlacenta specific protein 8
Smed IDSMED30023073
Length (bp)651
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Placenta specific protein 8 (SMED30023073) t-SNE clustered cells

Violin plots show distribution of expression levels for Placenta specific protein 8 (SMED30023073) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Placenta specific protein 8 (SMED30023073) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Placenta specific protein 8 (SMED30023073) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023073

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30023073SMESG000050177.1 SmedASXL_079560SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermal cellSMED30023073SMESG000050177.1 dd_Smed_v4_3182_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30023073SMESG000050177.1 dd_Smed_v6_3182_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30023073SMESG000050177.1 OX_Smed_1.0.18506ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Category 4 cellSMED30023073SMESG000050177.1 dd_Smed_v4_3182_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023073SMESG000050177.1 dd_Smed_v4_3182_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Placenta specific protein 8 vs. Ensembl Zebrafish
Match: ponzr5 (plac8 onzin related protein 5 [Source:ZFIN;Acc:ZDB-GENE-081104-325])

HSP 1 Score: 45.8246 bits (107), Expect = 3.796e-6
Identity = 24/76 (31.58%), Postives = 40/76 (52.63%), Query Frame = 3
Query:  336 CYTCYLFHIYDEFLCTPICMYDS-------VLQLRTKHRARHGIRGTIIEDCCKTYWCYWCAICQLKRDMDYVEDT 542
            C+ C     + E LC P  + D         L +R   R+R+GI+G+I +DC  + +C  C+ CQ+ R+M+  E +
Sbjct:   44 CFACSTARKHGECLCLP--LLDGFGFIPAITLAMRVSVRSRYGIKGSICKDCAYSTFCGACSWCQISREMNIREQS 117          
BLAST of Placenta specific protein 8 vs. Ensembl Zebrafish
Match: ponzr5 (plac8 onzin related protein 5 [Source:ZFIN;Acc:ZDB-GENE-081104-325])

HSP 1 Score: 45.4394 bits (106), Expect = 4.136e-6
Identity = 24/76 (31.58%), Postives = 40/76 (52.63%), Query Frame = 3
Query:  336 CYTCYLFHIYDEFLCTPICMYDS-------VLQLRTKHRARHGIRGTIIEDCCKTYWCYWCAICQLKRDMDYVEDT 542
            C+ C     + E LC P  + D         L +R   R+R+GI+G+I +DC  + +C  C+ CQ+ R+M+  E +
Sbjct:   41 CFACSTARKHGECLCLP--LLDGFGFIPAITLAMRVSVRSRYGIKGSICKDCAYSTFCGACSWCQISREMNIREQS 114          
BLAST of Placenta specific protein 8 vs. Ensembl Zebrafish
Match: plac8.2 (placenta associated 8, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-070424-12])

HSP 1 Score: 44.2838 bits (103), Expect = 7.979e-6
Identity = 32/99 (32.32%), Postives = 54/99 (54.55%), Query Frame = 3
Query:  231 IIQQPVANGPRLWXXXXXXXXXXXXXXXLTMFFTHCYTCYLFHIYDEFLCTPICMYDSVLQLRTKHRARHGIRGTIIEDCCKTYWCYWCAICQLKRDMD 527
            +  QP A GP+ + +G+  CC+D + CC  +F   C  C +    +E      C+    + +R+ +R ++ I+G++  D C  Y C  CA CQLKRD++
Sbjct:    3 VTSQPAAFGPQEFQTGLMSCCEDMSICCCGLFCLPCMGCSIASDMNE-----CCLCGLGMPMRSVYRTKYNIQGSMCTDFCIVYNCMPCAACQLKRDIE 96          
BLAST of Placenta specific protein 8 vs. Ensembl Zebrafish
Match: plac8.2 (placenta associated 8, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-070424-12])

