Helicase POLQ-like protein

Overview
NameHelicase POLQ-like protein
Smed IDSMED30023063
Length (bp)2922
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Helicase POLQ-like protein (SMED30023063) t-SNE clustered cells

Violin plots show distribution of expression levels for Helicase POLQ-like protein (SMED30023063) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Helicase POLQ-like protein (SMED30023063) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Helicase POLQ-like protein (SMED30023063) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023063

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30023063 SmedASXL_014025SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30023063 dd_Smed_v4_13290_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30023063 dd_Smed_v6_13290_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30023063 dd_Smed_v4_13290_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023063 SMED30023063smed_20140614PMID:27523733
Lei et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30023063 SMED_03251_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30023063 SMED_03251_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30023063 SMED_20165_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30023063 SMED_20165_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30023063 SmWIOct06_014057GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30023063 SMED_25797_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30023063 SMED_25797_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Helicase POLQ-like protein vs. Ensembl Human
Match: HELQ (helicase, POLQ like [Source:HGNC Symbol;Acc:HGNC:18536])

HSP 1 Score: 635.565 bits (1638), Expect = 0.000e+0
Identity = 329/774 (42.51%), Postives = 502/774 (64.86%), Query Frame = 1
Query:  247 KIQELLKFHRGIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHARIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDELFRQIDAECLG-VCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQN-----PGALGEILKSEVQYLIDHDLVRQ---VKSDSDNEICVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLKIDEYSLRRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKELLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASAESRALHEILNPISGKLVRQIISSAKMNIQEKLEALSEEYKELV 2541
            K+++L    +GI+KLY+WQ  CL +  + + +NL+YSLPTSGGKTLVAEILML++L   ++ V+ ILPY+A+VQEK+  LS FG++L F VEEYAG KG++PPTK  +  S+Y+ATIEK HSL+NSLIET +I  +GL+VVDELHMIG+GS RGA LE+ L K +      +I+GMSATL+N+ ++ +FL A  + S FRP+EL E++K++  I+ ++S+      E   +  R L    +  ++KMDPD+++ LV+E++P+ SC++FCP+K+ CEN+A  I K    + L   +K K++ E+ + +     G +CP L++ I  G+AYHHSGLT +ERK++EEA+  G + +  CTSTLAAGVNLPARRVI+RAPYV K+ +K +QYKQM GRAGR G D  GE  +I+ +KD+ +   LI +    C S ++ E  + I+   LS I L++    +DI  F+ G+ F +Q        +L EI    ++YL +  L+++    KS+ + +      T+LGRA  +G+ID+     +Y DLK     L L + LH++Y+ TP+D+V+   P W  Y ++  +L  +++ +   +GV+E  I     G    K K+D+  + RLY + +LY L  + +I+ V+  +    G++Q+LL    S+S+C+ +F EE   +FW Y+ LL +LT +L +CV  ELIPLME+ GV + RA +LY AGY +++ +A+A    L   ++ +S +  +QI+SSAKM + EK EAL EE +EL+
Sbjct:  322 KVRDLYAQFKGIEKLYEWQHTCLTLNSVQERKNLIYSLPTSGGKTLVAEILMLQELLCCRKDVLMILPYVAIVQEKISGLSSFGIELGFFVEEYAGSKGRFPPTKRREKKSLYIATIEKGHSLVNSLIETGRIDSLGLVVVDELHMIGEGS-RGATLEMTLAKILYTSKTTQIIGMSATLNNVEDLQKFLQAEYYTSQFRPVELKEYLKINDTIYEVDSKA-----ENGMTFSRLLNYKYSDTLKKMDPDHLVALVTEVIPNYSCLVFCPSKKNCENVAEMICKFLSKEYL--KHKEKEKCEVIKNLKNIGNGNLCPVLKRTIPFGVAYHHSGLTSDERKLLEEAYSTGVLCLFTCTSTLAAGVNLPARRVILRAPYVAKEFLKRNQYKQMIGRAGRAGIDTIGESILILQEKDKQQVLELITKPLENCYSHLVQEFTKGIQTLFLSLIGLKIATNLDDIYHFMNGTFFGVQQKVLLKEKSLWEITVESLRYLTEKGLLQKDTIYKSEEEVQYN-FHITKLGRASFKGTIDLAYCDILYRDLKKGLEGLVLESLLHLIYLTTPYDLVSQCNPDWMIYFRQFSQLSPAEQNVAAILGVSESFIGKKASGQAIGK-KVDKNVVNRLYLSFVLYTLLKETNIWTVSEKFNMPRGYIQNLLTGTASFSSCVLHFCEELE-EFWVYRALLVELTKKLTYCVKAELIPLMEVTGVLEGRAKQLYSAGYKSLMHLANANPEVLVRTIDHLSRRQAKQIVSSAKMLLHEKAEALQEEVEELL 1084          
BLAST of Helicase POLQ-like protein vs. Ensembl Human
Match: HELQ (helicase, POLQ like [Source:HGNC Symbol;Acc:HGNC:18536])

HSP 1 Score: 478.019 bits (1229), Expect = 6.401e-152
Identity = 280/774 (36.18%), Postives = 442/774 (57.11%), Query Frame = 1
Query:  247 KIQELLKFHRGIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHARIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDELFRQIDAECLG-VCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQNP-----GALGEILKSEVQYLIDHDLVRQ---VKSDSDNEICVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLKIDEYSLRRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKELLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASAESRALHEILNPISGKLVRQIISSAKMNIQEKLEALSEEYKELV 2541
            K+++L    +GI+KLY+WQ  CL +  + + +NL+YSLPTSGGKTLVAEILML++L   ++ V+ ILPY+A+VQEK+  +               G +G               AT+E   + I    +T QI  IG+     L+ + D           L KF++                         A  + S FRP+EL E++K++  I+ ++S+      E   +  R L    +  ++KMDPD+++ LV+E++P+ SC++FCP+K+ CEN+A  I K    + L   +K K++ E+ + +     G +CP L++ I  G+AYHHSGLT +ERK++EEA+  G + +  CTSTLAAGVNLPARRVI+RAPYV K+ +K +QYKQM GRAGR G D  GE  +I+ +KD+ +   LI +    C S ++ E  + I+   LS I L++    +DI  F+ G+ F +Q        +L EI    ++YL +  L+++    KS+ + +      T+LGRA  +G+ID+     +Y DLK     L L + LH++Y+ TP+D+V+   P W  Y ++  +L  +++ +   +GV+E  I     G    K K+D+  + RLY + +LY L  + +I+ V+  +    G++Q+LL    S+S+C+ +F EE   +FW Y+ LL +LT +L +CV  ELIPLME+ GV + RA +LY AGY +++ +A+A    L   ++ +S +  +QI+SSAKM + EK EAL EE +EL+
Sbjct:  322 KVRDLYAQFKGIEKLYEWQHTCLTLNSVQERKNLIYSLPTSGGKTLVAEILMLQELLCCRKDVLMILPYVAIVQEKLHMIG-------------EGSRG---------------ATLEMTLAKILYTSKTTQI--IGMSAT--LNNVED-----------LQKFLQ-------------------------AEYYTSQFRPVELKEYLKINDTIYEVDSKA-----ENGMTFSRLLNYKYSDTLKKMDPDHLVALVTEVIPNYSCLVFCPSKKNCENVAEMICKFLSKEYL--KHKEKEKCEVIKNLKNIGNGNLCPVLKRTIPFGVAYHHSGLTSDERKLLEEAYSTGVLCLFTCTSTLAAGVNLPARRVILRAPYVAKEFLKRNQYKQMIGRAGRAGIDTIGESILILQEKDKQQVLELITKPLENCYSHLVQEFTKGIQTLFLSLIGLKIATNLDDIYHFMNGTFFGVQQKVLLKEKSLWEITVESLRYLTEKGLLQKDTIYKSEEEVQYN-FHITKLGRASFKGTIDLAYCDILYRDLKKGLEGLVLESLLHLIYLTTPYDLVSQCNPDWMIYFRQFSQLSPAEQNVAAILGVSESFIGKKASGQAIGK-KVDKNVVNRLYLSFVLYTLLKETNIWTVSEKFNMPRGYIQNLLTGTASFSSCVLHFCEELE-EFWVYRALLVELTKKLTYCVKAELIPLMEVTGVLEGRAKQLYSAGYKSLMHLANANPEVLVRTIDHLSRRQAKQIVSSAKMLLHEKAEALQEEVEELL 1017          
BLAST of Helicase POLQ-like protein vs. Ensembl Human
Match: POLQ (DNA polymerase theta [Source:HGNC Symbol;Acc:HGNC:9186])

HSP 1 Score: 334.339 bits (856), Expect = 1.748e-95
Identity = 252/770 (32.73%), Postives = 389/770 (50.52%), Query Frame = 1
Query:  259 LLKFHR-GIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHA---------------RIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQ-KMDPDNVIGLVSEILPDK-SCIIFCPTKRQCENLANNIIK-----------LTDPKLLIPD-YKVKKRDELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELI-----KTFEDI-----VEFLQGSLFS-------IQNPGALGEILKSEVQYLIDHDLVRQVKSDSDNEICVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITP-SWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLKIDEYSL---RRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKE-LLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASA 2412
            L K+H  G+ K+++WQ ECL +  + + +NLVYS PTS GKTLVAE+L+LK++   ++  +FILP++++ +EK   L     ++   V+ Y G      P++H     + V TIE+A+ LIN LIE N++  +G++VVDELHM+GD S RG  LEL L K   +   +               +IVGMSATL NL  +  +L+A  + +DFRP+ L E VKV   I+  + +L            R  EP    M+Q K D D+V+ L  E + D  S ++FCP+K+ CE LA+ I +           L  P    P   + K+  E+  Q+     G+   L++ +  G+A+HH+GLT EER ++E AF  G I V+  TSTL++GVNLPARRVIIR P  G   +    YKQM GRAGRKG D  GE  +I    ++ K   L+  +    +S +       +   ++ AI LE+I      T +D+       FL  S+          Q    LG I ++ V +L++++ ++  ++    E  V   T LG A +  S+      +I++DL+ A     L   LH+LY+VTP  M    T   W  +     KL  S K + + +GV E  +     G   ++ +     +   +R + +L+L DL  +  + E+   Y  + G +QSL  +A  Y+  +  F        W   E LL +   RL   +  EL  L+ +  +   RA  LY +G+ T+  +A A
Sbjct:   81 LEKYHSFGVKKMFEWQAECLLLGQVLEGKNLVYSAPTSAGKTLVAELLILKRVLEMRKKALFILPFVSVAKEKKYYLQSLFQEVGIKVDGYMGSTS---PSRHFSSLDIAVCTIERANGLINRLIEENKMDLLGMVVVDELHMLGD-SHRGYLLELLLTKICYITRKSASCQADLASSLSNAVQIVGMSATLPNLELVASWLNAELYHTDFRPVPLLESVKVGNSIYDSSMKLV-----------REFEP----MLQVKGDEDHVVSLCYETICDNHSVLLFCPSKKWCEKLADIIAREFYNLHHQAEGLVKPSECPPVILEQKELLEVMDQLRRLPSGLDSVLQKTVPWGVAFHHAGLTFEERDIIEGAFRQGLIRVLAATSTLSSGVNLPARRVIIRTPIFGGRPLDILTYKQMVGRAGRKGVDTVGESILICKNSEKSKGIALLQGSLKPVRSCLQRREGEEVTGSMIRAI-LEIIVGGVASTSQDMHTYAACTFLAASMKEGKQGIQRNQESVQLGAI-EACVMWLLENEFIQSTEASDGTEGKVYHPTHLGSATLSSSLSPADTLDIFADLQRAMKGFVLENDLHILYLVTP--MFEDWTTIDWYRFFCLWEKLPTSMKRVAELVGVEEGFLARCVKGKVVARTERQHRQMAIHKRFFTSLVLLDLISEVPLREINQKYGCNRGQIQSLQQSAAVYAGMITVFSNRLG---WHNMELLLSQFQKRLTFGIQRELCDLVRVSLLNAQRARVLYASGFHTVADLARA 824          
BLAST of Helicase POLQ-like protein vs. Ensembl Human
Match: POLQ (DNA polymerase theta [Source:HGNC Symbol;Acc:HGNC:9186])

HSP 1 Score: 333.954 bits (855), Expect = 2.324e-95
Identity = 252/772 (32.64%), Postives = 389/772 (50.39%), Query Frame = 1
Query:  259 LLKFHR-GIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHA---------------RIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQ-KMDPDNVIGLVSEILPDK-SCIIFCPTKRQCENLANNIIK-------------LTDPKLLIPD-YKVKKRDELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELI-----KTFEDI-----VEFLQGSLFS-------IQNPGALGEILKSEVQYLIDHDLVRQVKSDSDNEICVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITP-SWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLKIDEYSL---RRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKE-LLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASA 2412
            L K+H  G+ K+++WQ ECL +  + + +NLVYS PTS GKTLVAE+L+LK++   ++  +FILP++++ +EK   L     ++   V+ Y G      P++H     + V TIE+A+ LIN LIE N++  +G++VVDELHM+GD S RG  LEL L K   +   +               +IVGMSATL NL  +  +L+A  + +DFRP+ L E VKV   I+  + +L            R  EP    M+Q K D D+V+ L  E + D  S ++FCP+K+ CE LA+ I +             L  P    P   + K+  E+  Q+     G+   L++ +  G+A+HH+GLT EER ++E AF  G I V+  TSTL++GVNLPARRVIIR P  G   +    YKQM GRAGRKG D  GE  +I    ++ K   L+  +    +S +       +   ++ AI LE+I      T +D+       FL  S+          Q    LG I ++ V +L++++ ++  ++    E  V   T LG A +  S+      +I++DL+ A     L   LH+LY+VTP  M    T   W  +     KL  S K + + +GV E  +     G   ++ +     +   +R + +L+L DL  +  + E+   Y  + G +QSL  +A  Y+  +  F        W   E LL +   RL   +  EL  L+ +  +   RA  LY +G+ T+  +A A
Sbjct:  214 LEKYHSFGVKKMFEWQAECLLLGQVLEGKNLVYSAPTSAGKTLVAELLILKRVLEMRKKALFILPFVSVAKEKKYYLQSLFQEVGIKVDGYMGSTS---PSRHFSSLDIAVCTIERANGLINRLIEENKMDLLGMVVVDELHMLGD-SHRGYLLELLLTKICYITRKSASCQADLASSLSNAVQIVGMSATLPNLELVASWLNAELYHTDFRPVPLLESVKVGNSIYDSSMKLV-----------REFEP----MLQVKGDEDHVVSLCYETICDNHSVLLFCPSKKWCEKLADIIAREFYNLHHQAEGEGLVKPSECPPVILEQKELLEVMDQLRRLPSGLDSVLQKTVPWGVAFHHAGLTFEERDIIEGAFRQGLIRVLAATSTLSSGVNLPARRVIIRTPIFGGRPLDILTYKQMVGRAGRKGVDTVGESILICKNSEKSKGIALLQGSLKPVRSCLQRREGEEVTGSMIRAI-LEIIVGGVASTSQDMHTYAACTFLAASMKEGKQGIQRNQESVQLGAI-EACVMWLLENEFIQSTEASDGTEGKVYHPTHLGSATLSSSLSPADTLDIFADLQRAMKGFVLENDLHILYLVTP--MFEDWTTIDWYRFFCLWEKLPTSMKRVAELVGVEEGFLARCVKGKVVARTERQHRQMAIHKRFFTSLVLLDLISEVPLREINQKYGCNRGQIQSLQQSAAVYAGMITVFSNRLG---WHNMELLLSQFQKRLTFGIQRELCDLVRVSLLNAQRARVLYASGFHTVADLARA 959          
BLAST of Helicase POLQ-like protein vs. Ensembl Human
Match: HELQ (helicase, POLQ like [Source:HGNC Symbol;Acc:HGNC:18536])

HSP 1 Score: 206.453 bits (524), Expect = 4.204e-57
Identity = 97/165 (58.79%), Postives = 130/165 (78.79%), Query Frame = 1
Query:  247 KIQELLKFHRGIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFM 741
            K+++L    +GI+KLY+WQ  CL +  + + +NL+YSLPTSGGKTLVAEILML++L   ++ V+ ILPY+A+VQEK+  LS FG++L F VEEYAG KG++PPTK  +  S+Y+ATIEK HSL+NSLIET +I  +GL+VVDELHMIG+GS RGA LE+ L K +
Sbjct:  322 KVRDLYAQFKGIEKLYEWQHTCLTLNSVQERKNLIYSLPTSGGKTLVAEILMLQELLCCRKDVLMILPYVAIVQEKISGLSSFGIELGFFVEEYAGSKGRFPPTKRREKKSLYIATIEKGHSLVNSLIETGRIDSLGLVVVDELHMIGEGS-RGATLEMTLAKIL 485          
BLAST of Helicase POLQ-like protein vs. Ensembl Celegans
Match: helq-1 (HELicase Q homolog [Source:UniProtKB/TrEMBL;Acc:Q65XX0])

HSP 1 Score: 510.375 bits (1313), Expect = 4.741e-166
Identity = 296/782 (37.85%), Postives = 460/782 (58.82%), Query Frame = 1
Query:  256 ELLKFHRGIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHARIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKL----------TDPKLLIPDYKVKKRDELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQ-NPGALGEILKSEVQYLIDH------DLVRQVKSDSDNEICV-------LKATELGRAVVRGSIDVIRVKEIYSDLKSAEN-SLNLATYLHMLYIVTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLKIDEYSLRRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKELLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASAESRALHEILNPISGKLVRQIISSAKMNIQEKLEALSEE 2526
            E+ +  + +DK YDWQ ECL    +    N + SLPT  GKTL+AE+LML++  +++R+ I +LPY+A+VQEK+ AL+PF       +EEYA  KG++PP K  K  SVYVATIEKA+ LINSLI   Q+ ++G++VVDELHMIGDG  RGA LE  L KF+   G  +IVGMSATL N+ ++   L A  + ++FRP+EL+EFVK+ + +H+++            +P  +L   P   ++  DPD +  L+++++P  S +IFCP K+ CEN+A  I K            +    +  Y     DE   ++DA        L+Q I  G+AYHHSGLTQ+ERK VE AF++G I V+C TSTLAAGVNLP RRVII+AP VG++ +  +QY QMAGRAGR GFD KG+C  I+   + +++   +L+ S + +      +   +  F+L  + L+L +  E+I+  ++ SLF  Q +P  + ++++S V+ L +H       L + V S+   +          +  ++LG AV     D      +++DL S+ N  +  A++ H+L+I+TP++ V +I  +W+ +      L +S+++LL   G+ E   F+LE    +  L      + RLY AL+L  +W+ + +Y VA  +    G++Q+ L +++S +A +A F E+     W  ++LLP+L  RL+    PEL+PLM + G++K RAA L+KAGY T+  IA A    L + L  I       II+SA+M ++++++   EE
Sbjct:  157 EMYRKIKKLDKFYDWQQECLSDKRLLDGENCILSLPTGAGKTLIAEVLMLREAIVRKRNAILVLPYVAIVQEKISALAPFEDAFGINIEEYASNKGRFPPIKRRKRVSVYVATIEKANMLINSLITQGQLDRVGMVVVDELHMIGDGG-RGAILEQLLAKFL-YKGTGQIVGMSATLPNIDDLKFALRAFVYSTNFRPVELTEFVKIGQTMHQVSEN-------GDLNPAGDL---PTNNLKSTDPDGICQLLAKLIPKNSAVIFCPNKKNCENVAVLIAKTLPAHIRQAKRAESDAFLQSYLSDNDDE---RMDA-------VLKQCILSGVAYHHSGLTQDERKCVEAAFMEGLIYVVCATSTLAAGVNLPVRRVIIKAPMVGRERLGKAQYLQMAGRAGRAGFDTKGDCITIIKAGEEERWFREMLK-SDIPRCMSSLSSEESMGSFILDCVVLKLAENIEEIMTAVRYSLFYAQESPENIRKLVESSVKRLEEHYFITIEPLEQDVASEPSAQASSIPRVPGKISPSDLGNAVFNAGFDPDEATRLHADLVSSLNQGVIFASHFHLLFIITPYEQVCNI--NWDLFLLMYNALPSSERKLLAECGLEEK--FILEAIITRVDLTAGTPRM-RLYIALMLQKIWNHEPMYTVAERFGVEKGWLQATLQSSISQAASIAKFSEKI-TTMWPLRKLLPELVQRLSEAAQPELLPLMTVDGIKKARAAILFKAGYKTVGMIARANPLKLVQELGTIRMAQANSIIASARMVLRDQVDEKMEE 909          
BLAST of Helicase POLQ-like protein vs. Ensembl Celegans
Match: helq-1 (HELicase Q homolog [Source:UniProtKB/TrEMBL;Acc:Q65XX0])

HSP 1 Score: 274.633 bits (701), Expect = 2.583e-82
Identity = 164/458 (35.81%), Postives = 267/458 (58.30%), Query Frame = 1
Query: 1198 LRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQ-NPGALGEILKSEVQYLIDH------DLVRQVKSDSDNEICV-------LKATELGRAVVRGSIDVIRVKEIYSDLKSAEN-SLNLATYLHMLYIVTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLKIDEYSLRRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKELLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASAESRALHEILNPISGKLVRQIISSAKMNIQEKLEALSEE 2526
            L+Q I  G+AYHHSGLTQ+ERK VE AF++G I V+C TSTLAAGVNLP RRVII+AP VG++ +  +QY QMAGRAGR GFD KG+C  I+   + +++   +L+ S + +      +   +  F+L  + L+L +  E+I+  ++ SLF  Q +P  + ++++S V+ L +H       L + V S+   +          +  ++LG AV     D      +++DL S+ N  +  A++ H+L+I+TP++ V +I  +W+ +      L +S+++LL   G+ E   F+LE    +  L      + RLY AL+L  +W+ + +Y VA  +    G++Q+ L +++S +A +A F E+     W  ++LLP+L  RL+    PEL+PLM + G++K RAA L+KAGY T+  IA A    L + L  I       II+SA+M ++++++   EE
Sbjct:    5 LKQCILSGVAYHHSGLTQDERKCVEAAFMEGLIYVVCATSTLAAGVNLPVRRVIIKAPMVGRERLGKAQYLQMAGRAGRAGFDTKGDCITIIKAGEEERWFREMLK-SDIPRCMSSLSSEESMGSFILDCVVLKLAENIEEIMTAVRYSLFYAQESPENIRKLVESSVKRLEEHYFITIEPLEQDVASEPSAQASSIPRVPGKISPSDLGNAVFNAGFDPDEATRLHADLVSSLNQGVIFASHFHLLFIITPYEQVCNI--NWDLFLLMYNALPSSERKLLAECGLEEK--FILEAIITRVDLTAGTPRM-RLYIALMLQKIWNHEPMYTVAERFGVEKGWLQATLQSSISQAASIAKFSEKI-TTMWPLRKLLPELVQRLSEAAQPELLPLMTVDGIKKARAAILFKAGYKTVGMIARANPLKLVQELGTIRMAQANSIIASARMVLRDQVDEKMEE 455          
BLAST of Helicase POLQ-like protein vs. Ensembl Celegans
Match: polq-1 (DNA polymerase theta [Source:UniProtKB/Swiss-Prot;Acc:A0FLQ6])

HSP 1 Score: 229.565 bits (584), Expect = 1.775e-61
Identity = 240/848 (28.30%), Postives = 378/848 (44.58%), Query Frame = 1
Query:  274 RGIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFM----RVFGHARIVGMSATLDNLSEICQFLH-AVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKS-CIIFCPTKRQCENLANNI------IKLTDPKLLIPDYKVKKRDELFRQIDAECLGVCP--TLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKD------------------------RDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDI-VEFLQGSLFSIQN-------PGALGEI-----LKSEVQYLIDHDLVRQVKSDS-DNEICVLKATELGRAVVRGSIDVIRVKEIYSD--LKSAEN---------SLNLATYL-------HMLYIVTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLKIDEYSLRRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSY-KELLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASAESRALHEILN---PISGK-----LVRQIISSAKMNIQEKLEALSEEYKELVVVRGASIATADEM 2580
            + I  L+DWQI+ L      + ++L++S PTS GK++VAE+L  K +A   R V+F+LPYI++ +EK+  +       +  V  + G +   P           V TIEKA SL N  +  +   +IG++VVDE+HM+ D SR GA++E  L K +          RI+GMSAT+  L  I ++L  A  F++ FRPI L   +        I S+L+              +   NK++++   D +I L  E     S  ++   +K   E  A NI      I  TD  LL    K +    LF +   E  G C    +   +  G+AYHH+GLT EER+ +E  F +  I ++  TSTLA+GVNLPA RV+I+A   G   +    Y+QM GRAGR G   +GE ++++ K D                        R      ILE      ++  S+   + K  + ++ +L+L     DI +E L  + F  Q+       P  LG       L  E    I  DL    ++ + D E+ +L      +   R  I + ++ +IYS   LK  +N         S N+  ++          + VTP ++       W+       KL +  K + K +GV+E  I     G    KL        R ++AL L+DL  + SIYEV++ Y    G +Q+L   + +Y+A +  F        W+Y K LL    TRL   V  EL  L+ I G+   RA  L++ G   +  +++ +S  L   L    P S       L   +    +M +      L E  +++++ R   +  + E+
Sbjct:   23 QNIKALFDWQIDVLNEARQFEDQHLIFSAPTSAGKSIVAELLSWK-VASTGRKVLFVLPYISVAREKLHQIQRCWRRDDISVCGFIGPQASNPNEWLGA-----VCTIEKAASLTNRALSEDWFEEIGMIVVDEMHMVFDSSR-GAHIEHMLSKVLLWNQSALEKVRIIGMSATIPELYRIGKWLDGAKVFEARFRPIVLQNHIV-------IGSELR--------------KSGDNKVLREFSEDPLILLTEESFRRNSQTLVMISSKLDAEKTALNIASRFHEINKTDSSLL-EILKERANGLLFIKHGLERNG-CKDRNVMSTLAWGVAYHHAGLTMEERECIELGFREKNIVILVATSTLASGVNLPAERVLIKAQPRGPSALTSLNYRQMVGRAGRTGHATRGETYLLIKKCDRDAVLKIIETPIDQGVLTRKRDAERTNLSRFILEGICTGLTTTRSQIHDLCKLLLFNSENLQL----SDIAIEMLLRNSFISQDENDDQLSPTQLGRAAIASSLPPEASLAIFEDLNSASRAIALDTELHMLYLVYFYKNS-RAQI-IQKIFKIYSIFILKKFKNLEPKFKKKISENITVHITNSIRKKQHFWHVTPINVSVWQECDWHHLFSIFSKLPSDHKRIAKLVGVSEKFILDQLQGRRNDKLLQIHI---RFFSALALFDLISEMSIYEVSHKYRIPRGCLQTLQSQSATYAAMIVAFCLRLG---WTYLKALLDGFATRLLFGVRSELSELVAIEGIDGQRARILHERGVTCLSHLSACDSSKLAHFLTLAVPYSSSNSNDGLGEWLFGEPRMRVDVAARTLKERARKVLIRRVQELGISVEL 828          
BLAST of Helicase POLQ-like protein vs. Ensembl Celegans
Match: Y54E2A.4 (pep chromosome:WBcel235:II:14768462:14778149:1 gene:WBGene00013189.1 transcript:Y54E2A.4b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y54E2A.4)

HSP 1 Score: 125.561 bits (314), Expect = 7.448e-29
Identity = 148/552 (26.81%), Postives = 237/552 (42.93%), Query Frame = 1
Query:  361 PTSGGKTLVAEILMLKQLAIKQ-RSVIFILPYIALVQEKVRALSP-FGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCL--LKFMRVFGHA-----RIVGMSATLDNLSEICQFL-----HAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKR--------DELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAP-YVGKDLIKFSQYK-----QMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGS-----LFSIQNPGALG------EILKSEVQYLIDHDLVRQVKSDS---DNEICVLKATELGR--AVVRGSIDVIR--VKEIYSDLKSAENSLNLAT 1878
            PT  GKTL AE+ M + L       V++I P  +LV+E+V      F   + + V E +G     P  +    +S+ + T EK   +  S      + ++GL+V+DE+H++G    RGA LE  +  LK +    H      R++G+S  L N  ++ ++L         F    RP+ +S  V +  F              Q + P   L   P               +    P K  +IF  ++RQ       +  L    LLI D+  K+         ++L   I  E       L+  +  GI  HH+GL+  ER +VE+ F++  I V+  T+TLA G+N PA  VI++   Y      K+  +      QM GRAGR  FDD     + V    +  +   + E   V +SS+L     ++   V + IS   I + + IVE+L  +     LF+  NP   G      E +   +  ++D  +   + S+    D+E  V+K T  GR  +V     + +R  VK ++S   S EN L + T
Sbjct:  485 PTGSGKTLCAELAMFRLLQDHPGMKVVYIAPLKSLVRERVDDWKKKFEDGMGYRVVEVSGDVT--PDPEELAASSILITTPEKWDGISRSWATREYVRRVGLIVLDEVHLLG--VDRGAVLEAIVSRLKMITRRSHVTEEPVRLLGLSTALANAGDVAEWLGIPDEACYNFRPSVRPVPIS--VHIQGFPG------------QHYCPRMGLMNKP-----------AYKAILTYSPRKPVLIFVSSRRQ-----TRLTALAFVNLLIADHNPKQWLNMDMLELEDLMAAIKDE------NLKLTLPFGIGMHHAGLSAHERAIVEQLFIEKKIQVLIATATLAWGINCPAHLVIVKGTEYFDGKKGKYVDFPVTDVLQMMGRAGRPQFDDSAVAVIYVQDAKKTFYKKFLYEPFPV-ESSLLP----VLPNHVNAEISAGTIDSKQAIVEYLSKTYLYRRLFA--NPNYYGLEEDSEEAMLKFITKIVDDSVAELLASECIHVDSEQDVIKPTPCGRIASVYYLQHETVRFLVKSLHSGC-SVENMLKILT 988          
BLAST of Helicase POLQ-like protein vs. Ensembl Celegans
Match: Y54E2A.4 (pep chromosome:WBcel235:II:14754622:14778149:1 gene:WBGene00013189.1 transcript:Y54E2A.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y54E2A.4)

HSP 1 Score: 124.02 bits (310), Expect = 2.548e-28
Identity = 148/552 (26.81%), Postives = 237/552 (42.93%), Query Frame = 1
Query:  361 PTSGGKTLVAEILMLKQLAIKQ-RSVIFILPYIALVQEKVRALSP-FGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCL--LKFMRVFGHA-----RIVGMSATLDNLSEICQFL-----HAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKR--------DELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAP-YVGKDLIKFSQYK-----QMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGS-----LFSIQNPGALG------EILKSEVQYLIDHDLVRQVKSDS---DNEICVLKATELGR--AVVRGSIDVIR--VKEIYSDLKSAENSLNLAT 1878
            PT  GKTL AE+ M + L       V++I P  +LV+E+V      F   + + V E +G     P  +    +S+ + T EK   +  S      + ++GL+V+DE+H++G    RGA LE  +  LK +    H      R++G+S  L N  ++ ++L         F    RP+ +S  V +  F              Q + P   L   P               +    P K  +IF  ++RQ       +  L    LLI D+  K+         ++L   I  E       L+  +  GI  HH+GL+  ER +VE+ F++  I V+  T+TLA G+N PA  VI++   Y      K+  +      QM GRAGR  FDD     + V    +  +   + E   V +SS+L     ++   V + IS   I + + IVE+L  +     LF+  NP   G      E +   +  ++D  +   + S+    D+E  V+K T  GR  +V     + +R  VK ++S   S EN L + T
Sbjct: 1203 PTGSGKTLCAELAMFRLLQDHPGMKVVYIAPLKSLVRERVDDWKKKFEDGMGYRVVEVSGDVT--PDPEELAASSILITTPEKWDGISRSWATREYVRRVGLIVLDEVHLLG--VDRGAVLEAIVSRLKMITRRSHVTEEPVRLLGLSTALANAGDVAEWLGIPDEACYNFRPSVRPVPIS--VHIQGFPG------------QHYCPRMGLMNKP-----------AYKAILTYSPRKPVLIFVSSRRQTR-----LTALAFVNLLIADHNPKQWLNMDMLELEDLMAAIKDE------NLKLTLPFGIGMHHAGLSAHERAIVEQLFIEKKIQVLIATATLAWGINCPAHLVIVKGTEYFDGKKGKYVDFPVTDVLQMMGRAGRPQFDDSAVAVIYVQDAKKTFYKKFLYEPFPV-ESSLLP----VLPNHVNAEISAGTIDSKQAIVEYLSKTYLYRRLFA--NPNYYGLEEDSEEAMLKFITKIVDDSVAELLASECIHVDSEQDVIKPTPCGRIASVYYLQHETVRFLVKSLHSGC-SVENMLKILT 1706          

HSP 2 Score: 124.02 bits (310), Expect = 2.592e-28
Identity = 124/489 (25.36%), Postives = 214/489 (43.76%), Query Frame = 1
Query:  343 NLVYSLPTSGGKTLVAEILMLKQLAIKQRS----------VIFILPYIALVQEKVRA----LSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHA----RIVGMSATLDNLSEICQFLHA------VAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIK----LTDPKLLIPDYKVKKRDELFRQIDAECLGVCPTLRQI---IRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQ----------YKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLF---SIQNPGALG 1677
            NL+   PT  GKT +A + +L  +   Q S          +I+I P  AL  E   +    L+P GL +  L  +    + +   T+           I +  +  NSLI       + LL++DE+H++ D   RG  +E  + + +R    +    RIVG+SATL N  ++ +FL          FD  FRP+ L++     KFI       K   F    +           ++  +  D V+  V         ++F  T+     L          L    L +P  +   +   + Q D + + +C    QI    + G+  HH+GL +++R ++E  F +G +SV+ CT+TLA GVNLPA  V+I+    G D+    +           +Q+ GRAGR  F+++G   +I  +   DK+  ++     V Q+ I S+    +   + + ++L  + T ++ VE+L  +     +++NP A G
Sbjct:  329 NLLICAPTGAGKTNIAMLTILNTIHEHQNSRGDIMKDDFKIIYIAPMKALATEMTESFGKRLAPLGLKVKELTGDTQLSRNEVADTQMLVLTPEKWDVITRKSTSDNSLINV-----VRLLIIDEVHLLHD--ERGPVIETLVARTLRQVEMSQSGIRIVGLSATLPNFIDVARFLRVNPYKGLFFFDGRFRPVPLTQ-----KFI----GTRKAGNFRDNLT-----------LMDNVCYDEVVDFVKR---GHQVLVFVHTRNGTAKLGEAFCARASVLGQMDLFLPKDRASSK---YIQAD-KAINICRNRAQISPLFQRGMGIHHAGLCRQDRILMERCFAEGHVSVLFCTATLAWGVNLPAHAVVIK----GTDVFDAEKGVFTDLGVLDVQQIFGRAGRPQFENEGHGIIITTRDKIDKYLTML-----VHQNPIESQFYARLHDNLNAEVALGTVSTVDEGVEWLTYTYMYTRALKNPMAYG 774          
BLAST of Helicase POLQ-like protein vs. Ensembl Fly
Match: mus301 (gene:FBgn0002899 transcript:FBtr0076689)

HSP 1 Score: 530.02 bits (1364), Expect = 7.372e-172
Identity = 309/846 (36.52%), Postives = 476/846 (56.26%), Query Frame = 1
Query:  109 KKFSGVDKVNEHYNSFTVRKRAYGQLDXXXXXXXXXXXXXXXXMSIKIQELLKFHRGIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHARIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQNPG-----------ALGEILKSEVQYLID---------------HDLVRQVKSDSDNEICV-----LKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIV---TPHDMVASITPSWNPYAKRIGKLLASDKE-LLKSIGVNE-DMIFMLEMGCCQSKLKIDEYSLRRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKELLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASAESRALHEILNPISGKLVRQIISSAKMNIQEKLEALSEEYKEL 2538
            + F+  +K N+  + F  +   YG  D                   K+++++  H+GI+ LY+WQ ECL +P I + +NL+Y+LPTSGGKTLVAEILML++L  ++R+V+FILPY+++VQEKV A+SPF +DL+F+VEEY  GKGK PP    K  S+++A+IEK   L++SLI+  +  +IGL+VVDELH+IG+   RGA LE  L K M +  + +IVGMSAT+ NLSEI  FL+A  +   FRP+EL E++K    +  INS     T E+ F P R++E N ++ V++ DPD++ GL+SE  P+  C++FCP+++ CEN+A  + ++  PK    +++  ++ +L   +D  C  + P L + +  GIAYHHSGLT +ERK +E A+  G ++VICCTSTLAAGVNLPA+RVIIRAPYVG++ +   +YKQM GRAGR G  + GE  +I   KD    G ++        SS+       ++  +LS + L L +   D+   +  +L S+Q               L E+ K++V  L +                D+ +  +   D  + +      K T +GRA  +  ID  R   I+ +LK A+  L L  YLH+LY+V     ++    + P+       +   L  D + + K +G  E     + +    Q  L +    L RLY  LIL D+ +   I  VA+ Y    G +Q L+  + + ++ +    EE   +FW YK L  ++  ++  C + EL PLME+  V+  RA +LY AG+ TI  IA      L + L  +  ++  +I+S+AK+ + +KL+ L EE + L
Sbjct:  223 QAFADFEKNNQDIDKFPSKGEFYGLPD-------------------KVKKMILEHKGINSLYEWQDECLNLPAIRQRKNLIYALPTSGGKTLVAEILMLRELLCRERNVLFILPYVSIVQEKVSAMSPFAIDLDFIVEEYTAGKGKCPPQPRRKRRSLFIASIEKGAVLMDSLIDVQRPHEIGLVVVDELHLIGEKG-RGATLEAFLTKVMFLNANIQIVGMSATIGNLSEISSFLNADVYTRGFRPVELKEYIKCGPDLLEINS--AGQTLEEIFVPSRSVEYNYSEAVKRADPDHLAGLISECAPEHCCLVFCPSRKNCENVALLLSRIV-PKHKFFEHRRSEKLDLMDALDKMCGILSPVLAKTLPYGIAYHHSGLTTDERKYIETAYRFGVVTVICCTSTLAAGVNLPAKRVIIRAPYVGQEFLTLCKYKQMVGRAGRAGLGEAGESILIAQSKDNLLVGQMLFSPMDKALSSLDQNEAVGLQSLILSVVGLNLAECRRDLNRLVNSTLLSVQAKSLEVAVNEIVLRILREMFKNKVLQLAEPQAKSKINSSDIITSQDVSQANRPAGDRRLLIGQSTPFKLTNIGRAAFKAGIDYKRANAIHKELKQAQQQLILTNYLHLLYLVVCFNSNERGDELFPADASILFGVYTSLPLDSQAMFKQLGFTEAHAARLFKTQSVQGPLSL---QLNRLYKVLILADILNLLPIPSVASKYNVERGTLQHLISQSTAAASAIVRLCEELE-EFWCYKPLFERILHKMDRCGTFELEPLMELPAVKINRARQLYAAGFQTIGDIARVRPSHLVQSLEHMPLRVATEIVSAAKIILMKKLDHLEEETENL 1041          
BLAST of Helicase POLQ-like protein vs. Ensembl Fly
Match: DNApol-theta (gene:FBgn0002905 transcript:FBtr0082662)

HSP 1 Score: 319.701 bits (818), Expect = 5.498e-91
Identity = 240/761 (31.54%), Postives = 395/761 (51.91%), Query Frame = 1
Query:  274 RGIDKLYDWQIECLKIPGI-GKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFM---RVFG-HARIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDK-SCIIFCPTKRQCENLANNIIKLTDPKL---------LIPDYKVKKRDELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQNPGALGE----------ILKSEVQYLIDHDLVRQVKSDSDNEICVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITP-SWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLKIDEYSL-RRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKELL-PKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASAESRALHEIL-NPISGKLVRQ 2469
            +G+  ++DWQ+ECL  P +  +  NLVYS PTS GKTLV+EILMLK +  + + V+ ILP+I++V+EK+  +        + VE + GG   Y P    +   V + TIEKA+S++N L+E  ++  IG++VVDE+H+I D  R G  LEL L K +   R  G   +++ MSATL+N+  +  +L A  + +++RP+ L E +KV   I+    +L  D  +QK    + LE          D D+V  L  E L +  S I+FCP+K  CENLA  +      ++         L  +   +   E+ +Q+     G+   + + I    A+HH+GLT EER ++E +F  G + V+  TSTL++GVNLPARRV+IR+P  G   +    Y+QM GRAGR G D  GE  +I ++ +     +L++       S +  +    +K  +L  IS  +  T EDI  F+  +L S Q      E           +   + +L++++ VR ++ + + E  V  AT LG A +  S+       ++++L+ +  S  L + LH +Y+VTP+ +   +    W  Y     KL +  K++ + +GV +  ++    G  Q+KL   +  + +R Y AL L +L ++  I  V + Y+   G +QSL   A +++  +  F    +   WS   L+  +   RL   +  +LI LM I  + + RA  L+ AG  ++V++A A+   L ++L N IS    +Q
Sbjct:  227 KGVVDMFDWQVECLSKPRLLFEHCNLVYSAPTSAGKTLVSEILMLKTVLERGKKVLLILPFISVVREKMFYMQDLLTPAGYRVEGFYGG---YTPPGGFESLHVAICTIEKANSIVNKLMEQGKLETIGMVVVDEVHLISDKGR-GYILELLLAKILYMSRRNGLQIQVITMSATLENVQLLQSWLDAELYITNYRPVALKEMIKVGTVIYDHRLKLVRDVAKQKVLL-KGLEN---------DSDDVALLCIETLLEGCSVIVFCPSKDWCENLAVQLATAIHVQIKSETVLGQRLRTNLNPRAIAEVKQQLRDIPTGLDGVMSKAITYACAFHHAGLTTEERDIIEASFKAGALKVLVATSTLSSGVNLPARRVLIRSPLFGGKQMSSLTYRQMIGRAGRMGKDTLGESILICNEINARMGRDLVVSELQPITSCLDMDGSTHLKRALLEVISSGVANTKEDIDFFVNCTLLSAQKAFHAKEKPPDEESDANYINDALDFLVEYEFVR-LQRNEERETAVYVATRLGAACLASSMPPTDGLILFAELQKSRRSFVLESELHAVYLVTPYSVCYQLQDIDWLLYVHMWEKLSSPMKKVGELVGVRDAFLYKALRG--QTKLDYKQMQIHKRFYIALALEELVNETPINVVVHKYKCHRGMLQSLQQMASTFAGIVTAFCNSLQ---WSTLALIVSQFKDRLFFGIHRDLIDLMRIPDLSQKRARALFDAGITSLVELAGADPVELEKVLYNSISFDSAKQ 967          
BLAST of Helicase POLQ-like protein vs. Ensembl Fly
Match: obe (gene:FBgn0038344 transcript:FBtr0083147)

HSP 1 Score: 124.405 bits (311), Expect = 2.283e-28
Identity = 115/429 (26.81%), Postives = 197/429 (45.92%), Query Frame = 1
Query:  343 NLVYSLPTSGGKTLVAEILMLKQLAIKQR-SVIFILPYIALVQEKVRAL------SPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHA----RIVGMSATLDNLSEICQFLHA-----VAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKL----TDPK--LLIPDYKVKKRDELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAP-YVGKDLIKF-----SQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSIL 1545
            N++   PT  GKT+VAEI + + L    +  V++I P  ALV+E++         S  GL +  L  +        P  +  + + + V T EK   +  S      +  + L+V+DE+H++G+   RG  +E+ + +   +  H     RIVG+S  L N  ++  +L         F    RP+ L   V ++ F                  P ++  P   +M     P      +    P +  I+F  ++RQ    A ++I      ++PK  L IP+ ++   + + + I  + L  C      +  GI  HH+GL +++RK VEE FL+  I ++  T+TLA GVNLPA  V+I+   Y    + K+     +   QM GRAGR  FD++G   V+V  + ++ +   + +   V +SS+L
Sbjct: 1354 NVLLGAPTGSGKTIVAEIAIFRALNQNPKCKVVYIAPLKALVKERIADWEQRFQRSSLGLKVVELTGDVT------PDIQAIRESQLIVTTPEKWDGISRSWQTREYVQHVSLIVIDEIHLLGED--RGPVIEVIVSRTNFISSHTGRAIRIVGLSTALANAQDLANWLGINKMGLYNFKPSVRPVPLQ--VHINGF------------------PGKHYCP---RMATMNRP--TFQAIRTYSPCEPTIVFVSSRRQTRLTALDLITFVAGESNPKQFLHIPEDEI---ELILQNIREQNLKFC------LAFGIGLHHAGLQEQDRKCVEELFLNRKIQILVATATLAWGVNLPAHLVVIKGTEYFDGKVKKYVDMPITDVLQMMGRAGRPQFDNEGVAVVLVHDEKKNFYKKFLYDPFPV-ESSLL 1739          

HSP 2 Score: 107.842 bits (268), Expect = 3.311e-23
Identity = 133/493 (26.98%), Postives = 205/493 (41.58%), Query Frame = 1
Query:  343 NLVYSLPTSGGKTLVAEILM-------LKQLAIKQRS--VIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCAS-VYVATIEKAHSLI-NSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHA----RIVGMSATLDNLSEICQFLHA------VAFDSDFRPIEL-SEFVKVD--KFIHRINSQ-----LKCDTFEQK------FSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYK----------QMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQ---NPGALG 1677
            N++   PT  GKT VA + +       L+Q  I +    +++I P  AL  E V   S     L   V E  G       TK    A+ + V T EK   +      +   IS + LL++DE+H++     RG  +E  + + +R+   +    RIVG+SATL N  ++  FL          FDS FRP+ L + FV +   K + +I         KC    Q+      F   RN       +++++   N            +  +F P       LA   I+ +  K L+         ELF      C             G+A HH+G+ + +R+MVE+ F++G ISV+ CT+TLA GVNLPA  VIIR    G D+                 Q+ GRAGR  FD  G   +I      + + +L+       Q  I S     +   + + I L  I   ++ +E+L  +   ++   NP   G
Sbjct:  504 NMLVCAPTGAGKTNVAMLSIVHTIRCHLEQGVINRDEFKIVYIAPMKALAAEMVDNFSKRLKSLQIAVRELTG---DIQLTKAEMAATQILVTTPEKWDVVTRKGSGDVALISLVELLIIDEVHLLH--GERGPVVEALVARTLRLVESSQSMIRIVGLSATLPNYIDVAHFLRVNPMKGLFYFDSRFRPVPLDTNFVGIKSVKQLQQIADMDQCCYQKCVEMVQEGHQIMVFVHARNATVRTANVIRELAQQN-----------NTSALFLPKDSAAHGLATRSIQRSRNKQLV---------ELF-----SC-------------GLAMHHAGMLRADRQMVEKYFVEGHISVLVCTATLAWGVNLPAHAVIIR----GTDIYDAKHGSFVDLGILDVLQIFGRAGRPQFDKSGVGTIITSYDKLNHYLSLLTN-----QFPIESNFVNCLADNLNAEIGLGTITNVDEAIEWLSYTYLFVRMRINPHVYG 944          
BLAST of Helicase POLQ-like protein vs. Ensembl Fly
Match: Mtr4 (gene:FBgn0001986 transcript:FBtr0080760)

HSP 1 Score: 121.324 bits (303), Expect = 1.379e-27
Identity = 142/486 (29.22%), Postives = 212/486 (43.62%), Query Frame = 1
Query:  328 IGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISK-IGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHARIVGMSATLDNLSEICQFL--------HAVAFDSDFRPIELSEFV--KVDKFIHRI---NSQLKCDTFEQKFSPERNLEPNPNKMVQK----------MDPDNVIGLVSEILPDK--SCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDELFRQI------DAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAP--YVGKDL--IKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEF-LQGSLFSIQNPGAL 1674
            I  +++++ S  TS GKT+VAE  + K LA KQR VI+  P  AL  +K R  +    D+  +      G     P+     AS  + T E    L N L   ++I + +G +V DE+H + D   RG   E  L+       + R V +SAT+ N  +  +++        H V   +D+RP  L  ++       IH I     Q K D F    +   N      K  QK              N+  +V  I+       IIF  +K+ CE  A  + KL       PD K K  DE+F         +   L     +  ++R GI  HH GL    ++ +E  F +G I  +  T T A G+N+PAR V+  AP  + GK    I   +Y QMAGRAGR+G DDKG   +++D+K     G  I++  +   +S       M+         L L++  E   E+ L+ S +  QN  AL
Sbjct:  163 IDNSQSVLVSAHTSAGKTVVAEYAIAKSLAAKQR-VIYTTPIKALSNQKFREFTDEFKDVGLVT-----GDVTINPS-----ASCLIMTTE---ILRNMLYRGSEIMREVGWVVFDEIHYMRD-KERGVVWEETLILLP---DNVRYVFLSATIPNARQFAEWVCHLHKQPCHVVY--TDYRPTPLQHYIFPAGGDGIHLIVDEKGQFKEDNFTTAMAVLANAG-EAGKGDQKGRHGGIKGTNAGQTNIFKIVKMIMERNFAPVIIFSFSKKDCEIYAMQMAKL---DFNTPDEK-KLVDEVFNNAMDVLTEEDRRLPQVENVLPLLRRGIGIHHGGLLPILKETIEILFGEGLIKALFATETFAMGLNMPARTVLFTAPRKFDGKKFRWISSGEYIQMAGRAGRRGLDDKGIVILMIDEKVSPAVGRDIVQGKADPINSAFHLTYNMV---------LNLLRVEEINPEYMLERSFYQFQNQAAL 614          
BLAST of Helicase POLQ-like protein vs. Ensembl Fly
Match: l(3)72Ab (gene:FBgn0263599 transcript:FBtr0075527)