HSP 1 Score: 44.2838 bits (103), Expect = 7.979e-6
Identity = 32/99 (32.32%), Postives = 54/99 (54.55%), Query Frame = 3
Query:  231 IIQQPVANGPRLWXXXXXXXXXXXXXXXLTMFFTHCYTCYLFHIYDEFLCTPICMYDSVLQLRTKHRARHGIRGTIIEDCCKTYWCYWCAICQLKRDMD 527
            +  QP A GP+ + +G+  CC+D + CC  +F   C  C +    +E      C+    + +R+ +R ++ I+G++  D C  Y C  CA CQLKRD++
Sbjct:    3 VTSQPAAFGPQEFQTGLMSCCEDMSICCCGLFCLPCMGCSIASDMNE-----CCLCGLGMPMRSVYRTKYNIQGSMCTDFCIVYNCMPCAACQLKRDIE 96          
BLAST of Placenta specific protein 8 vs. Ensembl Xenopus
Match: ifi35 (interferon induced protein 35 [Source:Xenbase;Acc:XB-GENE-1010748])

HSP 1 Score: 51.2174 bits (121), Expect = 4.698e-8
Identity = 27/68 (39.71%), Postives = 39/68 (57.35%), Query Frame = 3
Query:  324 FFTHCYTCYLFHIYDEFLCTPICMYDSVLQLRTKHRARHGIRGTIIEDCCKTYWCYWCAICQLKRDMD 527
            FF  C  C +   Y E  C P+ M  ++L LRT  R R+ I+GTI  DC    +C  CA+CQ+ R+++
Sbjct:   55 FFPMCVACKVAQDYGECCCLPL-MGGTILALRTGIRERYHIQGTICTDCLCVTFCGPCALCQMARELE 121          
BLAST of Placenta specific protein 8 vs. Ensembl Xenopus
Match: ENSXETT00000008293.1 (novel protein similar to cornifelin [Source:NCBI gene;Acc:733751])

HSP 1 Score: 51.2174 bits (121), Expect = 4.798e-8
Identity = 27/68 (39.71%), Postives = 39/68 (57.35%), Query Frame = 3
Query:  324 FFTHCYTCYLFHIYDEFLCTPICMYDSVLQLRTKHRARHGIRGTIIEDCCKTYWCYWCAICQLKRDMD 527
            FF  C  C +   Y E  C P+ M  ++L LRT  R R+ I+GTI  DC    +C  CA+CQ+ R+++
Sbjct:   47 FFPMCVACKVAQDYGECCCLPL-MGGTILALRTGIRERYHIQGTICTDCLCVTFCGPCALCQMARELE 113          
BLAST of Placenta specific protein 8 vs. Ensembl Xenopus
Match: ifi35 (interferon induced protein 35 [Source:Xenbase;Acc:XB-GENE-1010748])

HSP 1 Score: 51.2174 bits (121), Expect = 4.885e-8
Identity = 27/68 (39.71%), Postives = 39/68 (57.35%), Query Frame = 3
Query:  324 FFTHCYTCYLFHIYDEFLCTPICMYDSVLQLRTKHRARHGIRGTIIEDCCKTYWCYWCAICQLKRDMD 527
            FF  C  C +   Y E  C P+ M  ++L LRT  R R+ I+GTI  DC    +C  CA+CQ+ R+++
Sbjct:   57 FFPMCVACKVAQDYGECCCLPL-MGGTILALRTGIRERYHIQGTICTDCLCVTFCGPCALCQMARELE 123          
BLAST of Placenta specific protein 8 vs. Ensembl Xenopus
Match: myo19 (myosin XIX [Source:Xenbase;Acc:XB-GENE-999897])

HSP 1 Score: 45.4394 bits (106), Expect = 4.953e-6
Identity = 22/68 (32.35%), Postives = 36/68 (52.94%), Query Frame = 3
Query:  324 FFTHCYTCYLFHIYDEFLCTPICMYDSVLQLRTKHRARHGIRGTIIEDCCKTYWCYWCAICQLKRDMD 527
            F   C  C +   Y E  C P+ +  +++ +RT  R R+ I GTI  DC    +C  C +CQ+ R+++
Sbjct:   42 FLPLCLACKVAQDYGECCCLPV-LNGTIIAMRTGIRERYQIPGTICNDCVCLTFCGPCTLCQMARELN 108          
BLAST of Placenta specific protein 8 vs. Ensembl Mouse
Match: Plac8 (placenta-specific 8 [Source:MGI Symbol;Acc:MGI:2445289])