HSP 1 Score: 115.161 bits (287), Expect = 1.623e-25
Identity = 125/495 (25.25%), Postives = 222/495 (44.85%), Query Frame = 1
Query:  343 NLVYSLPTSGGKTLVAEILMLKQLA----------IKQRSVIFILPYIALVQEKVRALSPFGLDL---NFLVEEYAGGKGKYPPTKHTKCAS-VYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMR----VFGHARIVGMSATLDNLSEICQFLHA------VAFDSDFRPIEL-SEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDELFRQIDAECLGVCPT-LRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRA-----PYVGKDLIKFSQYK--QMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQNPGALGEILKSEVQYLIDHDLVR 1728
            N++   PT  GKT VA + M++++            +   +I++ P  +LVQE V     FG  L   N  V E  G    +  T+    A+ V V T EK   +     E   +S + L+++DE+H++ D   RG  LE  + + +R         R+VG+SATL N  ++  FL          FD+ +RP+ L  +++ V +        LK      +   E+ +E      V                     ++F  ++++    A  +  +   +  +  + +K+       +  E   V  T L++++  G A HH+G+T+ +R +VE+ F D  I V+  T+TLA GVNLPA  VII+      P  G+  ++ S     QM GRAGR  +D KGE  +I +  +   + +L+ +   + +S  +S+   M+     + I L  ++  +D V +L  +   I+       +L++   Y + HD ++
Sbjct:  498 NMLLCAPTGAGKTNVALLTMMREIGKHINEDGTINAQDFKIIYVAPMKSLVQEMV---GNFGRRLACYNLTVSELTGD---HQLTREQIAATQVIVCTPEKWDIITRKGGERTFVSLVRLVIIDEIHLLHD--ERGPVLEALVARTIRNIETTQEEVRLVGLSATLPNYQDVATFLRVKPDKGLFYFDNSYRPVSLEQQYIGVTE-----KKALKRFQVMNEIVYEKTMEHAGRNQV---------------------LVFVHSRKETGKTARAVRDMCLEQDTLGSF-LKEGSASMEVLRTEAEQVKNTELKELLPYGFAIHHAGMTRVDRTLVEDLFADRHIQVLVSTATLAWGVNLPAHTVIIKGTQVYNPEKGR-WVELSALDVLQMLGRAGRPQYDTKGEGILITNHSELQFYLSLLNQQLPI-ESQFISKLPDMLN----AEIVLGTVQHLQDAVNWLGYTYLYIR-------MLRNPTLYGVSHDAIK 944          

HSP 2 Score: 75.8702 bits (185), Expect = 1.846e-13
Identity = 112/502 (22.31%), Postives = 196/502 (39.04%), Query Frame = 1
Query:  343 NLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRA--LSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFM----RVFGHARIVGMSATLDNLSEICQFL-----HAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDE-----LFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAP--YVGKDLIKFSQYK-----QMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFS---IQNPGALGEILKSEVQYLIDH--DLVRQVKSDSDNEICV 1764
            N+    PT  GK  +AE  +++    +  +    L     + + V A   S FG  L+  V +  G  G     K      + + T +K   L     +   +  + L +VDEL ++G     G  LE+   +      ++    RIV +SA+L +  ++ Q+L         F    RPI L   ++     H                       N  ++     P  V   + +    K  I+F  +++Q    A +++      L  P+      +E     L R  D        TL++ +  G+AY H GL+  + ++VE+ F  G + V   +  L  G+++ A  VII     Y GK+   +  Y      QM GRA R   D   +C ++     +D F   I E   + +S +   + RM  +F    ++ + I+  +D V++L  +       QNP     +     ++L DH  +LV    SD +   C+
Sbjct: 1345 NVFVGAPTGSGKMTIAEFAIMRLFTTQSDARCVYLVSEEALADLVFADWHSKFG-SLDIKVVKLTGETGT--DLKLIAKGQLVITTADKWDVLSRRWKQRKNVQLVNLFIVDELQLVG--GEEGPVLEIVCSRMRYISSQIEKQIRIVALSASLTDARDVAQWLGCNPNATFNFHPSVRPIPLELHIQGYNVTH-----------------------NATRIATMSKP--VYNAILKYSAHKPVIVFVSSRKQARLTAIDVLTYAASDLQ-PNRFFHAEEEDIKPFLERMTDK-------TLKETLAQGVAYLHEGLSASDHRLVEQLFDSGAVQVAVISRDLCWGMSISAHLVIIMDTQFYNGKNH-SYEDYPITDVLQMIGRANRPNEDADAKCVLMCQSSKKDFFKKFINEPLPI-ESHL---DHRMHDHFNAEVVT-KTIENKQDAVDYLTWTFLYRRLTQNPNYYN-LQGVTHRHLSDHLSELVENTLSDLEQSKCI 1801          
BLAST of Helicase POLQ-like protein vs. Ensembl Zebrafish
Match: helq (helicase, POLQ like [Source:ZFIN;Acc:ZDB-GENE-060503-421])

HSP 1 Score: 619.772 bits (1597), Expect = 0.000e+0
Identity = 332/768 (43.23%), Postives = 497/768 (64.71%), Query Frame = 1
Query:  247 KIQELLKFHRGIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHARIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLK-CDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDELFRQIDAECLG-VCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQNP-----GALGEILKSEVQYLIDHDLVRQVKSDSDNEICVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLK-IDEYSLRRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKELLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASAESRALHEILNPISGKLVRQIISSAKMNIQEKLEALSEE 2526
            K+++L+   +GI  LY+WQ  CL +  I + RNL+YSLPTSGGKTLVAEIL+ K+L  +++  + ILPYI+LVQEKVR LS FG++L+FLVEEYAG KGK+PP K     S+Y+ TIEK HSL+NSLIE +++  IGL+VVDELHM+GDGS RGA LE+ L K + +    +++GMSATL N+ ++  FL A  + ++FRP+EL E+VK+   I+ ++ + + C TF       R L    +  +QKMDPD++I L +E++P +SC+IFC TK+ CENLA  I K  + + +   +K  ++  L  ++ +   G +CP L++ I  G+AYHHSGLT +ERK+VEEA+  G + ++ CTSTLAAG+NLPARRVI+R+PYV  D +K SQYKQM GRAGR G D  GE  +I+  KD +    L+      C S++L +  R +   +LS I L++  T E + + ++G+   +Q        +L ++    +Q L   +L+ +V SD +N+  +L+ T LGRA  +GS+D+     +Y DL      L L ++LH++Y+VTP+DMV    P W  Y ++   L A+++++  ++GV E   F+      QS  K +D   + RLY AL+L+ L  + +++ V+  ++ + GFVQ+LL +A ++ + + +F EE   +FW+YK LL +LT RL +CV  ELIPLME+ GV + RA +LY AGY T+  +A+A+ + L + +  +  K   QII+SAKM + EK EAL EE
Sbjct:  243 KVKDLIFRLKGIQDLYEWQKTCLSLDSIQQRRNLIYSLPTSGGKTLVAEILIFKELLCRKKDALLILPYISLVQEKVRGLSSFGIELDFLVEEYAGSKGKFPPVKRRNKNSLYITTIEKGHSLVNSLIENDRLDNIGLVVVDELHMLGDGS-RGAILEMTLSKILYMSKSTQVIGMSATLGNVKDLQSFLRAENYTNNFRPVELKEYVKIKDSIYEVDPKEEACFTF------SRLLNFKYSSGMQKMDPDHIIALATEVIPQQSCLIFCATKKNCENLAGMICKYLNKEFI--KHKEAEKAILLGELKSSGNGSLCPVLQKTIPFGLAYHHSGLTSDERKLVEEAYSSGVLCLLTCTSTLAAGINLPARRVILRSPYVAADFLKRSQYKQMVGRAGRAGIDAMGESILILQDKDINTAKKLLCAPMEKCYSNLLHDGGRGLLSLILSLIGLKITTTVEQVKDLMKGTFLGVQEAQVSPEKSLWDLTVESIQTLKQKNLI-EVSSDENNQ-NILQITRLGRATYKGSVDLSYCDVLYRDLSKGLEGLLLNSFLHLVYLVTPYDMVHQCKPDWMIYFRQFTNLSAAEQKMATTVGVPES--FVARKAAGQSVRKSVDVVVVNRLYLALVLFSLLKETNLWIVSERFQLTRGFVQTLLSSASAFGSSVLHFTEELE-EFWAYKALLSELTRRLTYCVQAELIPLMEVSGVLEHRAKQLYSAGYKTLSHLANADPQTLVQTIENLFKKQAYQIIASAKMLLTEKAEALQEE 996          
BLAST of Helicase POLQ-like protein vs. Ensembl Zebrafish
Match: helq (helicase, POLQ like [Source:ZFIN;Acc:ZDB-GENE-060503-421])

HSP 1 Score: 586.26 bits (1510), Expect = 0.000e+0
Identity = 314/751 (41.81%), Postives = 467/751 (62.18%), Query Frame = 1
Query:  298 WQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHARIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLK-CDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDELFRQIDAECLG-VCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQNP-----GALGEILKSEVQYLIDHDLVRQVKSDSDNEICVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLK-IDEYSLRRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKELLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASAESRALHEILNPISGKLVRQIISSAKMNIQEKLEALSEE 2526
            WQ  CL +  I + RNL+YSLPTSGGKTLVAEIL+ K+L  +++  + ILPYI+LVQEKVR LS FG++L+FLVEEYAG KGK+PP K     S+Y+ TIEK HSL+NSLIE +++  IGL+VVDELHM+GDGS RGA LE+ L K + +    +++GMSATL N+ ++  FL A  + ++FRP+EL E+VK+   I+ ++ + + C TF +  +             +KMDPD++I L +E++P +SC+IFC TK+ CENLA  I K  + + +   +K  ++  L  ++ +   G +CP L++ I  G+AYHHSGLT +ERK+VEEA+  G + ++ CTSTLAAG+NLPARRVI+R+PYV  D +K SQYKQM GRAGR G D  GE  +I+  KD +                                    +  T E + + ++G+   +Q        +L ++    +Q L   +L+ +V SD +N+  +L+ T LGRA  +GS+D+     +Y DL      L L ++LH++Y+VTP+DMV    P W  Y ++   L A+++++  ++GV E   F+      QS  K +D   + RLY AL+L+ L  + +++ V+  ++ + GFVQ+LL +A ++ + + +F EE   +FW+YK LL +LT RL +CV  ELIPLME+ GV + RA +LY AGY T+  +A+A+ + L + +  +  K   QII+SAKM + EK EAL EE
Sbjct:    2 WQKTCLSLDSIQQRRNLIYSLPTSGGKTLVAEILIFKELLCRKKDALLILPYISLVQEKVRGLSSFGIELDFLVEEYAGSKGKFPPVKRRNKNSLYITTIEKGHSLVNSLIENDRLDNIGLVVVDELHMLGDGS-RGAILEMTLSKILYMSKSTQVIGMSATLGNVKDLQSFLRAENYTNNFRPVELKEYVKIKDSIYEVDPKEEACFTFSRLLN------------FKKMDPDHIIALATEVIPQQSCLIFCATKKNCENLAGMICKYLNKEFI--KHKEAEKAILLGELKSSGNGSLCPVLQKTIPFGLAYHHSGLTSDERKLVEEAYSSGVLCLLTCTSTLAAGINLPARRVILRSPYVAADFLKRSQYKQMVGRAGRAGIDAMGESILILQDKDINT-----------------------------------ITTTVEQVKDLMKGTFLGVQEAQVSPEKSLWDLTVESIQTLKQKNLI-EVSSDENNQ-NILQITRLGRATYKGSVDLSYCDVLYRDLSKGLEGLLLNSFLHLVYLVTPYDMVHQCKPDWMIYFRQFTNLSAAEQKMATTVGVPES--FVARKAAGQSVRKSVDVVVVNRLYLALVLFSLLKETNLWIVSERFQLTRGFVQTLLSSASAFGSSVLHFTEELE-EFWAYKALLSELTRRLTYCVQAELIPLMEVSGVLEHRAKQLYSAGYKTLSHLANADPQTLVQTIENLFKKQAYQIIASAKMLLTEKAEALQEE 697          
BLAST of Helicase POLQ-like protein vs. Ensembl Zebrafish
Match: BX649525.2 (pep chromosome:GRCz11:CHR_ALT_CTG21_1_10:19337278:19347412:1 gene:ENSDARG00000115451.1 transcript:ENSDART00000188798.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX649525.2)

HSP 1 Score: 373.629 bits (958), Expect = 1.975e-118
Identity = 208/538 (38.66%), Postives = 324/538 (60.22%), Query Frame = 1
Query:  934 FSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDELFRQIDAECLG-VCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQNP-----GALGEILKSEVQYLIDHDLVRQVKSDSDNEICVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLK-IDEYSLRRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKELLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASAESRALHEILNPISGKLVRQIISSAKMNIQEKLEALSEE 2526
            F+  R L    +  +QKMDPD++I L +E++P +SC+IFC TK+ CENLA  I K  + + +   +K  ++  L  ++ +   G +CP L++ I  G+AYHHSGLT +ERK+VEEA+  G + ++ CTSTLAAG+NLPARRVI+R+PYV  D +K SQYKQM GRAGR G D  GE  +I+  KD +            C       N    K  +++ I++ +  T E + + ++G+   +Q        +L ++    +Q L   +L+ +V SD +N+  +L+ T LGRA  +GS+D+     +Y DL      L L ++LH++Y+VTP+DMV    P W  Y ++   L A+++++  ++GV E   F+      QS  K +D   + RLY AL+L+ L  + +++ V+  ++ + GFVQ+LL +A ++ + + +F EE   +FW+YK LL +LT RL +CV  ELIPLME+ GV + RA +LY AGY T+  +A+A+ + L + +  +  K   QII+SAKM + EK EAL EE
Sbjct:    1 FTFSRLLNFKYSSGMQKMDPDHIIALATEVIPQQSCLIFCATKKNCENLAGMICKYLNKEFI--KHKEAEKAILLGELKSSGNGSLCPVLQKTIPFGLAYHHSGLTSDERKLVEEAYSSGVLCLLTCTSTLAAGINLPARRVILRSPYVAADFLKRSQYKQMVGRAGRAGIDAMGESILILQDKDIN-----------TCNIYDHEYN----KCILITCINMLITTTVEQVKDLMKGTFLGVQEAQVSPEKSLWDLTVESIQTLKQKNLI-EVSSDENNQ-NILQITRLGRATYKGSVDLSYCDVLYRDLSKGLEGLLLNSFLHLVYLVTPYDMVHQCKPDWMIYFRQFTNLSAAEQKMATTVGVPES--FVARKAAGQSVRKSVDVVVVNRLYLALVLFSLLKETNLWIVSERFQLTRGFVQTLLSSASAFGSSVLHFTEELE-EFWAYKALLSELTRRLTYCVQAELIPLMEVSGVLEHRAKQLYSAGYKTLSHLANADPQTLVQTIENLFKKQAYQIIASAKMLLTEKAEALQEE 516          
BLAST of Helicase POLQ-like protein vs. Ensembl Zebrafish
Match: polq (polymerase (DNA directed), theta [Source:ZFIN;Acc:ZDB-GENE-040724-232])

HSP 1 Score: 320.857 bits (821), Expect = 3.324e-91
Identity = 242/787 (30.75%), Postives = 396/787 (50.32%), Query Frame = 1
Query:  277 GIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHA----------RIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPD-KSCIIFCPTKRQCENLANNI-------------IKLTDPKLLIPDYKVKKRDELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELI-----KTFEDIVEFL-----------QGSLFSIQNPGALGEILKSEVQYLIDHDLVRQVKSDSDNEICVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLKIDEYSL---RRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKELLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASAESRALHEIL-NPISGKLVRQIISSAKMNIQEK 2505
            G+ ++++WQ ECL +  + + +NLVYS PTS GKTLV+E+L+LK++   ++  +FILP++++ +EK+  L     +    VE Y G               V V TIEKA+ L+N LIE +++  +G +VVDELHM+GD S RG  LEL L K   +              +I+GMSATL NL  + ++L A  + +++RP+ L E+VK+   I+  +  L      ++F+P   +         K D D+++ L  E + D  S ++FCP+K  CE LA++I             I L    LL          ++  Q+     G+   L++ +  G+A+HH+GLT +ER ++E AF  G I V+  TSTL++GVNLPARRVIIR P     L+    YKQM GRAGRKG D  GE  ++  + +R K  +LI  +     S ++      +   +L AI LE+I      + +D+  +             GS    +N GA    +++ +++L+D++ +   K       C    T LG A +  S+       I++DL+ A     L   LH+LY +TP   V   T  W  +     +L ++ K + + +G+ E  +     G   +K +     +   +R +  L+L DL  ++ +  VA  Y  S G +QSL  +A +Y+  +  F    R  + + + LL +  +RL+  V  EL  L+ I  +   RA  LY +G+ T+ ++A A+   + + L   I  K  RQ +  +++  QE+
Sbjct:   96 GVHRMFEWQAECLTLGKVLEGQNLVYSAPTSAGKTLVSELLILKRVLETRQKAMFILPFVSVAREKMFYLQNVFQEAGIRVEGYMGSTSA---AGGFSALDVAVCTIEKANGLVNRLIEEDKLDLLGTVVVDELHMVGD-SGRGYLLELLLTKIRYIAQKTATRYSTSTGVQIIGMSATLPNLDLLARWLSAELYSTNYRPVPLMEWVKIGTNIYDGSLNLV-----RQFTPALPI---------KGDDDHIVSLCFETVQDGHSALLFCPSKNWCEKLADSIGREFYNLHHKGQSIFLNQEGLL----------DVLAQLKRTPAGLDHVLQRTVPWGVAFHHAGLTFDERDILEGAFRQGYIRVLAATSTLSSGVNLPARRVIIRTPVFNGHLLDILTYKQMVGRAGRKGVDTIGESVLVCKEAERAKGMSLIQGSLKPISSCLVKREGEGVTTSMLRAI-LEIIVGGVASSPQDVRMYAACTLLAAKAHQDGSESEARNKGA----IEACIEWLMDNEFIHIQKEGDGKMYC---PTHLGSATLSSSLSPPEALGIFADLQRAMKGFVLENDLHILYQITPV-YVDWTTIDWYQFFCLWEQLPSAMKRVAEMVGIQEGFLARSVGGKLIAKTEKQRRQMAIHKRFFTTLVLLDLVSEEPLGAVAKKYGCSRGQLQSLQQSASTYAGMVTVFCN--RLGWHNLELLLSQFQSRLSFGVQRELCDLVRISLLTAQRARTLYSSGFVTVAELARADVSEVEKALRKAIPFKSSRQAVDESEVEAQER 843          
BLAST of Helicase POLQ-like protein vs. Ensembl Zebrafish
Match: polq (polymerase (DNA directed), theta [Source:ZFIN;Acc:ZDB-GENE-040724-232])

HSP 1 Score: 317.005 bits (811), Expect = 5.784e-90
Identity = 242/798 (30.33%), Postives = 399/798 (50.00%), Query Frame = 1
Query:  277 GIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKF--------MRVFGHA-----RIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPD-KSCIIFCPTKRQCENLANNI--------------------IKLTDPKLLIPDYKVKKRDELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELI-----KTFEDIVEFLQGSLFS-------IQNPGALGE-----ILKSEVQYLIDHDLVRQVKSDSDNEICVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLKIDEYSL---RRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKELLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASAESRALHEIL-NPISGKLVRQIISSAKMNIQEK 2505
            G+ ++++WQ ECL +  + + +NLVYS PTS GKTLV+E+L+LK++   ++  +FILP++++ +EK+  L     +    VE Y G               V V TIEKA+ L+N LIE +++  +G +VVDELHM+GD S RG  LEL L K          R  G +     +I+GMSATL NL  + ++L A  + +++RP+ L E+VK+   I+  +  L      ++F+P   +         K D D+++ L  E + D  S ++FCP+K  CE LA++I                    I L    LL          ++  Q+     G+   L++ +  G+A+HH+GLT +ER ++E AF  G I V+  TSTL++GVNLPARRVIIR P     L+    YKQM GRAGRKG D  GE  ++  + +R K  +LI  +     S ++      +   +L AI LE+I      + +D+  +   +L +       +   G+  E      +++ +++L+D++ +   K       C    T LG A +  S+       I++DL+ A     L   LH+LY +TP   V   T  W  +     +L ++ K + + +G+ E  +     G   +K +     +   +R +  L+L DL  ++ +  VA  Y  S G +QSL  +A +Y+  +  F    R  + + + LL +  +RL+  V  EL  L+ I  +   RA  LY +G+ T+ ++A A+   + + L   I  K  RQ +  +++  QE+
Sbjct:  295 GVHRMFEWQAECLTLGKVLEGQNLVYSAPTSAGKTLVSELLILKRVLETRQKAMFILPFVSVAREKMFYLQNVFQEAGIRVEGYMGSTSA---AGGFSALDVAVCTIEKANGLVNRLIEEDKLDLLGTVVVDELHMVGD-SGRGYLLELLLTKIRYIAQKTATRNSGQSTSTGVQIIGMSATLPNLDLLARWLSAELYSTNYRPVPLMEWVKIGTNIYDGSLNLV-----RQFTPALPI---------KGDDDHIVSLCFETVQDGHSALLFCPSKNWCEKLADSIGREFYNLHHKEMQSGSGGQSISLNQEGLL----------DVLAQLKRTPAGLDHVLQRTVPWGVAFHHAGLTFDERDILEGAFRQGYIRVLAATSTLSSGVNLPARRVIIRTPVFNGHLLDILTYKQMVGRAGRKGVDTIGESVLVCKEAERAKGMSLIQGSLKPISSCLVKREGEGVTTSMLRAI-LEIIVGGVASSPQDVRMYAACTLLAASIAAEEVHQDGSESEARNKGAIEACIEWLMDNEFIHIQKEGDVERYC---PTHLGSATLSSSLSPPEALGIFADLQRAMKGFVLENDLHILYQITPV-YVDWTTIDWYQFFCLWEQLPSAMKRVAEMVGIQEGFLARSVGGKLIAKTEKQRRQMAIHKRFFTTLVLLDLVSEEPLGAVAKKYGCSRGQLQSLQQSASTYAGMVTVFCN--RLGWHNLELLLSQFQSRLSFGVQRELCDLVRISLLTAQRARTLYSSGFVTVAELARADVTEVEKALRKAIPFKSSRQAVDESEVEAQER 1057          
BLAST of Helicase POLQ-like protein vs. Ensembl Xenopus
Match: HELQ (helicase, POLQ like [Source:NCBI gene;Acc:100485183])

HSP 1 Score: 614.764 bits (1584), Expect = 0.000e+0
Identity = 331/773 (42.82%), Postives = 499/773 (64.55%), Query Frame = 1
Query:  247 KIQELLKFHRGIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHARIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDELFRQIDAECLG---VCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQN-----PGALGEILKSEVQYLIDHDLVRQVKSDSDNEICVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQS-KLKIDEYSLRRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKELLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASAESRALHEILNPISGKLVRQIISSAKMNIQEKLEALSEEYKEL 2538
            ++++L+   R I KLYDWQ  CL +  I + +NL+YSLPTSGGKTLVAEIL+L++L  +Q+ V+ ILPY+A+VQEKVR L+ FG++L+FLVEEYAG +G++PP K     S+Y+ATIEK HSLINSLIET +I+ +GL+VVDELHM+G+GS RGA LE+ L K +      +I+GMSATL+N++E+  FL A  + ++FRP+EL EFVKV   I+ ++S       E   +  R L    +  + K+DPD+V+ LV+E++P  SC++FCPTK+ CEN+A  I K  + KL +   + +K++ +    D + +G   +C  L++ I  GIAYHHSGLT +ERK++EEA+  G + ++ CTSTLAAGVNLPARRVI+RAPYV  D +K +QYKQM GRAGR G D  GE  +I+ +KD++    LI +    C S+++  + +  +  +LS I L++ KT E+I  F+  +LFS+Q         L ++ K  ++ L+D  L+   K+ S+ E  + + ++LG A  +G ID+     +YSDL      L L ++LH+LY+V P+D+V    P W  Y ++   L   ++++  S+G+ E   F+      Q+ K   +   + RLY + ILY L  +  I+ V+  +    G +Q+LL ++ S+S+ + +F EE  ++FW+YK LL +LT +L +CV  ELIPLME+ GV + RA +LY AGY ++  +A+A+   + + +  +S    +QI+ SAKM + EK EAL EE  EL
Sbjct:  234 RVRDLIYQFRRIKKLYDWQHTCLTLQSIKERKNLIYSLPTSGGKTLVAEILVLQELLCRQKDVLMILPYVAIVQEKVRGLASFGVELDFLVEEYAGSRGRFPPIKRRTKKSLYIATIEKGHSLINSLIETGRINDLGLIVVDELHMLGEGS-RGAILEMTLSKILYTSTSIQIIGMSATLNNVAELQNFLKAEYYTNNFRPVELKEFVKVRDCIYEVDSNA-----ENNLTFSRLLNYKYSNNMMKIDPDHVVALVTEVIPANSCLVFCPTKKNCENVAEMICKYLN-KLYVEHREAEKKNLI---ADLKNIGNGVLCSVLKRTIPFGIAYHHSGLTSDERKLIEEAYSAGVLCLLACTSTLAAGVNLPARRVILRAPYVANDFLKRAQYKQMVGRAGRAGIDSAGESILIIQEKDKELVQELISKPMENCYSNLMHNSGKDFQSLLLSLIGLKITKTAEEIYSFVSCTLFSVQQSVLCKAKNLLDVTKESLECLVDKGLICG-KTCSETEQYIFQVSKLGHATYKGCIDLACYDLLYSDLNRGLEGLVLESFLHLLYLVIPYDLVGKFNPDWMIYFRQYNSLSPVEQKVAASVGIPES--FLARKASGQTVKTSANNMVVNRLYLSFILYTLLKETDIWRVSAKFSIPRGTLQNLLSSSASFSSSVLHFCEEL-DEFWAYKSLLQELTKKLTYCVKSELIPLMEVAGVMEARAKQLYNAGYTSLAHLANADPEVMVKKIEHLSRHQAKQIVFSAKMLVNEKAEALQEEVDEL 992          
BLAST of Helicase POLQ-like protein vs. Ensembl Xenopus
Match: HELQ (helicase, POLQ like [Source:NCBI gene;Acc:100485183])

HSP 1 Score: 599.742 bits (1545), Expect = 0.000e+0
Identity = 320/757 (42.27%), Postives = 487/757 (64.33%), Query Frame = 1
Query:  247 KIQELLKFHRGIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHARIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDELFRQIDAECLG---VCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQN-----PGALGEILKSEVQYLIDHDLVRQVKSDSDNEICVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLKIDEYSLRRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKELLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASAESRALHEILNPISGKLVRQIISSAKMN 2493
            ++++L+   R I KLYDWQ  CL +  I + +NL+YSLPTSGGKTLVAEIL+L++L  +Q+ V+ ILPY+A+VQEKVR L+ FG++L+FLVEEYAG +G++PP K     S+Y+ATIEK HSLINSLIET +I+ +GL+VVDELHM+G+GS RGA LE+ L K +      +I+GMSATL+N++E+  FL A  + ++FRP+EL EFVKV   I+ ++S       E   +  R L    +  + K+DPD+V+ LV+E++P  SC++FCPTK+ CEN+A  I K  + KL +   + +K++ +    D + +G   +C  L++ I  GIAYHHSGLT +ERK++EEA+  G + ++ CTSTLAAGVNLPARRVI+RAPYV  D +K +QYKQM GRAGR G D  GE  +I+ +KD++    LI +    C S+++  + +  +  +LS I L++ KT E+I  F+  +LFS+Q         L ++ K  ++ L+D  L+   K+ S+ E  + + ++LG A  +G ID+     +YSDL      L L ++LH+LY+V P+D+V    P W  Y ++   L   ++++  S+G+ E  +     G    +   +   + RLY + ILY L  +  I+ V+  +    G +Q+LL ++ S+S+ + +F EE  ++FW+YK LL +LT +L +CV  ELIPLME+ GV + RA +LY AGY ++  +A+A+   + + +  +S    +QI+ SAK N
Sbjct:  207 RVRDLIYQFRRIKKLYDWQHTCLTLQSIKERKNLIYSLPTSGGKTLVAEILVLQELLCRQKDVLMILPYVAIVQEKVRGLASFGVELDFLVEEYAGSRGRFPPIKRRTKKSLYIATIEKGHSLINSLIETGRINDLGLIVVDELHMLGEGS-RGAILEMTLSKILYTSTSIQIIGMSATLNNVAELQNFLKAEYYTNNFRPVELKEFVKVRDCIYEVDSNA-----ENNLTFSRLLNYKYSNNMMKIDPDHVVALVTEVIPANSCLVFCPTKKNCENVAEMICKYLN-KLYVEHREAEKKNLI---ADLKNIGNGVLCSVLKRTIPFGIAYHHSGLTSDERKLIEEAYSAGVLCLLACTSTLAAGVNLPARRVILRAPYVANDFLKRAQYKQMVGRAGRAGIDSAGESILIIQEKDKELVQELISKPMENCYSNLMHNSGKDFQSLLLSLIGLKITKTAEEIYSFVSCTLFSVQQSVLCKAKNLLDVTKESLECLVDKGLICG-KTCSETEQYIFQVSKLGHATYKGCIDLACYDLLYSDLNRGLEGLVLESFLHLLYLVIPYDLVGKFNPDWMIYFRQYNSLSPVEQKVAASVGIPESFLARKASG----QTSANNMVVNRLYLSFILYTLLKETDIWRVSAKFSIPRGTLQNLLSSSASFSSSVLHFCEEL-DEFWAYKSLLQELTKKLTYCVKSELIPLMEVAGVMEARAKQLYNAGYTSLAHLANADPEVMVKKIEHLSRHQAKQIVFSAKTN 947          
BLAST of Helicase POLQ-like protein vs. Ensembl Xenopus
Match: HELQ (helicase, POLQ like [Source:NCBI gene;Acc:100485183])

HSP 1 Score: 598.971 bits (1543), Expect = 0.000e+0
Identity = 321/756 (42.46%), Postives = 488/756 (64.55%), Query Frame = 1
Query:  247 KIQELLKFHRGIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHARIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDELFRQIDAECLG---VCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQN-----PGALGEILKSEVQYLIDHDLVRQVKSDSDNEICVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQS-KLKIDEYSLRRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKELLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASAESRALHEILNPISGKLVRQIISSAK 2487
            ++++L+   R I KLYDWQ  CL +  I + +NL+YSLPTSGGKTLVAEIL+L++L  +Q+ V+ ILPY+A+VQEKVR L+ FG++L+FLVEEYAG +G++PP K     S+Y+ATIEK HSLINSLIET +I+ +GL+VVDELHM+G+GS RGA LE+ L K +      +I+GMSATL+N++E+  FL A  + ++FRP+EL EFVKV   I+ ++S       E   +  R L    +  + K+DPD+V+ LV+E++P  SC++FCPTK+ CEN+A  I K  + KL +   + +K++ +    D + +G   +C  L++ I  GIAYHHSGLT +ERK++EEA+  G + ++ CTSTLAAGVNLPARRVI+RAPYV  D +K +QYKQM GRAGR G D  GE  +I+ +KD++    LI +    C S+++  + +  +  +LS I L++ KT E+I  F+  +LFS+Q         L ++ K  ++ L+D  L+   K+ S+ E  + + ++LG A  +G ID+     +YSDL      L L ++LH+LY+V P+D+V    P W  Y ++   L   ++++  S+G+ E   F+      Q+ K   +   + RLY + ILY L  +  I+ V+  +    G +Q+LL ++ S+S+ + +F EE  ++FW+YK LL +LT +L +CV  ELIPLME+ GV + RA +LY AGY ++  +A+A+   + + +  +S    +QI+ SAK
Sbjct:  179 RVRDLIYQFRRIKKLYDWQHTCLTLQSIKERKNLIYSLPTSGGKTLVAEILVLQELLCRQKDVLMILPYVAIVQEKVRGLASFGVELDFLVEEYAGSRGRFPPIKRRTKKSLYIATIEKGHSLINSLIETGRINDLGLIVVDELHMLGEGS-RGAILEMTLSKILYTSTSIQIIGMSATLNNVAELQNFLKAEYYTNNFRPVELKEFVKVRDCIYEVDSNA-----ENNLTFSRLLNYKYSNNMMKIDPDHVVALVTEVIPANSCLVFCPTKKNCENVAEMICKYLN-KLYVEHREAEKKNLI---ADLKNIGNGVLCSVLKRTIPFGIAYHHSGLTSDERKLIEEAYSAGVLCLLACTSTLAAGVNLPARRVILRAPYVANDFLKRAQYKQMVGRAGRAGIDSAGESILIIQEKDKELVQELISKPMENCYSNLMHNSGKDFQSLLLSLIGLKITKTAEEIYSFVSCTLFSVQQSVLCKAKNLLDVTKESLECLVDKGLICG-KTCSETEQYIFQVSKLGHATYKGCIDLACYDLLYSDLNRGLEGLVLESFLHLLYLVIPYDLVGKFNPDWMIYFRQYNSLSPVEQKVAASVGIPES--FLARKASGQTVKTSANNMVVNRLYLSFILYTLLKETDIWRVSAKFSIPRGTLQNLLSSSASFSSSVLHFCEEL-DEFWAYKSLLQELTKKLTYCVKSELIPLMEVAGVMEARAKQLYNAGYTSLAHLANADPEVMVKKIEHLSRHQAKQIVFSAK 920          
BLAST of Helicase POLQ-like protein vs. Ensembl Xenopus
Match: HELQ (helicase, POLQ like [Source:NCBI gene;Acc:100485183])

HSP 1 Score: 423.32 bits (1087), Expect = 1.035e-132
Identity = 236/619 (38.13%), Postives = 376/619 (60.74%), Query Frame = 1
Query:  661 LVVDELHMIGDGSRRGANLELCLLKFMRVFGHARIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDELFRQIDAECLG---VCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQN-----PGALGEILKSEVQYLIDHDLVRQVKSDSDNEICVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLKIDEYSLRRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKELLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASAESRALHEILNPISGKLVRQIISSAKMN 2493
            +V ++LHM+G+GSR GA LE+ L K +      +I+GMSATL+N++E+  FL A  + ++FRP+EL EFVKV   I+ ++S       E   +  R L    +  + K+DPD+V+ LV+E++P  SC++FCPTK+ CEN+A  I K  + KL +   + +K++ +    D + +G   +C  L++ I  GIAYHHSGLT +ERK++EEA+  G + ++ CTSTLAAGVNLPARRVI+RAPYV  D +K +QYKQM GRAGR G D  GE  +I+ +KD++    LI +    C S+++  + +  +  +LS I L++ KT E+I  F+  +LFS+Q         L ++ K  ++ L+D  L+   K+ S+ E  + + ++LG A  +G ID+     +YSDL      L L ++LH+LY+V P+D+V    P W  Y ++   L   ++++  S+G+ E  +     G    +   +   + RLY + ILY L  +  I+ V+  +    G +Q+LL ++ S+S+ + +F EE  ++FW+YK LL +LT +L +CV  ELIPLME+ GV + RA +LY AGY ++  +A+A+   + + +  +S    +QI+ SAK N
Sbjct:  279 IVQEKLHMLGEGSR-GAILEMTLSKILYTSTSIQIIGMSATLNNVAELQNFLKAEYYTNNFRPVELKEFVKVRDCIYEVDSNA-----ENNLTFSRLLNYKYSNNMMKIDPDHVVALVTEVIPANSCLVFCPTKKNCENVAEMICKYLN-KLYVEHREAEKKNLI---ADLKNIGNGVLCSVLKRTIPFGIAYHHSGLTSDERKLIEEAYSAGVLCLLACTSTLAAGVNLPARRVILRAPYVANDFLKRAQYKQMVGRAGRAGIDSAGESILIIQEKDKELVQELISKPMENCYSNLMHNSGKDFQSLLLSLIGLKITKTAEEIYSFVSCTLFSVQQSVLCKAKNLLDVTKESLECLVDKGLICG-KTCSETEQYIFQVSKLGHATYKGCIDLACYDLLYSDLNRGLEGLVLESFLHLLYLVIPYDLVGKFNPDWMIYFRQYNSLSPVEQKVAASVGIPESFLARKASG----QTSANNMVVNRLYLSFILYTLLKETDIWRVSAKFSIPRGTLQNLLSSSASFSSSVLHFCEEL-DEFWAYKSLLQELTKKLTYCVKSELIPLMEVAGVMEARAKQLYNAGYTSLAHLANADPEVMVKKIEHLSRHQAKQIVFSAKTN 881          

HSP 2 Score: 96.2857 bits (238), Expect = 1.165e-19
Identity = 44/80 (55.00%), Postives = 62/80 (77.50%), Query Frame = 1
Query:  247 KIQELLKFHRGIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRAL 486
            ++++L+   R I KLYDWQ  CL +  I + +NL+YSLPTSGGKTLVAEIL+L++L  +Q+ V+ ILPY+A+VQEK+  L
Sbjct:  208 RVRDLIYQFRRIKKLYDWQHTCLTLQSIKERKNLIYSLPTSGGKTLVAEILVLQELLCRQKDVLMILPYVAIVQEKLHML 287          
BLAST of Helicase POLQ-like protein vs. Ensembl Xenopus
Match: polq (polymerase (DNA directed), theta [Source:NCBI gene;Acc:733897])

HSP 1 Score: 327.791 bits (839), Expect = 1.972e-93
Identity = 252/765 (32.94%), Postives = 388/765 (50.72%), Query Frame = 1
Query:  277 GIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVF------------GHA---RIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSE-ILPDKSCIIFCPTKRQCENLANNIIK--------------LTDPKLLIPDYKVKK---RDELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELI-----KTFEDIVEFLQGSLF--SIQNPGA------LGEILKSEVQYLIDHDLVRQVKSD-SDNEICVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTP-HDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLKIDEYSL---RRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDF-WSYKE-LLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASA 2412
            G+ ++++WQ ECL +  + + +NLVYS PTS GKTLVAE+L+LK++   +R  +FILP++++ +EK   L     ++   V+ Y G      P        V V TIEKA+ L+N LIE N+I  +G++VVDELHM+GD S RG  LEL L K   V             G A   +IVGMSATL NL  +  +L A  + +DFRP+ L E VK+ + +           ++      R  EP    +  K D D+++ L  E +    S +IFCP+K  CE LA+ I +                     +P   + +   RD +  Q+     G+   L + +  G+A+HH+GLT +ER +VE AF  G + V+  TSTL++GVNLPARRVIIR+P     L+    YKQMAGRAGRKG D +GE  ++    +R K  +L+  +    QS +L +    +   ++ AI LE+I      T ED+  +   +L   S++  G        G  +++ V +L+ ++ ++ ++ D    +  V + T+LG A +  S+       I++DL+ A     L   LH+LY+VTP ++   +I   W  +     KL  S K + + +G+ E  +     G   +K       +   RR + +L+L DL  + S+ E+   Y  S G +QSL  +A +Y    A  V  F N   W   E LL +  +RL   V  EL  L+ +  +   RA  LY AG  T+ ++A A
Sbjct:  209 GVSQMFEWQAECLMLGQVLEGKNLVYSAPTSAGKTLVAELLILKRVLETRRKALFILPFVSVAKEKTFYLQNLFQEVGVKVDGYMGSSS---PAGGFCSLDVAVCTIEKANGLVNRLIEENKIDLLGMMVVDELHMLGD-SHRGYLLELLLTKVRYVTQKGAVGRKAEGAGPANDVQIVGMSATLPNLGLLAAWLDAELYHTDFRPVPLLERVKIGRTV-----------YDSNMVAVREFEP---LLPVKGDDDHIVSLSYETVRGGHSILIFCPSKNWCEKLADTIAREFYNLFHRAQQRGDAGGSDSFVPPVALDRDGIRD-VMDQLKRSPAGLDAVLGRTVPWGVAFHHAGLTFDERDIVEGAFRQGFVRVLAATSTLSSGVNLPARRVIIRSPLFNGRLLDILTYKQMAGRAGRKGVDTEGESILVCKNPERAKGISLLQGSLKPVQSCLLRKEGAGVTGSMIRAI-LEIIVGGVADTPEDVRIYASCTLLAASMKQGGGDQEEEHGGGAIEACVDWLLRNEFIQILEEDRGGTKAEVYRPTKLGAATLSSSLSPSEALGIFADLQRAMKGFVLENDLHILYLVTPVYEEWTTI--DWYQFFCLWEKLPTSMKRVAELVGIEEGFLARSVNGKIVAKNDRQHRQIAIHRRFFTSLVLLDLISEVSLKELTKKYGCSRGQLQSLQQSAATY----AGMVTVFSNRLGWHNMELLLSQFQSRLTFGVQRELCDLVRVDLLNAQRARALYNAGLVTVAELARA 947          
BLAST of Helicase POLQ-like protein vs. Ensembl Mouse
Match: Helq (helicase, POLQ-like [Source:MGI Symbol;Acc:MGI:2176740])

HSP 1 Score: 641.343 bits (1653), Expect = 0.000e+0
Identity = 339/773 (43.86%), Postives = 505/773 (65.33%), Query Frame = 1
Query:  247 KIQELLKFHRGIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHARIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDELFRQIDAECLG-VCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQN-----PGALGEILKSEVQYLIDHDLVRQVKSDSDNE--ICVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLKIDEYSLRRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKELLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASAESRALHEILNPISGKLVRQIISSAKMNIQEKLEALSEEYKELV 2541
            K+++L    +GI KLYDWQ  CL +  + + +NL+YSLPTSGGKTLVAEILML++L  +Q+ V+ ILPY+A+VQEK+ +LS FG++L F VEEYAG KG++PP K  +  S+Y+ATIEKAHSL+N+LIET+++S +GL+VVDELHMIG+GS RGA LE+ L K +      +I+GMSATL+N+ ++  FL A  + S FRP+EL EF+KV+  I+ ++SQ   D     FS  R L    ++ ++KMDPD ++ LV+E++P+ SC++FCP+K+ CEN+A  + K      L  +++ K++ E+ + +     G VCP L++ +  GIAYHHSGLT EERK++EEA+  G + ++ CTSTLAAGVNLPARRVI+RAPYV    +K +QYKQM GRAGR G D  GE  +++ +KD+ +   LI      C S ++ E  + I+   LS I L++  +  DI +F+ G+ F +Q        +L EI    +++L +  L+ Q  S  DNE   C  + T+LG+A  +G+ID+     +Y DLK     L L + LH++Y+ TP+D+ A   P W  Y K+ G+L  +++ +   +GV+E  I     G    K K+D+  + RLY + +LY L  + +++ V+  +    G++Q+LL  A S+S+C+ +F EE   +FW YK LL +LT +L +CV  ELIPLME+ GV + RA +LY AGY +I+ +A+A    L + ++ +S +  RQI+SSAKM + EK EAL  E +EL+
Sbjct:  281 KVRDLYVQLKGIKKLYDWQHTCLTLRSVQERKNLIYSLPTSGGKTLVAEILMLQELLCRQKDVLMILPYVAIVQEKISSLSSFGIELGFFVEEYAGSKGRFPPIKRREKKSLYIATIEKAHSLVNALIETSRLSTLGLVVVDELHMIGEGS-RGAILEMTLAKVLYTSKTTQIIGMSATLNNVEDLQAFLKAEYYTSQFRPVELKEFLKVNDTIYEVDSQ-AADGM--TFS--RLLSYKYSEALKKMDPDRLVALVTEVIPNYSCLVFCPSKKNCENVAEMLCKFLSKDYL--NHREKEKCEVIKSLRNIGNGKVCPVLKRTVPFGIAYHHSGLTSEERKLLEEAYSTGVLCLLTCTSTLAAGVNLPARRVILRAPYVANTFLKRNQYKQMVGRAGRAGIDTAGESILLLQEKDKQQVLELISGPLETCCSHLVEEFTKGIQALFLSLIGLKIAASLGDIYQFMSGTFFGVQQKILLKEKSLWEITVDALEHLTEKGLL-QKDSCGDNEGLECHFRITKLGQASFKGAIDLAYCDTLYRDLKKGLEGLVLESLLHLIYLTTPYDLAAQSEPDWMVYFKQFGQLSPTEQNVAALLGVSESFIGKKAAGQAVRK-KVDKNVVNRLYLSFVLYSLLKETNVWSVSEKFNLPRGYIQNLLMGAASFSSCVLHFCEELE-EFWVYKALLVELTKKLTYCVKAELIPLMEVTGVLEGRAKQLYNAGYRSIMHLANANPEVLVKTIDHLSRRQARQIVSSAKMLLHEKAEALQGEAEELL 1042          
BLAST of Helicase POLQ-like protein vs. Ensembl Mouse
Match: Helq (helicase, POLQ-like [Source:MGI Symbol;Acc:MGI:2176740])

HSP 1 Score: 516.924 bits (1330), Expect = 9.911e-168
Identity = 269/601 (44.76%), Postives = 397/601 (66.06%), Query Frame = 1
Query:  247 KIQELLKFHRGIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHARIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDELFRQIDAECLG-VCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQNP-----GALGEILKSEVQYLIDHDLVRQVKSDSDNEI--CVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMI 2025
            K+++L    +GI KLYDWQ  CL +  + + +NL+YSLPTSGGKTLVAEILML++L  +Q+ V+ ILPY+A+VQEK+ +LS FG++L F VEEYAG KG++PP K  +  S+Y+ATIEKAHSL+N+LIET+++S +GL+VVDELHMIG+GS RGA LE+ L K +      +I+GMSATL+N+ ++  FL A  + S FRP+EL EF+KV+  I+ ++SQ   D     FS  R L    ++ ++KMDPD ++ LV+E++P+ SC++FCP+K+ CEN+A  + K      L  +++ K++ E+ + +     G VCP L++ +  GIAYHHSGLT EERK++EEA+  G + ++ CTSTLAAGVNLPARRVI+RAPYV    +K +QYKQM GRAGR G D  GE  +++ +KD+ +   LI      C S ++ E  + I+   LS I L++  +  DI +F+ G+ F +Q        +L EI    +++L +  L+ Q  S  DNE   C  + T+LG+A  +G+ID+     +Y DLK     L L + LH++Y+ TP+D+ A   P W  Y K+ G+L  +++ +   +GV+E  I
Sbjct:  280 KVRDLYVQLKGIKKLYDWQHTCLTLRSVQERKNLIYSLPTSGGKTLVAEILMLQELLCRQKDVLMILPYVAIVQEKISSLSSFGIELGFFVEEYAGSKGRFPPIKRREKKSLYIATIEKAHSLVNALIETSRLSTLGLVVVDELHMIGEGS-RGAILEMTLAKVLYTSKTTQIIGMSATLNNVEDLQAFLKAEYYTSQFRPVELKEFLKVNDTIYEVDSQ-AADGM--TFS--RLLSYKYSEALKKMDPDRLVALVTEVIPNYSCLVFCPSKKNCENVAEMLCKFLSKDYL--NHREKEKCEVIKSLRNIGNGKVCPVLKRTVPFGIAYHHSGLTSEERKLLEEAYSTGVLCLLTCTSTLAAGVNLPARRVILRAPYVANTFLKRNQYKQMVGRAGRAGIDTAGESILLLQEKDKQQVLELISGPLETCCSHLVEEFTKGIQALFLSLIGLKIAASLGDIYQFMSGTFFGVQQKILLKEKSLWEITVDALEHLTEKGLL-QKDSCGDNEGLECHFRITKLGQASFKGAIDLAYCDTLYRDLKKGLEGLVLESLLHLIYLTTPYDLAAQSEPDWMVYFKQFGQLSPTEQNVAALLGVSESFI 871          

HSP 2 Score: 56.9954 bits (136), Expect = 1.401e-7
Identity = 30/68 (44.12%), Postives = 45/68 (66.18%), Query Frame = 1
Query: 2338 HGVQKFRAAKLYKAGYDTIVKIASAESRALHEILNPISGKLVRQIISSAKMNIQEKLEALSEEYKELV 2541
              V+K RA +LY AGY +I+ +A+A    L + ++ +S +  RQI+SSAKM + EK EAL  E +EL+
Sbjct:  878 QAVRKGRAKQLYNAGYRSIMHLANANPEVLVKTIDHLSRRQARQIVSSAKMLLHEKAEALQGEAEELL 945          
BLAST of Helicase POLQ-like protein vs. Ensembl Mouse
Match: Polq (polymerase (DNA directed), theta [Source:MGI Symbol;Acc:MGI:2155399])