HSP 1 Score: 48.9062 bits (115), Expect = 2.259e-7
Identity = 33/121 (27.27%), Postives = 55/121 (45.45%), Query Frame = 3
Query:  165 PTPVLVQPGVMANPMNINQTTVIIQQPVANGPRLWXXXXXXXXXXXXXXXLTMFFTHCYTCYLFHIYDEFLCTPICMYDSVLQLRTKHRARHGIRGTIIEDCCKTYWCYWCAICQLKRDMD 527
            PT ++ QPG +  P N N  T +       G                   + +  T C+TC    +  +      C+  + + +RT +R R+GI G+I +D   T +C  C++CQLKRD++
Sbjct:    5 PTVIVTQPGFVRAPQNSNWQTSLCDCFSDCG-------------------VCLCGTFCFTCLGCQVAADM--NECCLCGTTVAMRTLYRTRYGIPGSICDDYMVTLFCPVCSVCQLKRDIN 104          
BLAST of Placenta specific protein 8 vs. Ensembl Mouse
Match: Plac8 (placenta-specific 8 [Source:MGI Symbol;Acc:MGI:2445289])

HSP 1 Score: 48.9062 bits (115), Expect = 2.259e-7
Identity = 33/121 (27.27%), Postives = 55/121 (45.45%), Query Frame = 3
Query:  165 PTPVLVQPGVMANPMNINQTTVIIQQPVANGPRLWXXXXXXXXXXXXXXXLTMFFTHCYTCYLFHIYDEFLCTPICMYDSVLQLRTKHRARHGIRGTIIEDCCKTYWCYWCAICQLKRDMD 527
            PT ++ QPG +  P N N  T +       G                   + +  T C+TC    +  +      C+  + + +RT +R R+GI G+I +D   T +C  C++CQLKRD++
Sbjct:    5 PTVIVTQPGFVRAPQNSNWQTSLCDCFSDCG-------------------VCLCGTFCFTCLGCQVAADM--NECCLCGTTVAMRTLYRTRYGIPGSICDDYMVTLFCPVCSVCQLKRDIN 104          
BLAST of Placenta specific protein 8 vs. Ensembl Mouse
Match: Plac8 (placenta-specific 8 [Source:MGI Symbol;Acc:MGI:2445289])

HSP 1 Score: 48.9062 bits (115), Expect = 2.259e-7
Identity = 33/121 (27.27%), Postives = 55/121 (45.45%), Query Frame = 3
Query:  165 PTPVLVQPGVMANPMNINQTTVIIQQPVANGPRLWXXXXXXXXXXXXXXXLTMFFTHCYTCYLFHIYDEFLCTPICMYDSVLQLRTKHRARHGIRGTIIEDCCKTYWCYWCAICQLKRDMD 527
            PT ++ QPG +  P N N  T +       G                   + +  T C+TC    +  +      C+  + + +RT +R R+GI G+I +D   T +C  C++CQLKRD++
Sbjct:    5 PTVIVTQPGFVRAPQNSNWQTSLCDCFSDCG-------------------VCLCGTFCFTCLGCQVAADM--NECCLCGTTVAMRTLYRTRYGIPGSICDDYMVTLFCPVCSVCQLKRDIN 104          
BLAST of Placenta specific protein 8 vs. UniProt/SwissProt
Match: sp|Q9JI48|PLAC8_MOUSE (Placenta-specific gene 8 protein OS=Mus musculus OX=10090 GN=Plac8 PE=1 SV=1)