HSP 1 Score: 321.242 bits (822), Expect = 2.871e-91
Identity = 243/771 (31.52%), Postives = 391/771 (50.71%), Query Frame = 1
Query:  259 LLKFHR-GIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHA---------------RIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQ-KMDPDNVIGLVSEILPDK-SCIIFCPTKRQCENLANNIIK-----LTDPKLLI-----PDYKVKKRD--ELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLI---LEASSVC---QSSILSENCRMIKYFVLSAI--SLELIKTF-------EDIVEFLQGSLFSIQNPGALGEILKSEVQYLIDHDLVRQVKSDSDNEICVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTP--HDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLKIDEYSL---RRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKE-LLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASAES 2418
            L K+H  G+ K+++WQ ECL +  + + +NLVYS PTS GKTLVAE+L+LK++   ++  +FILP++++ +EK   L     ++   V+ Y G      PT       + V TIE+A+ L+N LIE N++  +G++VVDELHM+GD S RG  LEL L K   V   +               +IVGMSATL NL  +  +L+A  + +DFRP+ L E +K+   I+  +S +K     ++F P          ++Q K D D+++ L  E + D  S +IFCP+K+ CE +A+ I +        P+ L+     P   + ++   E+  Q+     G+   L+  +  G+A+HH+GLT EER ++E AF  G I V+  TSTL++GVNLPARRVIIR P      +    YKQM GRAGRKG D  GE  ++    ++ K   L+   LE    C   Q  + +   R I   ++  +  + + ++T+         I E  QG +   Q+   LG I  + V +L++++ ++  +        V   T LG A +  S+      +I++DL+ A     L   LH++Y+VTP   D    I+  W  +     KL  S K + + +GV E  +     G   ++ +     +   +R + +L+L DL  +  + ++   Y  + G +QSL  +A  Y+  +  F        W   E LL +   RL   +  EL  L+ +  +   RA  LY +G+ T+  +A A+S
Sbjct:   80 LEKYHSFGVRKMFEWQAECLLLGHVLEGKNLVYSAPTSAGKTLVAELLILKRVLETRKKALFILPFVSVAKEKKCYLQSLFQEVGLKVDGYMGSTS---PTGQFSSLDIAVCTIERANGLVNRLIEENKMDLLGMVVVDELHMLGD-SHRGYLLELLLTKICYVTRKSASHQAESASTLSNAVQIVGMSATLPNLQLVASWLNAELYHTDFRPVPLLESIKIGNSIY--DSSMK---LVREFQP----------LLQVKGDEDHIVSLCYETIQDNHSVLIFCPSKKWCEKVADIIAREFYNLHHQPEGLVKSSEFPPVILDQKSLLEVMDQLKRSPSGLDSVLKNTVPWGVAFHHAGLTFEERDIIEGAFRQGFIRVLAATSTLSSGVNLPARRVIIRTPIFSGQPLDILTYKQMVGRAGRKGVDTMGESILVCKNSEKSKGIALLQGSLEPVHSCLQRQGEVTASMIRAILEIIVGGVASTSQDMQTYAACTFLAAAIQEGKQG-MQRNQDDAQLGAI-DACVTWLLENEFIQVAEPGDGTGGKVYHPTHLGSATLSSSLSPTDTLDIFADLQRAMKGFVLENDLHIVYLVTPVFEDW---ISIDWYRFFCLWEKLPTSMKRVAELVGVEEGFLARCVKGKVVARTERQHRQMAIHKRFFTSLVLLDLISEIPLKDINQKYGCNRGQIQSLQQSAAVYAGMITVFSNRLG---WHNMELLLSQFQKRLTFGIQRELCDLIRVSLLNAQRARFLYASGFLTVADLARADS 823          
BLAST of Helicase POLQ-like protein vs. Ensembl Mouse
Match: Ascc3 (activating signal cointegrator 1 complex subunit 3 [Source:MGI Symbol;Acc:MGI:1925237])

HSP 1 Score: 128.257 bits (321), Expect = 2.396e-29
Identity = 126/489 (25.77%), Postives = 213/489 (43.56%), Query Frame = 1
Query:  343 NLVYSLPTSGGKTLVAEILMLKQLAIKQRS-VIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGK------GKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHA----RIVGMSATLDNLSEICQFLHA-----VAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKL----TDPKLLIPDYKVKKRDELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAP--YVGKDL----IKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFS---IQNPG--ALGEILKSEVQYLIDH 1716
            N++   PT  GKT+ AE+ + +       S  ++I P  ALV+E++        D    +EE  G K         P  K    A + V T EK   +  S    + + ++ +L++DE+H++G+   RG  LE+ + +   +  H     RIVG+S  L N  ++  +L+        F    RP+ L   V +  F              Q + P         +M     P      +    P K  +IF  ++RQ    A  +I       DPK  + +   ++ D +   +          L+  +  GI  HH+GL + +RK VEE F++  + V+  TSTLA GVN PA  VII+    Y GK         +   QM GRAGR  FDD+G+  ++V    +D +   + E   V +SS+L     ++   + + I+   I + +D ++++  + F    I NP   +LG++ +  +   + H
Sbjct: 1345 NVLLGAPTGSGKTVAAELAIFRVFNKYPTSKAVYIAPLKALVRERMD-------DWKIRIEEKLGKKVIELTGDVTPDMKSIAKADLIVTTPEKWDGVSRSWQNRSYVQQVNILIIDEIHLLGE--ERGPVLEVIVSRTNFISSHTEKPVRIVGLSTALANARDLADWLNIKQMGLFNFRPSVRPVPLE--VHIQGFP------------GQHYCP---------RMASMNKP--AFQAIRSHSPAKPVLIFVSSRRQTRLTALELIAFLATEEDPKQWL-NMDEQEMDNIIGTVRDS------NLKLTLAFGIGMHHAGLHERDRKTVEELFVNCKVQVLIATSTLAWGVNFPAHLVIIKGTEYYDGKTRRYVDFPITDVLQMMGRAGRPQFDDQGKAVILVHDIKKDFYKKFLYEPFPV-ESSLLG----VLSDHLNAEIAGGTITSKQDAMDYITWTYFFRRLIMNPSYYSLGDVSQDSINKFLSH 1787          

HSP 2 Score: 105.145 bits (261), Expect = 2.952e-22
Identity = 117/482 (24.27%), Postives = 206/482 (42.74%), Query Frame = 1
Query:  343 NLVYSLPTSGGKTLVAEILMLKQL-------AIKQRS--VIFILPYIALVQEKV----RALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKI-GLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHA----RIVGMSATLDNLSEICQFLHA------VAFDSDFRPIELSE-FVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVI--GLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAP--YVGK-----DLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQ---NPGALG 1677
            N++   PT  GKT +A + +L ++        IK+    ++++ P  AL  E      + L P G+ +  L  +    K +   T+      + V T EK   +    +    +S+I  LL++DE+H++ +   RG  LE  + + +R         RI+G+SATL N  ++  FLH         FD  FRP+ L + F+ +                            + NKM Q  + D V    ++ ++      ++F   +      A ++I+       I  +   +  E    +          +R++   G + HH+G+ +++R +VE  F +G I V+ CT+TLA GVNLPA  V+I+    Y  K     DL       Q+ GRAGR  FD  GE  +I        + +L+ +     Q+ I S+    +   + + I+L  +   E+ V ++  +   ++   NP A G
Sbjct:  495 NMLICAPTGAGKTNIAMLTILHEIRQHFHQGVIKKNEFKIVYVAPMKALAAEMTNYFSKRLEPLGIVVKELTGDMQLSKSEILRTQ------MLVTTPEKWDVVTRKSVGDVALSQIVKLLILDEVHLLHED--RGPVLESIVARTLRQVESTQSMIRILGLSATLPNYLDVATFLHVNPYIGLFYFDGRFRPVPLGQTFLGIK---------------------------STNKMQQLNNMDEVCYESVLKQVKAGHQVMVFVHARNATVRTAMSLIERAKNSGQISCFLPTEGPEYGHALKQVQKSRNKQVRELFSDGFSIHHAGMLRQDRNLVENLFSNGHIKVLVCTATLAWGVNLPAHAVVIKGTQIYAAKRGSFVDL-GILDVMQIFGRAGRPQFDKFGEGIIITTHDKLSHYLSLLTQ-----QNPIESQFLESLADNLNAEIALGTVTNVEEAVRWMSYTYLYVRMRANPLAYG 935          
BLAST of Helicase POLQ-like protein vs. Ensembl Mouse
Match: Mtrex (Mtr4 exosome RNA helicase [Source:MGI Symbol;Acc:MGI:1919448])

HSP 1 Score: 115.931 bits (289), Expect = 9.331e-26
Identity = 138/512 (26.95%), Postives = 222/512 (43.36%), Query Frame = 1
Query:  280 IDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHARIVGMSATLDNLSEICQFL--------HAVAFDSDFRPIELSEFV--KVDKFIHRI---NSQLKCDTFEQKFSPERNLEPNPNKMVQK------MDPDNVIGLVSEILPD--KSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDELFRQIDAECLG----VCPTLRQII---RMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAP--YVGKDL--IKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEF-LQGSLFSIQN----PGALGEILKSEVQY 1704
            +D      I+C     +   ++++ S  TS GKT+ AE  +   L  KQR VIF  P  AL  +K R +     D+  +      G     PT     AS  V T E   S++    E   + ++  ++ DE+H + D S RG   E  ++       +   V +SAT+ N  +  +++        H +   +D+RP  L  ++       +H +   N   + D F       R+   +  K  QK        P NV  +V  I+    +  IIF  +K+ CE  A  + KL        D + K  +E+F     +CL       P +  ++   + GI  HH GL    ++ +E  F +G I  +  T T A G+N+PAR V+      Y GKD   I   +Y QM+GRAGR+G DD+G   ++VD+K     G  +L+ S+   +S       M+         L L++  E   E+ L+ S +  Q+    PG + ++  SE QY
Sbjct:  138 LDAFQREAIQC-----VDNNQSVLVSAHTSAGKTVCAEYAIALALREKQR-VIFTSPIKALSNQKYREMYEEFQDVGLMT-----GDVTINPT-----ASCLVMTTEILRSMLYRGSEV--MREVAWVIFDEIHYMRD-SERGVVWEETIILLP---DNVHYVFLSATIPNARQFAEWICHLHKQPCHVIY--TDYRPTPLQHYIFPAGGDGLHLVVDENGDFREDNFNTAMQVLRDA-GDLAKGDQKGRKGGTKGPSNVFKIVKMIMERNFQPVIIFSFSKKDCEAYALQMTKLD----FNTDEEKKMVEEVFNNA-IDCLSDEDKKLPQVEHVLPLLKRGIGIHHGGLLPILKETIEILFSEGLIKALFATETFAMGINMPARTVLFTNARKYDGKDFRWISSGEYIQMSGRAGRRGMDDRGIVILMVDEKMSPTIGKQLLKGSADPLNSAFHLTYNMV---------LNLLRVEEINPEYMLEKSFYQFQHYRAIPGVVEKVKNSEEQY 610          
BLAST of Helicase POLQ-like protein vs. UniProt/SwissProt
Match: sp|Q2VPA6|HELQ_MOUSE (Helicase POLQ-like OS=Mus musculus OX=10090 GN=Helq PE=1 SV=2)

HSP 1 Score: 641.343 bits (1653), Expect = 0.000e+0
Identity = 339/773 (43.86%), Postives = 505/773 (65.33%), Query Frame = 1
Query:  247 KIQELLKFHRGIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHARIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDELFRQIDAECLG-VCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQN-----PGALGEILKSEVQYLIDHDLVRQVKSDSDNE--ICVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLKIDEYSLRRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKELLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASAESRALHEILNPISGKLVRQIISSAKMNIQEKLEALSEEYKELV 2541
            K+++L    +GI KLYDWQ  CL +  + + +NL+YSLPTSGGKTLVAEILML++L  +Q+ V+ ILPY+A+VQEK+ +LS FG++L F VEEYAG KG++PP K  +  S+Y+ATIEKAHSL+N+LIET+++S +GL+VVDELHMIG+GS RGA LE+ L K +      +I+GMSATL+N+ ++  FL A  + S FRP+EL EF+KV+  I+ ++SQ   D     FS  R L    ++ ++KMDPD ++ LV+E++P+ SC++FCP+K+ CEN+A  + K      L  +++ K++ E+ + +     G VCP L++ +  GIAYHHSGLT EERK++EEA+  G + ++ CTSTLAAGVNLPARRVI+RAPYV    +K +QYKQM GRAGR G D  GE  +++ +KD+ +   LI      C S ++ E  + I+   LS I L++  +  DI +F+ G+ F +Q        +L EI    +++L +  L+ Q  S  DNE   C  + T+LG+A  +G+ID+     +Y DLK     L L + LH++Y+ TP+D+ A   P W  Y K+ G+L  +++ +   +GV+E  I     G    K K+D+  + RLY + +LY L  + +++ V+  +    G++Q+LL  A S+S+C+ +F EE   +FW YK LL +LT +L +CV  ELIPLME+ GV + RA +LY AGY +I+ +A+A    L + ++ +S +  RQI+SSAKM + EK EAL  E +EL+
Sbjct:  281 KVRDLYVQLKGIKKLYDWQHTCLTLRSVQERKNLIYSLPTSGGKTLVAEILMLQELLCRQKDVLMILPYVAIVQEKISSLSSFGIELGFFVEEYAGSKGRFPPIKRREKKSLYIATIEKAHSLVNALIETSRLSTLGLVVVDELHMIGEGS-RGAILEMTLAKVLYTSKTTQIIGMSATLNNVEDLQAFLKAEYYTSQFRPVELKEFLKVNDTIYEVDSQ-AADGM--TFS--RLLSYKYSEALKKMDPDRLVALVTEVIPNYSCLVFCPSKKNCENVAEMLCKFLSKDYL--NHREKEKCEVIKSLRNIGNGKVCPVLKRTVPFGIAYHHSGLTSEERKLLEEAYSTGVLCLLTCTSTLAAGVNLPARRVILRAPYVANTFLKRNQYKQMVGRAGRAGIDTAGESILLLQEKDKQQVLELISGPLETCCSHLVEEFTKGIQALFLSLIGLKIAASLGDIYQFMSGTFFGVQQKILLKEKSLWEITVDALEHLTEKGLL-QKDSCGDNEGLECHFRITKLGQASFKGAIDLAYCDTLYRDLKKGLEGLVLESLLHLIYLTTPYDLAAQSEPDWMVYFKQFGQLSPTEQNVAALLGVSESFIGKKAAGQAVRK-KVDKNVVNRLYLSFVLYSLLKETNVWSVSEKFNLPRGYIQNLLMGAASFSSCVLHFCEELE-EFWVYKALLVELTKKLTYCVKAELIPLMEVTGVLEGRAKQLYNAGYRSIMHLANANPEVLVKTIDHLSRRQARQIVSSAKMLLHEKAEALQGEAEELL 1042          
BLAST of Helicase POLQ-like protein vs. UniProt/SwissProt
Match: sp|Q8TDG4|HELQ_HUMAN (Helicase POLQ-like OS=Homo sapiens OX=9606 GN=HELQ PE=1 SV=2)

HSP 1 Score: 635.565 bits (1638), Expect = 0.000e+0
Identity = 329/774 (42.51%), Postives = 502/774 (64.86%), Query Frame = 1
Query:  247 KIQELLKFHRGIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHARIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDELFRQIDAECLG-VCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQN-----PGALGEILKSEVQYLIDHDLVRQ---VKSDSDNEICVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLKIDEYSLRRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKELLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASAESRALHEILNPISGKLVRQIISSAKMNIQEKLEALSEEYKELV 2541
            K+++L    +GI+KLY+WQ  CL +  + + +NL+YSLPTSGGKTLVAEILML++L   ++ V+ ILPY+A+VQEK+  LS FG++L F VEEYAG KG++PPTK  +  S+Y+ATIEK HSL+NSLIET +I  +GL+VVDELHMIG+GS RGA LE+ L K +      +I+GMSATL+N+ ++ +FL A  + S FRP+EL E++K++  I+ ++S+      E   +  R L    +  ++KMDPD+++ LV+E++P+ SC++FCP+K+ CEN+A  I K    + L   +K K++ E+ + +     G +CP L++ I  G+AYHHSGLT +ERK++EEA+  G + +  CTSTLAAGVNLPARRVI+RAPYV K+ +K +QYKQM GRAGR G D  GE  +I+ +KD+ +   LI +    C S ++ E  + I+   LS I L++    +DI  F+ G+ F +Q        +L EI    ++YL +  L+++    KS+ + +      T+LGRA  +G+ID+     +Y DLK     L L + LH++Y+ TP+D+V+   P W  Y ++  +L  +++ +   +GV+E  I     G    K K+D+  + RLY + +LY L  + +I+ V+  +    G++Q+LL    S+S+C+ +F EE   +FW Y+ LL +LT +L +CV  ELIPLME+ GV + RA +LY AGY +++ +A+A    L   ++ +S +  +QI+SSAKM + EK EAL EE +EL+
Sbjct:  322 KVRDLYAQFKGIEKLYEWQHTCLTLNSVQERKNLIYSLPTSGGKTLVAEILMLQELLCCRKDVLMILPYVAIVQEKISGLSSFGIELGFFVEEYAGSKGRFPPTKRREKKSLYIATIEKGHSLVNSLIETGRIDSLGLVVVDELHMIGEGS-RGATLEMTLAKILYTSKTTQIIGMSATLNNVEDLQKFLQAEYYTSQFRPVELKEYLKINDTIYEVDSKA-----ENGMTFSRLLNYKYSDTLKKMDPDHLVALVTEVIPNYSCLVFCPSKKNCENVAEMICKFLSKEYL--KHKEKEKCEVIKNLKNIGNGNLCPVLKRTIPFGVAYHHSGLTSDERKLLEEAYSTGVLCLFTCTSTLAAGVNLPARRVILRAPYVAKEFLKRNQYKQMIGRAGRAGIDTIGESILILQEKDKQQVLELITKPLENCYSHLVQEFTKGIQTLFLSLIGLKIATNLDDIYHFMNGTFFGVQQKVLLKEKSLWEITVESLRYLTEKGLLQKDTIYKSEEEVQYN-FHITKLGRASFKGTIDLAYCDILYRDLKKGLEGLVLESLLHLIYLTTPYDLVSQCNPDWMIYFRQFSQLSPAEQNVAAILGVSESFIGKKASGQAIGK-KVDKNVVNRLYLSFVLYTLLKETNIWTVSEKFNMPRGYIQNLLTGTASFSSCVLHFCEELE-EFWVYRALLVELTKKLTYCVKAELIPLMEVTGVLEGRAKQLYSAGYKSLMHLANANPEVLVRTIDHLSRRQAKQIVSSAKMLLHEKAEALQEEVEELL 1084          
BLAST of Helicase POLQ-like protein vs. UniProt/SwissProt
Match: sp|Q588V7|TEB_ARATH (Helicase and polymerase-containing protein TEBICHI OS=Arabidopsis thaliana OX=3702 GN=TEB PE=2 SV=1)

HSP 1 Score: 357.066 bits (915), Expect = 1.591e-102
Identity = 252/773 (32.60%), Postives = 396/773 (51.23%), Query Frame = 1
Query:  274 RGIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVF----------------------GHA-RIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPD-KSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDELFRQIDA---ECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQNPGALGEILKS---EVQYLIDHDLVRQVKSDSDNEICVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEM---------------------------GCCQSKLKIDEYSLR---RLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKELLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASA 2412
            +GI KLY WQ+ECL++ G+ + RNLVY   TS GK+ VAE+LML+++    +  + +LPY+++  EK   L      L   V  Y G +G     K T   SV V TIEKA+SLIN L+E  ++S++G++V+DELHM+GD   RG  LEL L K                            H  +IVGMSAT+ N+  +  +L A  + ++FRP+ L E++KV   I           + +K    R + P    M  K DPD+++ L +E++ +  S +IFC +++ CE+ A +I KL     +  D +  +  ++   IDA      GV P L + +  G+AYHH+GLT EER++VE  +  G + V+  TSTLAAGVNLPARRVI R P +G+D I  ++YKQM+GRAGR G D KG+  +I    +  +   L+ E     Q S LSE+   + + +L  ++  +++T +DI  +++ +L +   P    +++KS    +++L     +     + + E  +   T LGR     S+       +  DL  A   L +A+ LH++Y+VTP ++   + P+W  Y +R  +L   ++ +   +GV E   F++ M                           G    K+  DE  LR   R + ALIL  L  + S+ EV   ++ + G VQ+L   A  +S+ ++ F E  R  +   + L+ K   R++  V  E++ L  I  ++  RA  LYKAG  T   IA A
Sbjct:  510 KGISKLYPWQVECLQVDGVLQKRNLVYCASTSAGKSFVAEVLMLRRVIRTGKMALLVLPYVSICAEKAEHLEVLLEPLGKHVRSYYGNQGGGTLPKDT---SVAVCTIEKANSLINRLLEEGRLSELGIIVIDELHMVGD-QHRGYLLELMLTKLRYAAGEGSSESSSGESSGTSSGKADPAHGLQIVGMSATMPNVGAVADWLQAALYQTEFRPVPLEEYIKVGSTI-----------YNKKMEVVRTI-PKAADMGGK-DPDHIVELCNEVVQEGNSVLIFCSSRKGCESTARHISKLIKNVPVNVDGENSEFMDIRSAIDALRRSPSGVDPVLEETLPSGVAYHHAGLTVEEREIVETCYRKGLVRVLTATSTLAAGVNLPARRVIFRQPMIGRDFIDGTRYKQMSGRAGRTGIDTKGDSVLICKPGELKRIMALLNETCPPLQ-SCLSEDKNGMTHAILEVVAGGIVQTAKDIHRYVRCTLLNSTKP--FQDVVKSAQDSLRWLCHRKFL-----EWNEETKLYTTTPLGRGSFGSSLCPEESLIVLDDLLRAREGLVMASDLHLVYLVTPINV--GVEPNWELYYERFMELSPLEQSVGNRVGVVEP--FLMRMAHGATVRTLNRPQDVKKNLRGEYDSRHGSTSMKMLSDEQMLRVCKRFFVALILSKLVQEASVTEVCEAFKVARGMVQALQENAGRFSSMVSVFCE--RLGWHDLEGLVAKFQNRVSFGVRAEIVELTSIPYIKGSRARALYKAGLRTSQAIAEA 1251          
BLAST of Helicase POLQ-like protein vs. UniProt/SwissProt
Match: sp|O75417|DPOLQ_HUMAN (DNA polymerase theta OS=Homo sapiens OX=9606 GN=POLQ PE=1 SV=2)

HSP 1 Score: 334.339 bits (856), Expect = 8.395e-95
Identity = 252/770 (32.73%), Postives = 389/770 (50.52%), Query Frame = 1
Query:  259 LLKFHR-GIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHA---------------RIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQ-KMDPDNVIGLVSEILPDK-SCIIFCPTKRQCENLANNIIK-----------LTDPKLLIPD-YKVKKRDELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELI-----KTFEDI-----VEFLQGSLFS-------IQNPGALGEILKSEVQYLIDHDLVRQVKSDSDNEICVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITP-SWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLKIDEYSL---RRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKE-LLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASA 2412
            L K+H  G+ K+++WQ ECL +  + + +NLVYS PTS GKTLVAE+L+LK++   ++  +FILP++++ +EK   L     ++   V+ Y G      P++H     + V TIE+A+ LIN LIE N++  +G++VVDELHM+GD S RG  LEL L K   +   +               +IVGMSATL NL  +  +L+A  + +DFRP+ L E VKV   I+  + +L            R  EP    M+Q K D D+V+ L  E + D  S ++FCP+K+ CE LA+ I +           L  P    P   + K+  E+  Q+     G+   L++ +  G+A+HH+GLT EER ++E AF  G I V+  TSTL++GVNLPARRVIIR P  G   +    YKQM GRAGRKG D  GE  +I    ++ K   L+  +    +S +       +   ++ AI LE+I      T +D+       FL  S+          Q    LG I ++ V +L++++ ++  ++    E  V   T LG A +  S+      +I++DL+ A     L   LH+LY+VTP  M    T   W  +     KL  S K + + +GV E  +     G   ++ +     +   +R + +L+L DL  +  + E+   Y  + G +QSL  +A  Y+  +  F        W   E LL +   RL   +  EL  L+ +  +   RA  LY +G+ T+  +A A
Sbjct:   81 LEKYHSFGVKKMFEWQAECLLLGQVLEGKNLVYSAPTSAGKTLVAELLILKRVLEMRKKALFILPFVSVAKEKKYYLQSLFQEVGIKVDGYMGSTS---PSRHFSSLDIAVCTIERANGLINRLIEENKMDLLGMVVVDELHMLGD-SHRGYLLELLLTKICYITRKSASCQADLASSLSNAVQIVGMSATLPNLELVASWLNAELYHTDFRPVPLLESVKVGNSIYDSSMKLV-----------REFEP----MLQVKGDEDHVVSLCYETICDNHSVLLFCPSKKWCEKLADIIAREFYNLHHQAEGLVKPSECPPVILEQKELLEVMDQLRRLPSGLDSVLQKTVPWGVAFHHAGLTFEERDIIEGAFRQGLIRVLAATSTLSSGVNLPARRVIIRTPIFGGRPLDILTYKQMVGRAGRKGVDTVGESILICKNSEKSKGIALLQGSLKPVRSCLQRREGEEVTGSMIRAI-LEIIVGGVASTSQDMHTYAACTFLAASMKEGKQGIQRNQESVQLGAI-EACVMWLLENEFIQSTEASDGTEGKVYHPTHLGSATLSSSLSPADTLDIFADLQRAMKGFVLENDLHILYLVTP--MFEDWTTIDWYRFFCLWEKLPTSMKRVAELVGVEEGFLARCVKGKVVARTERQHRQMAIHKRFFTSLVLLDLISEVPLREINQKYGCNRGQIQSLQQSAAVYAGMITVFSNRLG---WHNMELLLSQFQKRLTFGIQRELCDLVRVSLLNAQRARVLYASGFHTVADLARA 824          
BLAST of Helicase POLQ-like protein vs. UniProt/SwissProt
Match: sp|Q8CGS6|DPOLQ_MOUSE (DNA polymerase theta OS=Mus musculus OX=10090 GN=Polq PE=1 SV=2)