HSP 1 Score: 48.9062 bits (115), Expect = 1.580e-6
Identity = 33/121 (27.27%), Postives = 55/121 (45.45%), Query Frame = 3
Query:  165 PTPVLVQPGVMANPMNINQTTVIIQQPVANGPRLWXXXXXXXXXXXXXXXLTMFFTHCYTCYLFHIYDEFLCTPICMYDSVLQLRTKHRARHGIRGTIIEDCCKTYWCYWCAICQLKRDMD 527
            PT ++ QPG +  P N N  T +       G                   + +  T C+TC    +  +      C+  + + +RT +R R+GI G+I +D   T +C  C++CQLKRD++
Sbjct:    5 PTVIVTQPGFVRAPQNSNWQTSLCDCFSDCG-------------------VCLCGTFCFTCLGCQVAADM--NECCLCGTTVAMRTLYRTRYGIPGSICDDYMVTLFCPVCSVCQLKRDIN 104          
BLAST of Placenta specific protein 8 vs. TrEMBL
Match: G7YSZ5 (Cornifelin OS=Clonorchis sinensis OX=79923 GN=CLF_109843 PE=4 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.005e-16
Identity = 49/116 (42.24%), Postives = 74/116 (63.79%), Query Frame = 3
Query:  216 NQTTVIIQQPVANGP--RLWXXXXXXXXXXXXXXXLTMFFTHCYTCYLFHIYDEFLCTPICMYDSVLQLRTKHRARHGIRGTIIEDCCKTYWCYWCAICQLKRDMDYVEDTKGSLD 557
            ++  VI++QP A+G   R W+ G+  C ++ ++C LT F   C TCYL+  Y E   TP  +  S + L  +HR R+GIRG+I+EDC    +C  CAIC+L RDM +VE+ +G+L+
Sbjct:    5 DRGNVILEQPRASGTPYRAWNDGLWDCGNNHSNCFLTAFCYTCMTCYLYEKYGEGCLTPCIIPMSAMVLTVQHRNRNGIRGSILEDCLTHAFCSPCAICRLYRDMKFVEEIRGTLN 120          
BLAST of Placenta specific protein 8 vs. TrEMBL
Match: A0A4S2L497 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010419 PE=4 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.124e-16
Identity = 50/116 (43.10%), Postives = 71/116 (61.21%), Query Frame = 3
Query:  216 NQTTVIIQQPVANGP--RLWXXXXXXXXXXXXXXXLTMFFTHCYTCYLFHIYDEFLCTPICMYDSVLQLRTKHRARHGIRGTIIEDCCKTYWCYWCAICQLKRDMDYVEDTKGSLD 557
            ++  VI++QP A+G   R W+ G+  C ++ T+  LT F   C TCYL+  Y E   TP  +  S + L  +HR R+GIRG I+EDC     C  CA+C+L RDM +VE+ KGSL+
Sbjct:    6 DRRNVILEQPRASGNPYRAWNDGLWDCGNNYTNSFLTAFCYTCMTCYLYEKYGEGCLTPCIIPMSAMVLTVQHRNRNGIRGNILEDCLTHAVCSPCAMCRLYRDMQFVEEIKGSLN 121          
BLAST of Placenta specific protein 8 vs. TrEMBL
Match: A0A075A451 (Putative Cys-rich domain protein OS=Opisthorchis viverrini OX=6198 GN=T265_03197 PE=4 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.804e-16
Identity = 51/116 (43.97%), Postives = 73/116 (62.93%), Query Frame = 3
Query:  216 NQTTVIIQQPVANGP--RLWXXXXXXXXXXXXXXXLTMFFTHCYTCYLFHIYDEFLCTPICMYDSVLQLRTKHRARHGIRGTIIEDCCKTYWCYWCAICQLKRDMDYVEDTKGSLD 557
            ++  VI++QP A+G   R W+ G+  C ++ T+C LT F   C TC+L+  Y E   TP  +  S + L  +HR R+GIRG I+EDC    +C  CAIC+L RDM +VE+ KGSL+
Sbjct:    5 DRGNVILEQPRASGNSYRAWNDGLWDCGNNYTNCFLTAFCYTCMTCHLYGKYGEGCLTPCIVPMSAMVLTVQHRNRNGIRGNILEDCLTHAFCSPCAICRLYRDMQFVEEIKGSLN 120          
BLAST of Placenta specific protein 8 vs. TrEMBL
Match: A0A0P0DI19 (Placenta specific protein 8 OS=Dugesia japonica OX=6161 GN=Plac 8 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.292e-16
Identity = 52/124 (41.94%), Postives = 74/124 (59.68%), Query Frame = 3
Query:  183 QPGVMANPMNINQTTVIIQQPVANGPRLWXXXXXXXXXXXXXXXLTMFFTHCYTCYLFHIYDEFLCTPICMYDSVLQLRTKHRARHGIRGTIIEDCCKTYWCYWCAICQLKRDMDYVEDTKGSL 554
            QPG  +         V+I QP +   R+WSS IC C +D   C  + FF  CY C ++  Y+E  C+ + + +S++ LR +HR RHGI+GTI +DC K+     C +CQLKRDM ++  TKGSL
Sbjct:   17 QPGKTSE-------NVVISQPKSE--RMWSSEICSCFEDIEICLWSTFFPQCYLCCMYMEYNECFCSSLLVPNSLMALRIQHRNRHGIKGTICDDCIKSTCYGPCTMCQLKRDMKHIISTKGSL 131          
BLAST of Placenta specific protein 8 vs. TrEMBL
Match: A0A5J4NRE5 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0010981 PE=4 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 4.956e-16
Identity = 56/133 (42.11%), Postives = 72/133 (54.14%), Query Frame = 3
Query:  168 TPVLVQPGVMANPMNINQTTVIIQQPV---ANGPRLWXXXXXXXXXXXXXXXLTMFFTHCYTCYLFHIYDEFLCTPICMYDSVLQLRTKHRARHGIRGTIIEDCCKTYWCYWCAICQLKRDMDYVEDTKGSLD 557
            TP+L QP         NQ  VI+ QP      G R W  G+C C ++C +C LT FF  C  C+++  Y E  CTP  +  S + L  KHR+RH I G+I  DCC    C  CA+C+L RDM YVE   G+L 
Sbjct:   29 TPLLSQP---------NQINVIVNQPEPTRGTGYRDWHDGLCSCGNNCGNCLLTAFFYPCVECHMYQRYGECCCTPCVIPMSGMVLAVKHRSRHRIVGSISGDCCTFMCCAPCALCRLYRDMVYVEGVNGTLS 152          
BLAST of Placenta specific protein 8 vs. Ensembl Cavefish
Match: ponzr5 (cornifelin homolog B-like [Source:NCBI gene;Acc:103036465])

HSP 1 Score: 46.9802 bits (110), Expect = 1.134e-6
Identity = 22/68 (32.35%), Postives = 36/68 (52.94%), Query Frame = 3
Query:  336 CYTCYLFHIYDEFLCTPICMYDSV----LQLRTKHRARHGIRGTIIEDCCKTYWCYWCAICQLKRDMD 527
            C+ C     + E LC P+  +  +    L +R+  R R+GI G+I  DC  +++C  C  CQ+ R+M 
Sbjct:   44 CFACSTSKKFGECLCLPLLEFGFIPPITLAMRSSMRQRYGIEGSICNDCVYSFFCCPCVWCQMSREMK 111          
BLAST of Placenta specific protein 8 vs. Ensembl Cavefish
Match: ponzr5 (cornifelin homolog B-like [Source:NCBI gene;Acc:103036465])

HSP 1 Score: 46.9802 bits (110), Expect = 1.134e-6
Identity = 22/68 (32.35%), Postives = 36/68 (52.94%), Query Frame = 3
Query:  336 CYTCYLFHIYDEFLCTPICMYDSV----LQLRTKHRARHGIRGTIIEDCCKTYWCYWCAICQLKRDMD 527
            C+ C     + E LC P+  +  +    L +R+  R R+GI G+I  DC  +++C  C  CQ+ R+M 
Sbjct:   44 CFACSTSKKFGECLCLPLLEFGFIPPITLAMRSSMRQRYGIEGSICNDCVYSFFCCPCVWCQMSREMK 111          
BLAST of Placenta specific protein 8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001184.1 (pep scaffold:Pmarinus_7.0:GL488356:6425:7851:-1 gene:ENSPMAG00000001063.1 transcript:ENSPMAT00000001184.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.3654 bits (111), Expect = 7.866e-8
Identity = 24/70 (34.29%), Postives = 39/70 (55.71%), Query Frame = 3
Query:  321 MFFTHCYTCYLFHIYDEFLCTPICMYDSVLQLRTKHRARHGIRGTIIEDCCKTYWCYWCAICQLKRDMDY 530
            +F   C  C +   + E  C PI +  S + LRT  R R+ I+G+I +DC    +C+ CA CQ+ R++ +
Sbjct:   15 IFCMLCLNCRMAKDFGECFCLPI-LPGSSMALRTAIRERYHIQGSICDDCVMLTFCFCCATCQMAREIKH 83          
BLAST of Placenta specific protein 8 vs. Planmine SMEST
Match: SMESG000050177.1 (SMESG000050177.1)