HSP 1 Score: 321.242 bits (822), Expect = 2.008e-90
Identity = 243/771 (31.52%), Postives = 391/771 (50.71%), Query Frame = 1
Query:  259 LLKFHR-GIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHA---------------RIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQ-KMDPDNVIGLVSEILPDK-SCIIFCPTKRQCENLANNIIK-----LTDPKLLI-----PDYKVKKRD--ELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLI---LEASSVC---QSSILSENCRMIKYFVLSAI--SLELIKTF-------EDIVEFLQGSLFSIQNPGALGEILKSEVQYLIDHDLVRQVKSDSDNEICVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTP--HDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLKIDEYSL---RRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKE-LLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASAES 2418
            L K+H  G+ K+++WQ ECL +  + + +NLVYS PTS GKTLVAE+L+LK++   ++  +FILP++++ +EK   L     ++   V+ Y G      PT       + V TIE+A+ L+N LIE N++  +G++VVDELHM+GD S RG  LEL L K   V   +               +IVGMSATL NL  +  +L+A  + +DFRP+ L E +K+   I+  +S +K     ++F P          ++Q K D D+++ L  E + D  S +IFCP+K+ CE +A+ I +        P+ L+     P   + ++   E+  Q+     G+   L+  +  G+A+HH+GLT EER ++E AF  G I V+  TSTL++GVNLPARRVIIR P      +    YKQM GRAGRKG D  GE  ++    ++ K   L+   LE    C   Q  + +   R I   ++  +  + + ++T+         I E  QG +   Q+   LG I  + V +L++++ ++  +        V   T LG A +  S+      +I++DL+ A     L   LH++Y+VTP   D    I+  W  +     KL  S K + + +GV E  +     G   ++ +     +   +R + +L+L DL  +  + ++   Y  + G +QSL  +A  Y+  +  F        W   E LL +   RL   +  EL  L+ +  +   RA  LY +G+ T+  +A A+S
Sbjct:   80 LEKYHSFGVRKMFEWQAECLLLGHVLEGKNLVYSAPTSAGKTLVAELLILKRVLETRKKALFILPFVSVAKEKKCYLQSLFQEVGLKVDGYMGSTS---PTGQFSSLDIAVCTIERANGLVNRLIEENKMDLLGMVVVDELHMLGD-SHRGYLLELLLTKICYVTRKSASHQAESASTLSNAVQIVGMSATLPNLQLVASWLNAELYHTDFRPVPLLESIKIGNSIY--DSSMK---LVREFQP----------LLQVKGDEDHIVSLCYETIQDNHSVLIFCPSKKWCEKVADIIAREFYNLHHQPEGLVKSSEFPPVILDQKSLLEVMDQLKRSPSGLDSVLKNTVPWGVAFHHAGLTFEERDIIEGAFRQGFIRVLAATSTLSSGVNLPARRVIIRTPIFSGQPLDILTYKQMVGRAGRKGVDTMGESILVCKNSEKSKGIALLQGSLEPVHSCLQRQGEVTASMIRAILEIIVGGVASTSQDMQTYAACTFLAAAIQEGKQG-MQRNQDDAQLGAI-DACVTWLLENEFIQVAEPGDGTGGKVYHPTHLGSATLSSSLSPTDTLDIFADLQRAMKGFVLENDLHIVYLVTPVFEDW---ISIDWYRFFCLWEKLPTSMKRVAELVGVEEGFLARCVKGKVVARTERQHRQMAIHKRFFTSLVLLDLISEIPLKDINQKYGCNRGQIQSLQQSAAVYAGMITVFSNRLG---WHNMELLLSQFQKRLTFGIQRELCDLIRVSLLNAQRARFLYASGFLTVADLARADS 823          
BLAST of Helicase POLQ-like protein vs. TrEMBL
Match: K1QZF0 (Helicase POLQ-like protein OS=Crassostrea gigas OX=29159 GN=CGI_10018463 PE=4 SV=1)

HSP 1 Score: 685.256 bits (1767), Expect = 0.000e+0
Identity = 363/806 (45.04%), Postives = 531/806 (65.88%), Query Frame = 1
Query:  247 KIQELLKFHRGIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHARIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDP--KLLIPDYKVKKRD---ELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQNPGALGEIL---KSEVQYLIDHDLVRQVKSDSDNE--IC---VLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLKIDEYSLRRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKELLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASAESRALHEILNPISGKLVRQIISSAKMNIQEKLEALSEEYKELVVV-------RGA--SIATADEMDTCTHS 2598
            K+QELL+  RGI  LY+WQ  CLK+P + K  NLVYSLPTSGGKTLVAE+L+LK+L  K+R  + ILP++++VQEKV+ L+   ++L+FLVEEYAG +G++PP KH +   +Y+ATIEKAHSL+NSL+E +++  +GL+VVDELHMIG+G  RGA LE  LLK +      +I+GMSATL+N+ ++  FL A  F SDFRP++L+E+VK+   I  +    K  T + +   +R +    +  + K+DPD+++GLV+E++P  SC+IFCPTK+ CEN+A  + KL     + L    K ++RD   EL+R  D E   +CP L+  I  G+AYHHSGLT +ER+++E A+ DG + V+ CTSTLAAGVNLPA+RVI+R PY+G   +  SQYKQM GRAGR G D  GE  +IV  KDR K  ++I      C SS+  ++ + IK  +LS+I L++  T + + + +  +L S+Q      +I+   K  +Q LID  LV Q +S S  E   C    L+ T LGRA  +GSID+    ++Y+DLK AE SL LA++LH+L++VTP+D+V  + PSW  Y K+I  L   + ++ + IGV E  +     G    ++ +DE+ ++R Y  L+LYDLW QKS++EVA  ++Q  GF+Q+LL +  S+ AC+ +F +E   +FW+Y+ELL     RLA+CVS EL+PLMEI GV+  RA +LY AG+ +  ++A+AE   L   +  I  K+ RQI++SAK+ + EK EAL +E ++LV V       +G+  S++  ++MD  +HS
Sbjct:  323 KVQELLQKQRGITSLYEWQDRCLKLPSLQKGGNLVYSLPTSGGKTLVAEVLILKELLCKKRDALMILPFVSIVQEKVKGLAQLAVELDFLVEEYAGSRGRFPPIKHRR-RCLYIATIEKAHSLVNSLLEQDRLDSLGLVVVDELHMIGEGKSRGACLEATLLKVLHARAPTQIIGMSATLNNIGDLLSFLKADIFSSDFRPVKLTEYVKLQDNIFEVQ---KGQTLQDRLDHQRTVTFEYSPEMAKVDPDHLLGLVTEVIPQHSCLIFCPTKKNCENVALMLSKLMAKHRRELSQVRKQERRDLLKELYR--DGE-QRMCPVLQHTIHFGLAYHHSGLTTDERQLLEAAYTDGVLCVLACTSTLAAGVNLPAKRVILRNPYIGTQFLNRSQYKQMIGRAGRAGKDTTGESILIVSPKDRCKVWDIISGPVESCFSSLTYDDGKGIKSLILSSIGLQITSTTKAVFDMMSQTLLSLQASHLSCDIVAMTKDALQQLIDEGLVVQKRSLSQGEEIFCHDPSLEVTPLGRATFKGSIDLEFSTQLYTDLKKAEESLVLASHLHLLFLVTPYDLVKDVRPSWMTYFKQISLLTPVELKVAELIGVPEAYVAKKASGQVTRQV-VDEFVVKRFYLTLMLYDLWRQKSLWEVAEKFDQPRGFIQNLLSSTASFGACVYHFCQEL-EEFWAYQELLGTFVKRLAYCVSAELLPLMEISGVKLGRARQLYSAGFHSTAQVAAAEPETLVRSIKQIPRKVARQIVASAKLLLNEKAEALLQEVEDLVTVPVDRMTSQGSPRSLSQLNDMDIFSHS 1119          
BLAST of Helicase POLQ-like protein vs. TrEMBL
Match: A0A1V4JUT9 (Helicase POLQ-like isoform A OS=Patagioenas fasciata monilis OX=372326 GN=HELQ PE=4 SV=1)

HSP 1 Score: 664.07 bits (1712), Expect = 0.000e+0
Identity = 341/774 (44.06%), Postives = 512/774 (66.15%), Query Frame = 1
Query:  247 KIQELLKFHRGIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHARIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDELFRQIDAECLG-VCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQN-----PGALGEILKSEVQYLIDHDLVRQVKSDSD-NEICVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLKIDEYSLRRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKELLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASAESRALHEILNPISGKLVRQIISSAKMNIQEKLEALSEEYKELVVV 2547
            K+++LLK  RGI+ LY+WQ  CL +  + + +NL+YSLPTSGGKTLVAEI++L++L  +Q++V+ ILPY+A+VQEKVR LS FG++L FLVEEYAG KG++PP K     S+Y+ATIEK H+L+NSLIET +I  +GL+VVDELHM+G+GS RGA LE+ L K +    + +I+GMSATL+N+ ++ +FL A  + ++FRP+EL E+VK+   I+ ++ +      E+ F+  R L    +  +QK DPD++I LV+E++P  SC+IFCPTK+ CEN+A+ + K  + +     ++ K++ +L + +     G VCP L+Q I  G+AYHHSGLT +ERK +EEA+  G + ++ CT+TLAAGVNLPARRVI+RAPYV  D +K +QYKQM GRAGR G DD GE  +IV +KDR    +L+      C S++L E  + ++  +LS + L++  T E++  F+ G+L  +Q        +L EI+K  ++ LI+  L++   S+ D N  C L  T LG+A  +GSID+     +Y +LK     L L + LH+LY+ TP+DM ++ +P W  Y K+  +L  +++++   +GV E  I     G    K  +D   + RLY   +LY L  + +++ V+  +  S G+VQ+LL++A S+++C+ +F EE   +FW YK LL +LT +L +CV  ELIPLME+ GV + RA +LY AGY T+  +A+A    L +++  +S +  +QIISSAKM + EK EAL EE +EL+ V
Sbjct:  278 KVKDLLKQFRGIETLYEWQHNCLMLESLQRRKNLIYSLPTSGGKTLVAEIIILQELLCRQKNVLMILPYVAIVQEKVRGLSSFGIELGFLVEEYAGSKGRFPPIKRRIKKSLYIATIEKGHALVNSLIETERIDDLGLVVVDELHMLGEGS-RGATLEITLAKILYTSKNTQIIGMSATLNNVEDLQKFLQAEYYTNNFRPVELKEYVKIRDTIYAVDGKT-----EKGFTFSRLLNFKYSSKLQKADPDHIIALVTEVIPKYSCLIFCPTKKNCENVASMVCKYLEKEFRA--HREKEKQDLIKDLKNIGNGSVCPVLKQTIPFGVAYHHSGLTNDERKSIEEAYSAGILCLLACTATLAAGVNLPARRVILRAPYVASDFLKKNQYKQMIGRAGRAGIDDAGESILIVQEKDRHLVQDLVSSPLENCYSNLLLELTKGMQSLLLSLVGLKIAVTQEEVSNFMCGTLLGVQQQLLSKEKSLSEIIKDGLENLIEKGLLKGRTSEKDHNTKCTLTVTPLGKATYKGSIDLAYCNLLYRELKQGLEGLILESNLHLLYLATPYDMTSNCSPDWMIYLKQFNQLSGAEQKVADIVGVPESFIIKKASGQAIRK-NVDSAVVNRLYLTFVLYALLKETNVWSVSEKFNMSRGYVQNLLNSAASFASCVLHFCEELE-EFWVYKALLTELTKQLTYCVKTELIPLMEVAGVLEARAKQLYNAGYKTLAHLANANPEILVKVIERLSRRQAKQIISSAKMLLSEKAEALQEEVEELLKV 1041          
BLAST of Helicase POLQ-like protein vs. TrEMBL
Match: A0A433TIF4 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_010943 PE=4 SV=1)

HSP 1 Score: 664.07 bits (1712), Expect = 0.000e+0
Identity = 336/778 (43.19%), Postives = 516/778 (66.32%), Query Frame = 1
Query:  238 MSIKIQELLKFHRGIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHARIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQ-LKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKL-TDPKLLIPDYKVKKRDELFRQIDAECLG-VCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQNPGALG----EILKSEVQYLIDHDLV-RQVKSDSDNEICVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLKIDEYSLRRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKELLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASAESRALHEILNPISGKLVRQIISSAKMNIQEKLEALSEEYKELVVV 2547
            + +K+Q+LL+  RGI KLYDWQ ECL++  +   +NL+YSLPTSGGKTLVAEILM++Q+   +R  I +LP++++VQEKVR+++ F  +L FLVEEYAG KG++PPTK  +  S+Y+ATIEKAHSL+NSLIE  +   +GL+VVDELHMIG+G  RG+NLE  LLK + +    +IVGMSATL+N+ E+ QFLHA  + ++FRP+ L EFVKV+  I  +N Q L+    E +   ++ +    +  + ++DPD+++ LV E+ PDKSC++FCP+KR CE+++  + KL       + D    KR +L  ++  +  G +CP L + ++ G+AYHHSGLT +ER+++E+A+ DGT+ V+ CTSTLAAGVNLPA+RVI+R+PYVG  LIK SQYKQM GRAGR G D  GE ++IV  +DR K   ++      C SS++ +  + +K  +LSAI L+++ +       +  SL +IQ    LG     +    V+YL+   LV R V+ +       L  + +G+A  +G +D +   ++Y DLK++E+SLNL+TYLH+LY+VTP+D    I P+++ Y K+   L  ++ ++  +IGV E+ +  L  G   S+ K+   ++ R Y  L+L+DLW + ++++VA  + Q+ GF+Q+LL  A ++++C+ ++ EE   +FW+Y+ LL K   RLAHCV+ EL+PLM++ GV+  RA +LY AGY ++ ++A+A    L   +  +S +   QI+S+AK  ++E+  AL EE   L V+
Sbjct:  235 LPLKVQKLLEASRGISKLYDWQEECLQLDALKDKKNLIYSLPTSGGKTLVAEILMMRQVLCHKRDAILVLPFVSIVQEKVRSITEFATELGFLVEEYAGSKGRFPPTKRREKKSLYIATIEKAHSLVNSLIELGRTEALGLVVVDELHMIGEGGSRGSNLEALLLKIVALGSDIQIVGMSATLNNIDELQQFLHAEIYSNNFRPVPLKEFVKVEDNIFHVNHQTLRA---EDRLEHDKFVTFPYSSELLRLDPDHLLALVLEVAPDKSCLVFCPSKRNCESVSVMLSKLMASHHSYLRDINKSKRRQLLEELGRDGGGQICPVLARTVQFGVAYHHSGLTMDERRLIEDAYSDGTLCVLTCTSTLAAGVNLPAKRVILRSPYVGLSLIKHSQYKQMVGRAGRAGIDSSGESYLIVSSQDRMKVKEMLSGPQDFCHSSLMYDGGKGVKSLLLSAIGLKMVTSVPQAFSLMNQSLLAIQ-ARKLGVDVETVTTDAVEYLLGQGLVTRGVECEGQ-----LLVSPVGQATFKGPVDHMYSGQLYRDLKASESSLNLSTYLHLLYLVTPYDTALDIKPAFDIYFKKYCSLSETETKVAAAIGVPENYL-SLRAGGLSSRKKVCLLTVNRFYLTLMLWDLWKEHTVWQVAETFSQTRGFIQNLLSQAAAFASCVLHYCEEL-EEFWAYQVLLEKFVKRLAHCVTSELLPLMDVPGVKLARAKQLYSAGYRSVSQLAAATEDQLSSCVAHLSRRAASQIVSAAKNILEERKAALMEEVDSLNVL 1001          
BLAST of Helicase POLQ-like protein vs. TrEMBL
Match: A0A2I0MGL7 (Helicase, POLQ-like OS=Columba livia OX=8932 GN=HELQ PE=4 SV=1)

HSP 1 Score: 663.685 bits (1711), Expect = 0.000e+0
Identity = 343/774 (44.32%), Postives = 510/774 (65.89%), Query Frame = 1
Query:  247 KIQELLKFHRGIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHARIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDELFRQIDAECLG-VCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQNP-----GALGEILKSEVQYLIDHDLVRQVKSDSD-NEICVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLKIDEYSLRRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKELLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASAESRALHEILNPISGKLVRQIISSAKMNIQEKLEALSEEYKELVVV 2547
            K+++LLK  RGI+ LY+WQ  CL +  + + +NL+YSLPTSGGKTLVAEI++L++L  +Q++V+ ILPY+A+VQEKVR LS FG++L FLVEEYAG KG++PP K     S+Y+ATIEK H+L+NSLIET +I  +GL+VVDELHM+G+GS RGA LE+ L K +    + +I+GMSATL+N+ ++ +FL A  + ++FRP+EL E+VK+   I+ ++S+      E+ F+  R L    +  +QK DPD++I LV+E++P  SC+IFCPTK+ CEN+A+ + K    +     ++ K++ +L + +     G VCP L+Q I  G+AYHHSGLT +ERK +EEA+  G + ++ CT+TLAAGVNLPARRVI+RAPYV  D +K +QYKQM GRAGR G DD GE  +IV +KDR    +L+      C S++L E  + ++  +LS + L++  T E++  F+  +L  +Q        +L EI+K  ++ LI   L+R   S+ D N  C L  T LG+A  +GSID+     +Y +LK     L L + LH+LY+ TP+DM ++ +P W  Y K+  +L A+++++   +GV E  I     G    K  +D   + RLY   +LY L  + +++ V+  +  S G+VQ+LL +A S+++C+ +F EE   +FW YK LL +LT +L +CV  ELIPLME+ GV + RA +LY AGY T+  +A+A    L +++  +S +  +QIISSAKM + EK EAL EE +EL+ V
Sbjct:  278 KVKDLLKQFRGIETLYEWQHNCLMLESLQQRKNLIYSLPTSGGKTLVAEIIILQELLCRQKNVLMILPYVAIVQEKVRGLSSFGIELGFLVEEYAGSKGRFPPIKRRIKKSLYIATIEKGHALVNSLIETERIDDLGLVVVDELHMLGEGS-RGATLEITLAKILYTSKNTQIIGMSATLNNVEDLQKFLQAEYYTNNFRPVELKEYVKIRDTIYAVDSKT-----EKGFTFSRLLNFKYSSNLQKADPDHIIALVTEVIPKYSCLIFCPTKKNCENVASMVCKYLQKEFRA--HREKEKQDLIKDLKNIGNGSVCPVLKQTIPFGVAYHHSGLTNDERKSIEEAYSAGILCLLACTATLAAGVNLPARRVILRAPYVASDFLKKNQYKQMIGRAGRAGIDDAGESILIVQEKDRHLVQDLVSSPLENCYSNLLLELTKGMQSLLLSLVGLKIAVTHEEVSNFMCSTLLGVQQQLLSKDKSLSEIIKDGLENLIQKGLLRGRTSEKDHNSKCTLTVTPLGKATYKGSIDLAYCNLLYRELKKGLEGLILESNLHLLYLATPYDMTSNCSPDWMIYLKQFNQLSAAEQKVADVVGVPESFIIKKASGQAIRK-NMDSAVVNRLYLTFVLYALLKETNVWSVSEKFNMSRGYVQNLLSSAASFASCVLHFCEELE-EFWVYKALLTELTKQLTYCVKTELIPLMEVAGVLEARAKQLYNAGYKTLAHLANANPEILVKVIEHLSRRQAKQIISSAKMLLSEKAEALQEEVEELLKV 1041          
BLAST of Helicase POLQ-like protein vs. TrEMBL
Match: A0A1V4JUX3 (Helicase POLQ-like isoform B OS=Patagioenas fasciata monilis OX=372326 GN=HELQ PE=4 SV=1)

HSP 1 Score: 663.3 bits (1710), Expect = 0.000e+0
Identity = 341/774 (44.06%), Postives = 512/774 (66.15%), Query Frame = 1
Query:  247 KIQELLKFHRGIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHARIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDELFRQIDAECLG-VCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQN-----PGALGEILKSEVQYLIDHDLVRQVKSDSD-NEICVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLKIDEYSLRRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKELLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASAESRALHEILNPISGKLVRQIISSAKMNIQEKLEALSEEYKELVVV 2547
            K+++LLK  RGI+ LY+WQ  CL +  + + +NL+YSLPTSGGKTLVAEI++L++L  +Q++V+ ILPY+A+VQEKVR LS FG++L FLVEEYAG KG++PP K     S+Y+ATIEK H+L+NSLIET +I  +GL+VVDELHM+G+GS RGA LE+ L K +    + +I+GMSATL+N+ ++ +FL A  + ++FRP+EL E+VK+   I+ ++ +      E+ F+  R L    +  +QK DPD++I LV+E++P  SC+IFCPTK+ CEN+A+ + K  + +     ++ K++ +L + +     G VCP L+Q I  G+AYHHSGLT +ERK +EEA+  G + ++ CT+TLAAGVNLPARRVI+RAPYV  D +K +QYKQM GRAGR G DD GE  +IV +KDR    +L+      C S++L E  + ++  +LS + L++  T E++  F+ G+L  +Q        +L EI+K  ++ LI+  L++   S+ D N  C L  T LG+A  +GSID+     +Y +LK     L L + LH+LY+ TP+DM ++ +P W  Y K+  +L  +++++   +GV E  I     G    K  +D   + RLY   +LY L  + +++ V+  +  S G+VQ+LL++A S+++C+ +F EE   +FW YK LL +LT +L +CV  ELIPLME+ GV + RA +LY AGY T+  +A+A    L +++  +S +  +QIISSAKM + EK EAL EE +EL+ V
Sbjct:  197 KVKDLLKQFRGIETLYEWQHNCLMLESLQRRKNLIYSLPTSGGKTLVAEIIILQELLCRQKNVLMILPYVAIVQEKVRGLSSFGIELGFLVEEYAGSKGRFPPIKRRIKKSLYIATIEKGHALVNSLIETERIDDLGLVVVDELHMLGEGS-RGATLEITLAKILYTSKNTQIIGMSATLNNVEDLQKFLQAEYYTNNFRPVELKEYVKIRDTIYAVDGKT-----EKGFTFSRLLNFKYSSKLQKADPDHIIALVTEVIPKYSCLIFCPTKKNCENVASMVCKYLEKEFRA--HREKEKQDLIKDLKNIGNGSVCPVLKQTIPFGVAYHHSGLTNDERKSIEEAYSAGILCLLACTATLAAGVNLPARRVILRAPYVASDFLKKNQYKQMIGRAGRAGIDDAGESILIVQEKDRHLVQDLVSSPLENCYSNLLLELTKGMQSLLLSLVGLKIAVTQEEVSNFMCGTLLGVQQQLLSKEKSLSEIIKDGLENLIEKGLLKGRTSEKDHNTKCTLTVTPLGKATYKGSIDLAYCNLLYRELKQGLEGLILESNLHLLYLATPYDMTSNCSPDWMIYLKQFNQLSGAEQKVADIVGVPESFIIKKASGQAIRK-NVDSAVVNRLYLTFVLYALLKETNVWSVSEKFNMSRGYVQNLLNSAASFASCVLHFCEELE-EFWVYKALLTELTKQLTYCVKTELIPLMEVAGVLEARAKQLYNAGYKTLAHLANANPEILVKVIERLSRRQAKQIISSAKMLLSEKAEALQEEVEELLKV 960          
BLAST of Helicase POLQ-like protein vs. Ensembl Cavefish
Match: helq (helicase, POLQ like [Source:ZFIN;Acc:ZDB-GENE-060503-421])

HSP 1 Score: 619.387 bits (1596), Expect = 0.000e+0
Identity = 320/768 (41.67%), Postives = 483/768 (62.89%), Query Frame = 1
Query:  247 KIQELLKFHRGIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHARIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDELFRQIDAECLG-VCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQNPGALGEILKSEVQYLIDHDLVRQVKSDSDNEICVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLKIDEYSLRRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKELLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASAESRALHEILNPISGKLVRQIISSAKMNIQEKLEALSEEYKELVVV 2547
            K+++L+   +GI  LYDWQ  CL +  + + +NL+YSLPTSGGKTLVAEIL+ K+L  +++  + ILPY+ALVQEKVR L+ FG++L+F+VEEYAG KG++PP K     S+Y+ TIEK HSL+NSLIE N++  IGL+VVDELHM+GDGS RGA LE+ L K + +    +I+GMSATL N+ ++  FL A  + +DFRP+EL E+VK+   I+ +  +      E+ F   R L    +  +QKMDPD++I LV+E++P +SC+IFC TK+ CEN+A  I K      L+  ++  ++  L  ++     G +CP L++ +  G+AYHHSGLT +ERK+VEEA+  G + ++ CTSTLAAG+NLPARRVI+R+PYVG D +K SQYKQM GRAGR G D  GE  +I+  +D+D    L+      C S++L +  + +    LS I L +  T +                 +L E+    ++ L    L+      +      L+ T +GRA  +GS+D+     +Y DL      L L ++LH++Y+VTP+D+V+   P W  Y  +  KL  +++++  ++GV E  +     G    K  +D   + RLY AL+LY L  +  ++ V++ ++ + GFVQ+LL ++ ++ +C+ +F EE   +FW+YK LL +LT RL +CV  ELIPLME+ GV + RA +LY AGY T+  +A+A+   L + +  +  K   QI++SAKM +QEK EAL EE+ +L+++
Sbjct:  195 KVKDLIMRLKGIQDLYDWQKVCLDLDSVKQRKNLIYSLPTSGGKTLVAEILIFKELLCRRKDALLILPYVALVQEKVRGLASFGIELDFMVEEYAGSKGRFPPVKRRSSNSLYITTIEKGHSLVNSLIEANRLDNIGLVVVDELHMLGDGS-RGAILEMTLAKVLYINKSTQIIGMSATLGNIGDLQSFLRAENYTNDFRPVELKEYVKLRDSIYEVKPK-----EEECFRFSRLLAFKYSSGMQKMDPDHIIALVTEVIPKQSCLIFCATKKNCENVAGMICKYLHTDFLM--HREGEKATLLAELRNSGNGSLCPVLQRTVPFGLAYHHSGLTSDERKLVEEAYSSGVLCLLACTSTLAAGINLPARRVILRSPYVGIDFLKRSQYKQMVGRAGRAGIDSVGESILILQDRDKDMVRKLVSAPMEKCYSNLLHDGSKGLLSLTLSLIGLNVSDTCQQ---------------KSLKELTVESIEILKQKGLIEASSGAAGGA--SLQVTRIGRATYKGSVDLSYCDVLYRDLSKGLEGLLLNSFLHLVYLVTPYDLVSQCKPDWMIYYTQFSKLSPAEQKMAATLGVPESFVARKAAGQSVRK-NVDNLVVNRLYLALVLYSLLRETDLWSVSDRFQMTRGFVQTLLSSSSAFCSCVLHFTEEL-EEFWAYKALLSELTRRLTYCVQAELIPLMEVSGVMELRAKQLYSAGYKTLAHLANADPNVLVKKVENLFKKQANQIVASAKMLLQEKAEALQEEFDDLLML 935          
BLAST of Helicase POLQ-like protein vs. Ensembl Cavefish
Match: polq (DNA polymerase theta [Source:NCBI gene;Acc:103039702])

HSP 1 Score: 323.168 bits (827), Expect = 4.470e-92
Identity = 241/782 (30.82%), Postives = 392/782 (50.13%), Query Frame = 1
Query:  277 GIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHAR-------------IVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEIL-PDKSCIIFCPTKRQCENLANNII----------KLTDPKLLIPDYKVKKRDELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELI-----KTFEDIVEFLQGSLFSIQNPGALGEILKSE------VQYLIDHDLVRQVKSDSDNEICVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLKIDEYSL---RRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKELLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASAESRALHEILNPISG-KLVRQIISSAKMNIQEK 2505
            G+ ++++WQ ECL +  + + +NLVYS PTS GKTLV+E+L+LK++   +R  IFILP++++ +EK+  L     +    VE Y G               V V TIEKA+ LIN LIE +++  +G++VVDELHM+GD S RG  LEL L K   +    +             IVGMSATL NL  + ++L A  + +D+RP+ L E+VK+   I+  +      T  ++F+P          +  K D D+++ L  E +    S ++FCP+K  CE LA++I           K ++  +      ++   ++  Q+     G+   L++ +  G+A+HH+GLT +ER ++E AF  G I V+  TSTL++GVNLPARRVIIR P     L+    YKQM GRAGRKG D  GE  ++  + +R K  +LI  +     S ++      +   +L AI LE+I      T E++  +   +L +        E  +S       + +L+D++ +   K       C    + LG A +  S+       I++DL+ A     L   LH+LY +TP   V   T  W  +     +L ++ K + + +G+ E  +     G   +K +     +   +R +  L+L DL  ++ +  VA  Y  S G +QSL  +A +Y+  +  F    R  + + + LL +  +RL+  V  EL  L+ I  +   RA  LY AG+ T+ +IA   +  + + L   +  K  RQ +  +  + QE+
Sbjct:  265 GVKQMFEWQAECLTLGKVLEGKNLVYSAPTSAGKTLVSELLILKRVLETRRKAIFILPFVSVAREKMFYLQNVFQEAGVRVEGYMGSTSA---AGGFSALDVAVCTIEKANGLINRLIEEDRMDLLGIVVVDELHMLGD-SGRGYLLELLLTKIQYIATKTKERCTDKAYTDGVQIVGMSATLPNLDLLARWLSAELYHTDYRPVPLMEWVKIGTQIYDGSM-----TLIRQFTP---------ALPVKGDDDHIVSLCFETVHAGHSALLFCPSKNWCEKLADSIAREFYNLYHKEKQSESGVQSVSLNLEGLQDVVAQLKRSPAGLDQVLQRTVPWGVAFHHAGLTFDERDILEGAFRQGFIRVLAATSTLSSGVNLPARRVIIRTPVFNGHLLDILTYKQMVGRAGRKGVDTIGESVLVCKEAERMKGVSLIQGSLKPISSCLVKREGEGVTTSMLRAI-LEIIVGGVASTPEEVRTYASCTLLAASMASEQPEAAQSRGAIEACMDWLMDNEFIHIQKEGETERYC---PSHLGSATLSSSLSPPEALGIFADLQRAMKGFVLENDLHILYQITPV-YVDWTTIDWYQFFCLWEQLPSAMKRVAEMVGIQESFLARSVGGKLIAKTEKQRRQMAIHKRFFTTLVLLDLVSEEPLGAVAKKYGCSRGQLQSLQQSASTYAGMVTVFCN--RLGWHNLELLLSQFQSRLSFGVQRELCDLVRISLLNAQRARALYSAGFVTVAEIARGNTADVEKALRKATPFKSSRQAVDESAEDAQER 1021          
BLAST of Helicase POLQ-like protein vs. Ensembl Cavefish
Match: helq (helicase, POLQ like [Source:ZFIN;Acc:ZDB-GENE-060503-421])

HSP 1 Score: 206.453 bits (524), Expect = 5.075e-58
Identity = 95/167 (56.89%), Postives = 129/167 (77.25%), Query Frame = 1
Query:  247 KIQELLKFHRGIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRV 747
            K+++L+   +GI  LYDWQ  CL +  + + +NL+YSLPTSGGKTLVAEIL+ K+L  +++  + ILPY+ALVQEKVR L+ FG++L+F+VEEYAG KG++PP K     S+Y+ TIEK HSL+NSLIE N++  IGL+VVDELHM+GDGS RGA LE+ L K + +
Sbjct:  250 KVKDLIMRLKGIQDLYDWQKVCLDLDSVKQRKNLIYSLPTSGGKTLVAEILIFKELLCRRKDALLILPYVALVQEKVRGLASFGIELDFMVEEYAGSKGRFPPVKRRSSNSLYITTIEKGHSLVNSLIEANRLDNIGLVVVDELHMLGDGS-RGAILEMTLAKVLYI 415          
BLAST of Helicase POLQ-like protein vs. Ensembl Cavefish
Match: hfm1 (helicase for meiosis 1 [Source:ZFIN;Acc:ZDB-GENE-061207-43])

HSP 1 Score: 118.627 bits (296), Expect = 1.293e-26
Identity = 136/566 (24.03%), Postives = 250/566 (44.17%), Query Frame = 1
Query:  337 TRNLVYSLPTSGGKTLVAEILMLKQL-----AIKQRSVIFILPYIALVQEKVR----ALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHA-----------RIVGMSATLDNLSEICQFLH-------AVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDELFRQ----IDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAP--YVGKDLIKFSQYK--QMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLF---SIQNPGALG---EILKSEVQYLIDHDLVRQVKSDSDNEICVL------KATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHML 1893
            ++N V   PT  GKT++ E+ +++ L            +++ P  AL  ++         P GL+   L      G  +       + A + + T EK  S+         +  + L ++DE+H++ D S RG  LE+ + +   +  +            R V +SAT+ N+ +I  +L         +  D   RP++L + V    F +  N        E KF    N      KM       +VI   S+    K  ++FC T++  +  A  + K  D + ++    +  R  L +     +DA+       LR +I  G+ YHH+G++  +RK+VE+AF  G + V+  TSTLA GVNLPA  V+I++   Y G    ++S+    QM GRAGR  FD      ++   + R+K+   I   S   +SS+   +  ++++ + + I L  I      +++++ +     +++NP   G   E+ K  ++  +    ++ + S +  ++  +      K TE G+ + R  +    +K+ +S L   E   NLA  + M+
Sbjct:  257 SKNFVACAPTGSGKTVLFELAIIRLLMETTEPWHNVKAVYMAPIKALCSQQYENWKLKFGPLGLNCKELT-----GDTEIEDVFEIQDAHLIMTTPEKWDSMTRKWKNNCLLQSVQLFLIDEVHVVKD-STRGPTLEVVVSRMKTIHSYTVAESPDASTRMRFVAVSATIPNICDIADWLSNDQGPATCLEMDESHRPVKLRKVVLGFPFGNSQN--------EFKFDLSLNY-----KMA------SVIQTYSD---QKPTLVFCSTRKGVQQSATVLAK--DARFIM---SIDHRQRLMKYASSILDAK-------LRDLIMCGVGYHHAGVSLSDRKVVEDAFTAGDLPVLFTTSTLAMGVNLPAHLVVIKSTMHYAGGSCEEYSEADMLQMIGRAGRPQFDTSATAVIMTRIQTREKYLQFI-SGSETIESSL---HTNLVEH-LNAEIVLHTISDVNMALDWIRSTFLYIRALKNPTHYGFSSELDKCGIETKLQELCLKNLNSLASYQLITMDEDINIKPTESGKLMARYCVAFDTMKQ-FSKLTGTE---NLAELIEMM 773          
BLAST of Helicase POLQ-like protein vs. Ensembl Cavefish
Match: mtrex (Mtr4 exosome RNA helicase [Source:NCBI gene;Acc:103046062])

HSP 1 Score: 113.62 bits (283), Expect = 4.089e-25
Identity = 133/497 (26.76%), Postives = 215/497 (43.26%), Query Frame = 1
Query:  328 IGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHARIVGMSATLDNLSEICQFL--------HAVAFDSDFRPIELSEFV--KVDKFIHRI---NSQLKCDTFEQKFSPERNLEPNPNKMVQKMD----------PDNVIGLVSEILPD--KSCIIFCPTKRQCENLANNIIKLT----DPKLLIPDYKVKKRDELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAP--YVGKDL--IKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEF-LQGSLFSIQN----PGALGEILKSEVQY 1704
            I   ++++ S  TS GKT+ AE  +   L  KQR VIF  P  AL  +K R +     D+  +      G     PT     AS  V T E   S++    E   + ++  ++ DE+H + D S RG   E  ++       +   V +SAT+ N  +  +++        H V   +D+RP  L  ++       +H +   N + + D F       R+          K D          P NV  +V  I+    +  IIF  +K++CE  A  + KL     D K L+ +      D L    D + L     +  +++ GI  HH GL    ++ +E  F +G +  +  T T A G+N+PAR V+  +   + GKD   I   +Y QM+GRAGR+G D++G    +VD+K     G  +L+ S+   +S       M+         L L++  E   E+ L+ S +  Q+    PG L ++ K E  Y
Sbjct:  126 IDNNQSVLVSAHTSAGKTVCAEYAIALALREKQR-VIFTSPIKALSNQKYREMYEEFQDVGLMT-----GDVTINPT-----ASCLVMTTEILRSMLYRGSEV--MREVAWVIFDEIHYMRD-SERGVVWEETIILLP---DNVHYVFLSATIPNARQFAEWICHLHKQPCHVVY--TDYRPTPLQHYIFPAGGDGLHLVVDENGEFREDNFNTAMQVLRDAGDQGGSSGGKWDAKGRRGGTKGPSNVFKIVKMIMERNFQPVIIFSFSKKECEAYALQVSKLDFNTDDEKKLVEEVFSNAIDCL--SDDDKKLPQVEHVLPLLKRGIGIHHGGLLPILKETIEILFSEGLLKALFATETFAMGINMPARTVLFTSARKFDGKDFRWISSGEYIQMSGRAGRRGMDERGIVIFMVDEKMSPAVGKQLLKGSADPLNSAFHLTYNMV---------LNLLRVEEINPEYMLEKSFYQFQHYRAVPGVLEKMKKLEEMY 592          
BLAST of Helicase POLQ-like protein vs. Ensembl Sea Lamprey
Match: helq (helicase, POLQ like [Source:ZFIN;Acc:ZDB-GENE-060503-421])

HSP 1 Score: 637.106 bits (1642), Expect = 0.000e+0
Identity = 324/759 (42.69%), Postives = 500/759 (65.88%), Query Frame = 1
Query:  238 MSIKIQELLKFHRGIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHARIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQNPGA----LGEILKSEVQYLIDHDLVRQVKSDSDNEIC----VLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLKIDEYSLRRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKELLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASAESRALHEILNPISGKLVRQIISSAKM 2490
            +  K+  LL+  RGI +LY WQ +CL +  + + +NL+YSLPTSGGKTLVAEILML++L  K+R  + ILPY+A+VQEKVR+LS FG++L   +EEYAG KG+ PP K  K  S+Y+ATIEKAHSL+NSL+E  ++ +IGL+VVDELHM+G+G  RGA LE  L K        +I+GMSATL N++++ +FL+A  + +DFRP+EL E++K+   I+ +N++  C   E++F   R L    +  + KMDPD+++ LV+E++P  SC++FCPTK+ CEN+A  I K      L   ++ +++  L  ++ A+   +CP LR+ +  G+AYHHSGLT EER+++EEA+  GT+ ++ CTSTLAAGVNLPARRVI+R+PY+G   +  SQYKQM GRAGR G D  GE   IV+ +D+ K   L+     VCQSS+  E+ + ++  +LS I L++    + I  FL+ +LF +Q        LGE+ +  +Q L+   LVR + S S+        +L+ T+LG+A  +GS+D+     +Y DLK+    L L  YLH++Y+ TP+DMV+   P WN Y ++  +L  +++++   IGV E  I     G    +  +DE  + R Y AL+LY L+ Q S++E A+ + Q+ GF+Q+L+ +A ++++C+ +F +E  ++FW+Y+ L   LT +L++CV  ELIPLME+ GV++ RA +LYKAG+ ++  +A+A+ + L + +  +  +  +QI+ SAK+
Sbjct:   70 LPTKVHSLLQQQRGIKELYAWQHDCLSLNSVRQGKNLIYSLPTSGGKTLVAEILMLRELLCKRRDALLILPYVAIVQEKVRSLSVFGVELEIFIEEYAGSKGRMPPRKKRKKNSLYIATIEKAHSLVNSLLEEGRMQEIGLIVVDELHMLGEGGSRGATLEQTLAKVQYTSKTTQIIGMSATLSNINDLQKFLNAELYTNDFRPVELREYIKLGDSIYGVNNKALCP--EEQFDFIRLLSYKYSSGMLKMDPDHIVALVTEVIPAHSCLVFCPTKKNCENVAEMICKYLAKTFL--QHREEEKRALLAELQADG-ELCPVLRRTVPYGLAYHHSGLTGEERRLIEEAYSAGTLCLLTCTSTLAAGVNLPARRVILRSPYIGNSFLSRSQYKQMVGRAGRAGIDSSGESITIVNSRDKAKAVTLVGGPFEVCQSSLTYEDGKGVQSLLLSLIGLKITTDIDAIYRFLETTLFGVQQQEGGMKELGELGRHCLQQLLQLGLVR-LCSRSEGAAAPSEQLLEITKLGQATYKGSVDLAFCTVLYRDLKTGVEGLVLNNYLHLIYLATPYDMVSQCRPDWNTYMRQFNQLDVTEQKVATFIGVPEGFIARKMAGQGTRQKTVDERVVNRFYLALVLYALFKQTSVWEAASKFGQNRGFIQNLVGSAAAFASCIMHFCQEL-DEFWAYQLLFADLTQKLSYCVKSELIPLMEVAGVKEARARQLYKAGFKSLAILANADPKDLVQQIEFLPHRQAKQIVFSAKL 821          
BLAST of Helicase POLQ-like protein vs. Ensembl Sea Lamprey
Match: helq (helicase, POLQ like [Source:ZFIN;Acc:ZDB-GENE-060503-421])

HSP 1 Score: 610.527 bits (1573), Expect = 0.000e+0
Identity = 314/760 (41.32%), Postives = 483/760 (63.55%), Query Frame = 1
Query:  238 MSIKIQELLKFHRGIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHARIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLEL-IKTFEDIVEFLQGSLFSI-QNPGALGEILKSEVQYLIDH-DLVRQVKSDSDNEICVLKATELGRAV----VRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLKIDEYSLRRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKELLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASAESRALHEILNPISGKLVRQIISSAKMNI 2496
            +  K+  LL+  RGI +LY WQ +CL +  + + +NL+YSLPTSGGKTLVAEILML++L  K+R  + ILPY+A+VQEKVR+LS FG++L   +EEYAG KG+ PP K  K  S+Y+ATIEKAHSL+NSL+E  ++ +IGL+VVDELHM+G+G  RGA LE  L K        +I+GMSATL N++++ +FL+A  + +DFRP+EL E++K+   I+ +N++  C   E++F   R L         KMDPD+++ LV+E++P  SC++FCPTK+ CEN+A  I K          ++ +++  L  ++ A+   +CP LR+ +  G+AYHHSGLT EER+++EEA+  GT+ ++ CTSTLAAGVNLPARRVI+R+PY+G   +  SQYKQM GRAGR G D  GE   IV+ +D+ K   L+     VCQSS+  E+ + ++  +LS I L++   T       +Q +LF + Q  G + E+ +     L  H               C  K     +A     ++GS+D+     +Y DLK+    L L  YLH++Y+ TP+DMV+   P WN Y ++  +L  +++++   IGV E  I     G    +  +DE  + R Y AL+LY L+ Q S++E A+ + Q+ GF+Q+L+ +A ++++C+ +F +E  ++FW+Y+ L   LT +L++CV  ELIPLME+ GV++ RA +LYKAG+ ++  +A+A+ + L + +  +  +  +QI+ SAK+ +
Sbjct:    4 LPTKVHSLLQQQRGIKELYAWQHDCLSLNSVRQGKNLIYSLPTSGGKTLVAEILMLRELLCKRRDALLILPYVAIVQEKVRSLSVFGVELEIFIEEYAGSKGRMPPRKKRKKNSLYIATIEKAHSLVNSLLEEGRMQEIGLIVVDELHMLGEGGSRGATLEQTLAKVQYTSKTTQIIGMSATLSNINDLQKFLNAELYTNDFRPVELREYIKLGDSIYGVNNKALCP--EEQFDFIRLLS-------YKMDPDHIVALVTEVIPAHSCLVFCPTKKNCENVAEMICKYLAKTRHTLHHREEEKRALLAELQADG-ELCPVLRRTVPYGLAYHHSGLTGEERRLIEEAYSAGTLCLLTCTSTLAAGVNLPARRVILRSPYIGNSFLSRSQYKQMVGRAGRAGIDSSGESITIVNSRDKAKAVTLVGGPFEVCQSSLTYEDGKGVQSLLLSLIGLKVRFDTLSRFGAVIQTTLFGVQQQEGGMKELGE-----LGRHCLQQLLQLGLLLASACHYKVNLTFKASLTFNLKGSVDLAFCTVLYRDLKTGVEGLVLNNYLHLIYLATPYDMVSQCRPDWNTYMRQFNQLDVTEQKVATFIGVPEGFIARKMAGQGTRQKTVDERVVNRFYLALVLYALFKQTSVWEAASKFGQNRGFIQNLVGSAAAFASCIMHFCQEL-DEFWAYQLLFADLTQKLSYCVKSELIPLMEVAGVKEARARQLYKAGFKSLAILANADPKDLVQQIEFLPHRQAKQIVFSAKVTM 747          
BLAST of Helicase POLQ-like protein vs. Ensembl Sea Lamprey
Match: ascc3 (activating signal cointegrator 1 complex subunit 3 [Source:NCBI gene;Acc:100332599])

HSP 1 Score: 125.946 bits (315), Expect = 1.309e-29
Identity = 121/471 (25.69%), Postives = 204/471 (43.31%), Query Frame = 1
Query:  343 NLVYSLPTSGGKTLVAEILMLKQL-AIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGK---------YPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHA----RIVGMSATLDNLSEICQFL---HAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKL----TDPKLLIPDYKVKKRDELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAP-YVGKDLIKFSQYK-----QMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFS---IQNP 1665
            N++   PT  GKT+ AE+ + +   A      ++I P  ALV+E++        D    +E  AG              P  +    A + V T EK   +  S    + + ++ LLV+DE+H++GD   RG  LE+ + +   +  H     R+VG+S  L N  ++  +L     + F+  FRP      V ++  IH    Q  C                  +M     P      +    P K  +IF  ++RQ    A ++I       +PK  +   + +  + +   +    L +C      +  GI  HH+GL + +R+ VEE F++  I V+  TSTLA GVN PA  VII+   Y      ++  +      QM GRAGR  FDD+G+  + V    +D +   + E   V +SS+L     ++   + + I+   I + +D ++++  + F    I NP
Sbjct:  712 NVLLGAPTGSGKTVAAELAIFRIFNAHPGAKAVYIAPLKALVRERME-------DWKVRLEPEAGCAAARVVELTGDVTPDARAIASADLIVTTPEKWDGVSRSWHSRSYVKQVALLVIDEIHLLGDD--RGPVLEVIVSRTNFISSHTEKPVRVVGLSTALANARDLADWLAIKQVILFN--FRPSVRP--VPLEAHIHGFPGQHYCP-----------------RMATMNKP--TFQAIRTHSPAKPVLIFVSSRRQTRLTALDLIAFLAGEDNPKQWLHTDETEM-EHIISTVKDSNLKLC------LAFGIGMHHAGLHERDRRTVEELFVNTRIQVLIATSTLAWGVNFPAHLVIIKGTEYFDGKTRRYVDFPITDVLQMMGRAGRPQFDDQGKAVIFVHDLKKDFYKKFLYEPFPV-ESSLLE----VLADHLNAEITSGTITSKQDAMDYITWTYFFRRLIMNP 1138          

HSP 2 Score: 81.6481 bits (200), Expect = 5.775e-16
Identity = 73/276 (26.45%), Postives = 118/276 (42.75%), Query Frame = 1
Query:  760 RIVGMSATLDNLSEICQFLHA------VAFDSDFRPIELSE-FVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVI--GLVSEILPDKSCIIFCPTKRQCENLANNIIKLT----DPKLLIPDYKVKKRDELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAP--YVGK-----DLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSV 1527
            RIVG+SATL N  ++ +FLH         FDS FRP+ LS+ F+ V                              NKM Q  D D V    ++ ++      ++F   +      A  + ++     +     P  +  +    F+Q++         +R++   G + HH+G+ + +R +VE  F  G + V+ CT+TLA GVNLPA  VII+    Y  K     DL       Q+ GRAGR  +D  G   +I       ++  L+ + + +
Sbjct:    9 RIVGLSATLPNYLDVARFLHVNPYIGLFFFDSRFRPVPLSQTFIGVK---------------------------TTNKMQQMHDMDEVCYDKVLEQVKAGHQVMVFVHARNATVRTAMALREMAKNNGEAGFFTPP-QSAEYGTAFKQVERSR---NKPMRELFPDGFSTHHAGMLRPDRSLVEGLFSRGLVRVLVCTATLAWGVNLPAHAVIIKGTQIYDAKRGTFVDLGALD-VMQIFGRAGRPQYDTFGLGIIITSHDKLGRYLTLLTQQNPI 252          
BLAST of Helicase POLQ-like protein vs. Ensembl Sea Lamprey
Match: ascc3 (activating signal cointegrator 1 complex subunit 3 [Source:NCBI gene;Acc:100332599])