HSP 1 Score: 258.84 bits (660), Expect = 4.186e-89
Identity = 139/140 (99.29%), Postives = 140/140 (100.00%), Query Frame = 3
Query:  138 MQYDNRGFLPTPVLVQPGVMANPMNINQTTVIIQQPVANGPRLWXXXXXXXXXXXXXXXLTMFFTHCYTCYLFHIYDEFLCTPICMYDSVLQLRTKHRARHGIRGTIIEDCCKTYWCYWCAICQLKRDMDYVEDTKGSLD 557
            MQYDNRGFLPTPVLVQPGVMANPMNINQTTVIIQQPVANGPRLWSSGICGCC+DCTSCCLTMFFTHCYTCYLFHIYDEFLCTPICMYDSVLQLRTKHRARHGIRGTIIEDCCKTYWCYWCAICQLKRDMDYVEDTKGSLD
Sbjct:    1 MQYDNRGFLPTPVLVQPGVMANPMNINQTTVIIQQPVANGPRLWSSGICGCCEDCTSCCLTMFFTHCYTCYLFHIYDEFLCTPICMYDSVLQLRTKHRARHGIRGTIIEDCCKTYWCYWCAICQLKRDMDYVEDTKGSLD 140          
BLAST of Placenta specific protein 8 vs. Planmine SMEST
Match: SMESG000050175.1 (SMESG000050175.1)

HSP 1 Score: 134.035 bits (336), Expect = 5.474e-40
Identity = 82/141 (58.16%), Postives = 100/141 (70.92%), Query Frame = 3
Query:  138 MQYDNRGFLPTPVLVQPGVMANPMNINQTTVIIQQPVA-NGPRLWXXXXXXXXXXXXXXXLTMFFTHCYTCYLFHIYDEFLCTPICMYDSVLQLRTKHRARHGIRGTIIEDCCKTYWCYWCAICQLKRDMDYVEDTKGSLD 557
            MQYDN G     V++QPGV   P   NQT +I QQP   N PR WSS + GCC+DCTSC L++ F  CY CYL+  ++EF+CTP+    S+L LRTKHRARH I+GTI+ D CK Y CY C +CQLKRDM+YVE+T GSLD
Sbjct:    1 MQYDNNGLPCNTVIIQPGV---PTYGNQTVIIQQQPNQRNLPRDWSSELFGCCEDCTSCWLSLCFAECYLCYLYSKHNEFVCTPLFTPSSLLLLRTKHRARHRIKGTIMGDACKIYCCYICTMCQLKRDMNYVEETNGSLD 138          
BLAST of Placenta specific protein 8 vs. Planmine SMEST
Match: SMESG000050244.1 (SMESG000050244.1)

HSP 1 Score: 112.079 bits (279), Expect = 1.767e-31
Identity = 71/132 (53.79%), Postives = 87/132 (65.91%), Query Frame = 3
Query:  162 LPTPVLVQPGVMANPMNINQTTVIIQQPVANGPRLWXXXXXXXXXXXXXXXLTMFFTHCYTCYLFHIYDEFLCTPICMYDSVLQLRTKHRARHGIRGTIIEDCCKTYWCYWCAICQLKRDMDYVEDTKGSLD 557
            + T ++ QPG      + NQ      Q      R WSSG+  CCDDCTSC L  F   CY CY++HIY EF+CTP+    S L LRTKHR+R+ I+G+II DCC TYWCY+CA+CQLKRDMDYVED  G L+
Sbjct:    1 MTTVIITQPG------HKNQVITRQDQIPRTTYRNWSSGLFDCCDDCTSCVLIAFCPECYLCYMYHIYYEFVCTPLFTPASTLLLRTKHRSRNHIKGSIIADCCLTYWCYFCAMCQLKRDMDYVEDKNGYLE 126          
BLAST of Placenta specific protein 8 vs. Planmine SMEST
Match: SMESG000050244.1 (SMESG000050244.1)

HSP 1 Score: 110.923 bits (276), Expect = 5.429e-31
Identity = 72/135 (53.33%), Postives = 89/135 (65.93%), Query Frame = 3
Query:  162 LPTPVLVQPGVMANPMNINQTTVII---QQPVANGPRLWXXXXXXXXXXXXXXXLTMFFTHCYTCYLFHIYDEFLCTPICMYDSVLQLRTKHRARHGIRGTIIEDCCKTYWCYWCAICQLKRDMDYVEDTKGSLD 557
            + T ++ QPG      + NQ   +I    Q      R WSSG+  CCDDCTSC L  F   CY CY++HIY EF+CTP+    S L LRTKHR+R+ I+G+II DCC TYWCY+CA+CQLKRDMDYVED  G L+
Sbjct:    1 MTTVIITQPG------HKNQVAPVITRQDQIPRTTYRNWSSGLFDCCDDCTSCVLIAFCPECYLCYMYHIYYEFVCTPLFTPASTLLLRTKHRSRNHIKGSIIADCCLTYWCYFCAMCQLKRDMDYVEDKNGYLE 129          
BLAST of Placenta specific protein 8 vs. Planmine SMEST
Match: SMESG000050245.1 (SMESG000050245.1)

HSP 1 Score: 108.612 bits (270), Expect = 3.742e-30
Identity = 69/132 (52.27%), Postives = 83/132 (62.88%), Query Frame = 3
Query:  162 LPTPVLVQPGVMANPMNINQTTVIIQQPVANGPRLWXXXXXXXXXXXXXXXLTMFFTHCYTCYLFHIYDEFLCTPICMYDSVLQLRTKHRARHGIRGTIIEDCCKTYWCYWCAICQLKRDMDYVEDTKGSLD 557
            + T  + QPG        NQ      Q      R WSSG+  CCDDC SC    F   CY CY++HIY EF+CTP+    S L LRTKHR+R+ I+G+II DCC TYWCY+CA+CQLKRDMDYVED  G L+
Sbjct:    1 MTTVFVTQPG------QGNQAITRQNQIAEPTYRNWSSGLFDCCDDCASCWCVTFCPECYLCYMYHIYYEFVCTPLFTPASTLLLRTKHRSRNHIKGSIIADCCLTYWCYFCAMCQLKRDMDYVEDKNGYLE 126          
The following BLAST results are available for this feature:
BLAST of Placenta specific protein 8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Placenta specific protein 8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Placenta specific protein 8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Placenta specific protein 8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ponzr53.796e-631.58plac8 onzin related protein 5 [Source:ZFIN;Acc:ZDB... [more]
ponzr54.136e-631.58plac8 onzin related protein 5 [Source:ZFIN;Acc:ZDB... [more]
plac8.27.979e-632.32placenta associated 8, tandem duplicate 2 [Source:... [more]
plac8.27.979e-632.32placenta associated 8, tandem duplicate 2 [Source:... [more]
back to top
BLAST of Placenta specific protein 8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ifi354.698e-839.71interferon induced protein 35 [Source:Xenbase;Acc:... [more]
ENSXETT00000008293.14.798e-839.71novel protein similar to cornifelin [Source:NCBI g... [more]
ifi354.885e-839.71interferon induced protein 35 [Source:Xenbase;Acc:... [more]
myo194.953e-632.35myosin XIX [Source:Xenbase;Acc:XB-GENE-999897][more]
back to top
BLAST of Placenta specific protein 8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Plac82.259e-727.27placenta-specific 8 [Source:MGI Symbol;Acc:MGI:244... [more]
Plac82.259e-727.27placenta-specific 8 [Source:MGI Symbol;Acc:MGI:244... [more]
Plac82.259e-727.27placenta-specific 8 [Source:MGI Symbol;Acc:MGI:244... [more]
back to top
BLAST of Placenta specific protein 8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q9JI48|PLAC8_MOUSE1.580e-627.27Placenta-specific gene 8 protein OS=Mus musculus O... [more]
back to top
BLAST of Placenta specific protein 8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7YSZ51.005e-1642.24Cornifelin OS=Clonorchis sinensis OX=79923 GN=CLF_... [more]
A0A4S2L4971.124e-1643.10Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A075A4511.804e-1643.97Putative Cys-rich domain protein OS=Opisthorchis v... [more]
A0A0P0DI193.292e-1641.94Placenta specific protein 8 OS=Dugesia japonica OX... [more]
A0A5J4NRE54.956e-1642.11Uncharacterized protein OS=Paragonimus westermani ... [more]
back to top
BLAST of Placenta specific protein 8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ponzr51.134e-632.35cornifelin homolog B-like [Source:NCBI gene;Acc:10... [more]
ponzr51.134e-632.35cornifelin homolog B-like [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Placenta specific protein 8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000001184.17.866e-834.29pep scaffold:Pmarinus_7.0:GL488356:6425:7851:-1 ge... [more]
back to top
BLAST of Placenta specific protein 8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Placenta specific protein 8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Placenta specific protein 8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Placenta specific protein 8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000050177.14.186e-8999.29SMESG000050177.1[more]
SMESG000050175.15.474e-4058.16SMESG000050175.1[more]
SMESG000050244.11.767e-3153.79SMESG000050244.1[more]
SMESG000050244.15.429e-3153.33SMESG000050244.1[more]
SMESG000050245.13.742e-3052.27SMESG000050245.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023073 ID=SMED30023073|Name=Placenta specific protein 8|organism=Schmidtea mediterranea sexual|type=transcript|length=651bp
CATATCTTTCGCTATTGTTCAACTATCTGATTGGTATGCTAGGCCTTTTA
TTTAGCTAAACCGAATCGCAATTGTCAATTTTAAGAAATATTTAGAAAAA
TTTAGAGAAAACTAGAATTTCATTCAACACTACCAAAATGCAATATGATA
ACCGAGGATTTCTTCCAACTCCGGTTCTTGTCCAACCAGGAGTAATGGCT
AACCCGATGAATATCAATCAAACAACTGTCATTATCCAACAGCCGGTTGC
AAATGGGCCACGGCTCTGGAGTTCAGGAATCTGTGGGTGTTGCGATGATT
GTACATCATGTTGTTTGACGATGTTCTTCACACATTGTTACACGTGCTAT
TTGTTCCATATATACGACGAATTCCTTTGCACTCCGATTTGCATGTACGA
TTCAGTTCTACAATTGAGGACCAAGCACCGGGCCCGACATGGTATTAGGG
GCACAATAATCGAGGATTGTTGCAAAACATATTGGTGTTACTGGTGCGCT
ATATGTCAACTGAAGCGTGACATGGATTATGTAGAAGATACAAAAGGATC
CCTTGATTAATTGAACAATTTCAGAACCACCTAAACTAATAATAACTGTT
AATTTTACAGGATATTGCTTCTGATAAATTACAATTTGTTTGATAAAAAA
A
back to top

protein sequence of SMED30023073-orf-1

>SMED30023073-orf-1 ID=SMED30023073-orf-1|Name=SMED30023073-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=141bp
MQYDNRGFLPTPVLVQPGVMANPMNINQTTVIIQQPVANGPRLWSSGICG
CCDDCTSCCLTMFFTHCYTCYLFHIYDEFLCTPICMYDSVLQLRTKHRAR
HGIRGTIIEDCCKTYWCYWCAICQLKRDMDYVEDTKGSLD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR006461PLAC_motif_containing
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006461PLAC8 motif-containing proteinTIGRFAMTIGR01571TIGR01571coord: 43..129
e-value: 1.2E-13
score: 49.7
IPR006461PLAC8 motif-containing proteinPFAMPF04749PLAC8coord: 44..127
e-value: 1.2E-10
score: 42.3
IPR006461PLAC8 motif-containing proteinPANTHERPTHR15907FAMILY NOT NAMEDcoord: 27..132
NoneNo IPR availablePANTHERPTHR15907:SF93PLACENTA-SPECIFIC 8, TANDEM DUPLICATE 1-RELATEDcoord: 27..132