HSP 1 Score: 124.79 bits (312), Expect = 3.061e-29
Identity = 121/473 (25.58%), Postives = 205/473 (43.34%), Query Frame = 1
Query:  343 NLVYSLPTSGGKTLVAEILMLKQL-AIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGK-----------YPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHA----RIVGMSATLDNLSEICQFL---HAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKL----TDPKLLIPDYKVKKRDELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAP-YVGKDLIKFSQYK-----QMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFS---IQNP 1665
            N++   PT  GKT+ AE+ + +   A      ++I P  ALV+E++        D    +E  AG +              P  +    A + V T EK   +  S    + + ++ LLV+DE+H++GD   RG  LE+ + +   +  H     R+VG+S  L N  ++  +L     + F+  FRP      V ++  IH    Q  C                  +M     P      +    P K  +IF  ++RQ    A ++I       +PK  +   + +  + +   +    L +C      +  GI  HH+GL + +R+ VEE F++  I V+  TSTLA GVN PA  VII+   Y      ++  +      QM GRAGR  FDD+G+  + V    +D +   + E   V +SS+L     ++   + + I+   I + +D ++++  + F    I NP
Sbjct:  711 NVLLGAPTGSGKTVAAELAIFRIFNAHPGAKAVYIAPLKALVRERME-------DWKVRLEPEAGKECAAARVVELTGDVTPDARAIASADLIVTTPEKWDGVSRSWHSRSYVKQVALLVIDEIHLLGDD--RGPVLEVIVSRTNFISSHTEKPVRVVGLSTALANARDLADWLAIKQVILFN--FRPSVRP--VPLEAHIHGFPGQHYCP-----------------RMATMNKP--TFQAIRTHSPAKPVLIFVSSRRQTRLTALDLIAFLAGEDNPKQWLHTDETEM-EHIISTVKDSNLKLC------LAFGIGMHHAGLHERDRRTVEELFVNTRIQVLIATSTLAWGVNFPAHLVIIKGTEYFDGKTRRYVDFPITDVLQMMGRAGRPQFDDQGKAVIFVHDLKKDFYKKFLYEPFPV-ESSLLE----VLADHLNAEITSGTITSKQDAMDYITWTYFFRRLIMNP 1139          

HSP 2 Score: 81.6481 bits (200), Expect = 5.876e-16
Identity = 73/276 (26.45%), Postives = 118/276 (42.75%), Query Frame = 1
Query:  760 RIVGMSATLDNLSEICQFLHA------VAFDSDFRPIELSE-FVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVI--GLVSEILPDKSCIIFCPTKRQCENLANNIIKLT----DPKLLIPDYKVKKRDELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAP--YVGK-----DLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSV 1527
            RIVG+SATL N  ++ +FLH         FDS FRP+ LS+ F+ V                              NKM Q  D D V    ++ ++      ++F   +      A  + ++     +     P  +  +    F+Q++         +R++   G + HH+G+ + +R +VE  F  G + V+ CT+TLA GVNLPA  VII+    Y  K     DL       Q+ GRAGR  +D  G   +I       ++  L+ + + +
Sbjct:   10 RIVGLSATLPNYLDVARFLHVNPYIGLFFFDSRFRPVPLSQTFIGVK---------------------------TTNKMQQMHDMDEVCYDKVLEQVKAGHQVMVFVHARNATVRTAMALREMAKNNGEAGFFTPP-QSAEYGTAFKQVERSR---NKPMRELFPDGFSTHHAGMLRPDRSLVEGLFSRGLVRVLVCTATLAWGVNLPAHAVIIKGTQIYDAKRGTFVDLGALD-VMQIFGRAGRPQYDTFGLGIIITSHDKLGRYLTLLTQQNPI 253          
BLAST of Helicase POLQ-like protein vs. Ensembl Sea Lamprey
Match: mtrex (Mtr4 exosome RNA helicase [Source:ZFIN;Acc:ZDB-GENE-040426-2854])

HSP 1 Score: 116.316 bits (290), Expect = 1.156e-26
Identity = 131/490 (26.73%), Postives = 219/490 (44.69%), Query Frame = 1
Query:  328 IGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELH-MIGDGSRRGANLELCLLKFMRVFGHARIVGMSATLDNLSEICQFL--------HAVAFDSDFRPIELSEFV----------KVDKFIHRINSQLKCDTFEQKFSPER-NLEPNPNKMVQKMDPDNVIGLVSEILPD--KSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDELFRQI---DAECLG----VCPTLRQ---IIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAP--YVGKD--LIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEF-LQGSLFSIQNPGALGEIL 1686
            I  +++++ +  TS GKT+ AE  + + L  KQR VIF  P  AL  +K R L     D+  L      G     P+     AS  V T E   S++    E   + ++  ++ DE+H M   G  RG   E  ++       +   V +SAT+ N ++  +++        H V+  +D+RP  L  F+           VD+F+       K D F Q  S  R   +P+  +        NV  ++  I+    +  IIF  +KR+CE  A  + +L        D+  ++   L  ++      CL       P +++   I++ GI  HH GL    ++ +E  F +G I  +  T T A G+N+PAR V+  +   + G+D   I   +Y QM+GRAGR+G D++G   ++VD+K     G+ +L+ S    +S       M+         L L++  E   E+ L+ S F  Q   A+ ++L
Sbjct:  141 IDNSQSVLVAAHTSAGKTVCAEYAIAQALRGKQR-VIFTSPIKALSNQKYRELHEEFHDVGLLT-----GDITINPS-----ASCLVMTTEILRSMLYRGSEI--MREVAWVIFDEIHYMRNPGKERGVVWEETIILLP---DNVHYVFLSATIPNGTQFAEWICHLHKQPCHVVS--TDYRPTPLQHFIFPAGGDGLLLVVDEFL-----DFKEDNFLQAMSLLREGGDPSRKRKGGNKGESNVFKIIKLIMERNLQPVIIFSFSKRECETYAVQLSQL--------DFNTEEEKCLVEEVFNNAMSCLSDEDQKLPQVQRVLPILKRGIGIHHGGLLPVLKETIEILFSEGLIKALFATETFAMGINMPARTVLFTSARKFDGRDHRWISSGEYIQMSGRAGRRGMDERGTVILMVDEKMSPTVGHQLLQGSPDPLNSAFHLTYNMV---------LNLLRVEEINPEYMLEKSFFQFQQYKAVPDLL 590          
BLAST of Helicase POLQ-like protein vs. Ensembl Yeast
Match: HFM1 (Meiosis specific DNA helicase; involved in the conversion of double-stranded breaks to later recombination intermediates and in crossover control; catalyzes the unwinding of Holliday junctions; has ssDNA and dsDNA stimulated ATPase activity [Source:SGD;Acc:S000003220])

HSP 1 Score: 149.828 bits (377), Expect = 3.126e-37
Identity = 144/578 (24.91%), Postives = 273/578 (47.23%), Query Frame = 1
Query:  274 RGIDKLYDW-QIECLKIPGIGKTR-NLVYSLPTSGGKTLVAEILMLKQLA-----IKQRSVIFILPYIALVQEKVRALSP--FGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISK-IGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHARIVGMSATLDNLSEICQFLHA--------VAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRA--PYVGKDLIKFSQYK--QMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSI---QNPGALGEI-------------LKSEVQYLIDHDLVRQVKSDSDNEICVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHML 1893
            RG+ K  ++ +++    P I ++  N + S PT  GKT++ E+ +L+ +           +I+I P  +L  E  +   P    L +  L  + +     +  T+  K  ++ + T EK   L     + +++ + + L++VDE+H I +  +RGA+LE+ L +   +  + R V +SAT+ N+ ++  +L          ++FD  +R ++L++FV    F         C    QK                 +    +I ++ +   ++  +IFCPT+            ++  K L+ ++   K  +      ++ +     L + ++ GIA+HH+G++ E+R  VE+ FL G+I+++C TSTLA GVNLPA  VII+    +   ++ ++S     QM GRAGR  F+  G   ++ D K +  + NLI   + V +SS+   +  +I++   +  SLE + + E  V +L+ + F +   +NP A  E+             +    QYL+D  +  ++   S+ E    K+T  G A+ R  I    +K+      +A+  L+L   L++L
Sbjct:  131 RGVFKFTEFNKMQSEAFPSIYESNENCIISSPTGSGKTVLFELAILRLIKETNSDTNNTKIIYIAPTKSLCYEMYKNWFPSFVNLSVGMLTSDTS-----FLETEKAKKCNIIITTPEKWDLLTRRWSDYSRLFELVKLVLVDEIHTIKE--KRGASLEVILTRMNTMCQNIRFVALSATVPNIEDLALWLKTNNELPANILSFDESYRQVQLTKFVYGYSF--------NCKNDFQK---------------DAIYNSKLIEIIEKHADNRPVLIFCPTRAST---------ISTAKFLLNNHIFSKSKKRCNHNPSDKI-----LNECMQQGIAFHHAGISLEDRTAVEKEFLAGSINILCSTSTLAVGVNLPAYLVIIKGTKSWNSSEIQEYSDLDVLQMIGRAGRPQFETHGCAVIMTDSKMKQTYENLI-HGTDVLESSL---HLNLIEHLA-AETSLETVYSIETAVNWLRNTFFYVRFGKNPAAYQEVNRYVSFHSVEDSQINQFCQYLLDTLVKVKIIDISNGE---YKSTAYGNAMTRHYISFESMKQFI----NAKKFLSLQGILNLL 652          
BLAST of Helicase POLQ-like protein vs. Ensembl Yeast
Match: BRR2 (RNA-dependent ATPase RNA helicase (DEIH box); required for disruption of U4/U6 base-pairing in native snRNPs to activate the spliceosome for catalysis; homologous to human U5-200kD [Source:SGD;Acc:S000000974])

HSP 1 Score: 134.806 bits (338), Expect = 2.519e-32
Identity = 121/410 (29.51%), Postives = 188/410 (45.85%), Query Frame = 1
Query:  343 NLVYSLPTSGGKTLVAEILMLKQLA-----------IKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLK--FMRVFG--HARIVGMSATLDNLSEICQFLHA-----VAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNII-KLTDPKLLIPDYKVKKRDELFRQI-DAECLGVC-PTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIR-----APYVGK-DLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKD 1485
            N++   PT  GKT +A + +LK L+           +    +++I P  ALVQE+VR        L   V E  G        K      V V+T EK      +      +  + LL++DE+H++ D   RG  LE  + +  +   +G  + RI+G+SATL N  ++ +FL         FDS FRP  LS                      Q+F   +  E N  K ++ M+      ++  I      I+F  ++++    A  +  K  +  +    +K+ K D   +QI   E   V  P+LR++I  GI  HH+GLT+ +R + E+ F DG + V+ CT+TLA GVNLPA  VII+     +P  G  + +      QM GRAGR  +D  GE  +I D+ +
Sbjct:  516 NMLICAPTGSGKTNIALLTVLKALSHHYNPKTKKLNLSAFKIVYIAPLKALVQEQVREFQRRLAFLGIKVAELTGDSRL--SRKQIDETQVLVSTPEKWDITTRNSNNLAIVELVRLLIIDEIHLLHDD--RGPVLESIVARTFWASKYGQEYPRIIGLSATLPNYEDVGRFLRVPKEGLFYFDSSFRPCPLS----------------------QQFCGIK--ERNSLKKLKAMNDACYEKVLESINEGNQIIVFVHSRKETSRTATWLKNKFAEENIT---HKLTKNDAGSKQILKTEAANVLDPSLRKLIESGIGTHHAGLTRSDRSLSEDLFADGLLQVLVCTATLAWGVNLPAHTVIIKGTDVYSPEKGSWEQLSPQDVLQMLGRAGRPRYDTFGEGIIITDQSN 894          
BLAST of Helicase POLQ-like protein vs. Ensembl Yeast
Match: SLH1 (Putative RNA helicase related to Ski2p; involved in translation inhibition of non-poly(A) mRNAs; required for repressing propagation of dsRNA viruses [Source:SGD;Acc:S000003503])

HSP 1 Score: 114.39 bits (285), Expect = 3.897e-26
Identity = 109/421 (25.89%), Postives = 183/421 (43.47%), Query Frame = 1
Query:  361 PTSGGKTLVAEILMLKQL-AIKQRSVIFILPYIALVQEKV----RALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHA----RIVGMSATLDNLSEICQFL----HAV-AFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKL----TDPKLLIPDYKVKKRDEL---FRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIR------APYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSI 1542
            PT  GKT+VAE+ +         + +++I P  ALV+E+V    + ++P   D    V E  G     P  K    A++ + T EK   +  +      +  + L+++DE+H++   S RG  LE+ + +   +        R++GMS  + N  ++  +L    H +  F S  RP+ L  +  +D F   +            F P       P           V   + +  PDK  +IF  ++RQ    A ++I L     +P+  +    +   +EL     Q+  +      TL+  ++ GI  HH+GL Q++R +  + F    I ++  TSTLA GVNLPA  VII+      A   G   +  +   QM GRAGR  +D  G   ++  K+ +  F    L      +SS+
Sbjct: 1163 PTGSGKTIVAELAIWHAFKTFPGKKIVYIAPMKALVRERVDDWRKKITPVTGDK---VVELTGDS--LPDPKDVHDATIVITTPEKFDGISRNWQTRKFVQDVSLIIMDEIHLL--ASDRGPILEMIVSRMNYISSQTKQPVRLLGMSTAVSNAYDMAGWLGVKDHGLYNFPSSVRPVPLKMY--IDGFPDNL-----------AFCPLMKTMNKP-----------VFMAIKQHSPDKPALIFVASRRQTRLTALDLIHLCGMEDNPRRFL---NIDDEEELQYYLSQVTDD------TLKLSLQFGIGLHHAGLVQKDRSISHQLFQKNKIQILIATSTLAWGVNLPAHLVIIKGTQFFDAKIEGYRDMDLTDILQMMGRAGRPAYDTTGTA-IVYTKESKKMFYKHFLNVGFPVESSL 1542          

HSP 2 Score: 112.464 bits (280), Expect = 1.546e-25
Identity = 109/399 (27.32%), Postives = 176/399 (44.11%), Query Frame = 1
Query:  301 QIECLKIPGIGKT-RNLVYSLPTSGGKTLVAEILMLKQLAIKQRSV----------------IFILPYIALVQEKV----RALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQ-ISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHA----RIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSP---ERNLEPNPNKMVQKMDPDNVIGLVSEILPDK-----SCIIFCPTKRQCENLANNIIKLTDPK----LLIPD--YKVKKRDELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYV 1377
            QI+ L  P   KT  N++   PT  GKT +A + ++    IKQ SV                I++ P  AL  E V    + L+PF + +  L  +    K +   T+      V V T EK   +       N  +SK+ LL++DE+H++ +   RG+ +E  + + +R    +    RI+G+SATL N  ++  FL                          +N Q+    F+Q F P   E+ L     K   +   +N+  +  + L +        ++F  ++++    A N IKL +      L  PD   K K    L +  D +       +++I + G   HH+G+ + +R + E+ F DG I V+CCT+TLA GVNLPA  VII+   V
Sbjct:  290 QIQSLVYPVAYKTNENMLICAPTGAGKTDIALLTIIN--TIKQFSVVNGENEIDIQYDDFKVIYVAPLKALAAEIVDKFSKKLAPFNIQVRELTGDMQLTKAEILATQ------VIVTTPEKWDVVTRKANGDNDLVSKVKLLIIDEVHLLHED--RGSVIETLVARTLRQVESSQSMIRIIGLSATLPNFMDVADFLG-------------------------VNRQIGMFYFDQSFRPKPLEQQLLGCRGKAGSRQSKENIDKVAYDKLSEMIQRGYQVMVFVHSRKETVKSARNFIKLAESNHEVDLFAPDPIEKDKYSRSLVKNRDKD-------MKEIFQFGFGIHHAGMARSDRNLTEKMFKDGAIKVLCCTATLAWGVNLPADCVIIKGTQV 646          
BLAST of Helicase POLQ-like protein vs. Ensembl Yeast
Match: MTR4 (ATP-dependent 3'-5' RNA helicase of the DExD/H family; involved in nuclear RNA processing and degradation both as a component of TRAMP complex and in TRAMP-independent processes; TRAMP unwinds RNA duplexes, with Mtr4p unwinding activity stimulated by Pap2p/Air2p but not dependent on ongoing polyadenylation; contains an arch domain, with two coiled-coil arms/stalks and a globular fist/KOW domain, which has RNA binding activity and is required for 5.8S rRNA processing [Source:SGD;Acc:S000003586])

HSP 1 Score: 103.605 bits (257), Expect = 6.720e-23
Identity = 120/457 (26.26%), Postives = 193/457 (42.23%), Query Frame = 1
Query:  247 KIQELLKFHRGIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRAL-SPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHARIVGMSATLDNLSEICQFL--------HAVAFDSDFRPIELSEF------------VKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIG--------LVSEILPDK--SCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDELFRQIDAECLGVCPT----LRQI------IRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRA--PYVGKDL--IKFSQYKQMAGRAGRKGFDDKGECFVIVDKK 1482
            ++ E   +   +D   D  I C     I +  +++ S  TS GKT+VAE  + + L  KQR VI+  P  AL  +K R L + FG D+  +      G     P      A   V T E   S++    E   + ++  ++ DE+H + D  R     E  +L   +V    R V +SAT+ N  E  +++        H V   ++FRP  L  +            V         N Q    +   +   + N   +  K  Q     +  G        +V  I   K    I+F  +KR CE LA  + KL        D+      E   +I    + + P     L QI      +R GI  HHSGL    ++++E  F +G + V+  T T + G+N+PA+ V+  +   + G+    +   +Y QM+GRAGR+G DD+G   +++D+K
Sbjct:  139 RVNEARTYPFTLDPFQDTAISC-----IDRGESVLVSAHTSAGKTVVAEYAIAQSLKNKQR-VIYTSPIKALSNQKYRELLAEFG-DVGLMT-----GDITINPD-----AGCLVMTTEILRSMLYRGSEV--MREVAWVIFDEVHYMRDKERGVVWEETIILLPDKV----RYVFLSATIPNAMEFAEWICKIHSQPCHIVY--TNFRPTPLQHYLFPAHGDGIYLVVDEKSTFREENFQKAMASISNQIGDDPNSTDSRGKKGQTYKGGSAKGDAKGDIYKIVKMIWKKKYNPVIVFSFSKRDCEELALKMSKL--------DFNSDDEKEALTKIFNNAIALLPETDRELPQIKHILPLLRRGIGIHHSGLLPILKEVIEILFQEGFLKVLFATETFSIGLNMPAKTVVFTSVRKWDGQQFRWVSGGEYIQMSGRAGRRGLDDRGIVIMMIDEK 562          
BLAST of Helicase POLQ-like protein vs. Ensembl Yeast
Match: SKI2 (Ski complex component and putative RNA helicase; mediates 3'-5' RNA degradation by the cytoplasmic exosome; null mutants have superkiller phenotype of increased viral dsRNAs and are synthetic lethal with mutations in 5'-3' mRNA decay; mutations in the human ortholog, SKIV2L, causes Syndromic diarrhea/Trichohepatoenteric (SD/THE) syndrome [Source:SGD;Acc:S000004390])

HSP 1 Score: 69.707 bits (169), Expect = 1.855e-12
Identity = 54/167 (32.34%), Postives = 80/167 (47.90%), Query Frame = 1
Query: 1018 EILPDKSCIIFCPTKRQCE---------NLANNIIKLTDPKLLIPD--YKVKKRDELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRA--PYVGKDLIKFS--QYKQMAGRAGRKGFDDKGECFVIV 1473
            E+LP    ++F  +K++CE         N  NN  K +   + I     ++KK D    QI           R ++  GIA HH GL    ++++E  F  G I V+  T T A G+NLP R VI  +   + G  L + +  ++ QMAGRAGR+G D  G   V+ 
Sbjct:  625 ELLP---MVVFVFSKKRCEEYADWLEGINFCNNKEK-SQIHMFIEKSITRLKKEDRDLPQI--------LKTRSLLERGIAVHHGGLLPIVKELIEILFSKGFIKVLFATETFAMGLNLPTRTVIFSSIRKHDGNGLRELTPGEFTQMAGRAGRRGLDSTGTVIVMA 779          
BLAST of Helicase POLQ-like protein vs. Ensembl Nematostella
Match: EDO44748 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUT3])

HSP 1 Score: 626.706 bits (1615), Expect = 0.000e+0
Identity = 318/774 (41.09%), Postives = 495/774 (63.95%), Query Frame = 1
Query:  238 MSIKIQELLKFHRGIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHARIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQNPGALGEILKSE------VQYLIDHDLVRQVKSDSDNEICVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLKIDEYSLRRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKELLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASAESRALHEILNPISGKLVRQIISSAKMNIQEKLEALSEEYKELV 2541
            + IK+++L   +RGI  LY+WQ  CLK+P I + RNL+YSLPTSGGKTLVAEILM+K+L +  + V+ +LP++++VQEKV+ ++ F ++L F+VEEYAG KGK+PP K     ++Y+ATIEKA+SL+NSLIE  ++  +GL+VVDELHM+G+G  RGA LE+CL K +    H +IVGMSATL N+ ++ +FL A  + +DFRP+EL E+VKVD  ++++         ++ +   R +  +P++   K DPD+++ LV E++P  SC+IFC TK+ CEN+A  +++    ++     K+ +R EL + +  +  G+CP L++ +  GIAYHHSGLT +ERK++E+A+  G +  + CTSTLAAGVNLPA+RVI+RAPY+G+++I+ SQYKQM GRAGR G D  GE  +I+   D+ K   L       CQSS+  +  + ++   L+ + L++ +T  ++V FL  +L +IQ    LG+   ++      ++ L+    V+ V    D++I +   T LGRA  +GS+D+     +YS++K A  ++ L   LH+LY+ TP D   +I P W  Y + +  L   +++    IGV +  +     G   +K  + E  + R Y +L+LY L    S++ V++ ++ S GFVQ+LL +A SY++CL  F E    +FW+ K LL  +  +L++    ELIPLME+ GV++ RA +LYKAGY  +  +A AE   L + +  +  K  +QI+S+AKM + EK +AL EE ++LV
Sbjct:    4 LPIKVKDLFLAYRGIQNLYEWQDACLKLPAIQEKRNLIYSLPTSGGKTLVAEILMMKELLVHHKDVVLVLPFVSIVQEKVKTITQFAVELGFVVEEYAGSKGKFPPRKRRTKRALYIATIEKANSLVNSLIEEKRMDDLGLIVVDELHMLGEGGGRGATLEMCLAKTLFSTNHIQIVGMSATLSNIGDLQKFLMAEVYSNDFRPVELQEYVKVDNIVYKVPCSSSKSEADEIYVQVRRIGHSPDQRHIK-DPDHLVPLVLEVIPQHSCLIFCATKKNCENVAKLMVEFLPREM--TQVKIGERMELLQALHHQANGLCPVLKKSVPYGIAYHHSGLTMDERKLIEDAYSQGVLCALTCTSTLAAGVNLPAKRVILRAPYIGRNIIRKSQYKQMIGRAGRAGIDSTGESILIIKTTDKHKVAPLFSGEFDSCQSSLPYQEYKGLRTLFLTLLGLKICQTKSELVSFLSRTLMAIQ----LGDSFDADQHATEALRTLVSLGHVKAVDDCEDHKIEI---TPLGRATYKGSLDIDDTPSVYSEIKRAMGAMVLTNELHLLYLTTPLDQGGTIQPDWMAYQREVATLGPEEQKAAGHIGVTDLYLLGRAYGRKLTKCPVGEEVVHRFYLSLMLYKLMQGSSMWHVSSVFQVSRGFVQNLLTSAASYASCLVRFTEA--KEFWTIKLLLEAMVRKLSYTTHLELIPLMEVAGVKQARARQLYKAGYRNLSDLAWAEPAVLVQQIEHLPKKHAQQIVSAAKMLLNEKADALREEAEDLV 765          
BLAST of Helicase POLQ-like protein vs. Ensembl Nematostella
Match: EDO46714 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPC5])

HSP 1 Score: 123.635 bits (309), Expect = 1.920e-28
Identity = 118/429 (27.51%), Postives = 194/429 (45.22%), Query Frame = 1
Query:  343 NLVYSLPTSGGKTLVAEILMLKQL-AIKQRSVIFILPYIALVQE-----KVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHA----RIVGMSATLDNLSEICQFLHAVA-----FDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPD-NVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKL----TDPK--LLIPDYKVKKRDELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAP--YVGKDL----IKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSIL 1545
            N++   PT  GKT++AE+ + +          ++I P  ALV+E     KVR    FG  L   V E  G     P ++    A + V T EK   +  S    + + ++ LL++DE+H++GD   RG  LE+ + +   +  H     R+VG+S  L N  ++  +L   +     F    RP+ L   V +  F                  P ++  P   +M     P    I + S   P K  ++F  ++RQ    A ++I       DPK  L +P+ ++++     R  +         L+ ++  GI  HH+GL + +R +VEE F++  I V+  TSTLA GVN PA  V+I+    + GK         +   QM GRAGR  +DD+G+  ++V    +  +   + E   V +SS+L
Sbjct: 1349 NVLLGAPTGSGKTIIAELAIFRLFDKYPGAKAVYIAPLKALVRERMDDWKVR----FGRKLGKRVIELTGDV--TPDSRSISQADLIVTTPEKWDGISRSWQTRSYVKQVNLLIIDEIHLLGD--ERGPVLEVIVSRTNFISSHTDKKVRVVGLSTALANARDLADWLGIGSAGMFNFRPSVRPVPLE--VHITGF------------------PGKHYCP---RMATMNKPTFEAIRIHS---PTKPTLVFVSSRRQTRLTALDLIAFLAAQDDPKQWLHMPEEEMEQVLHAVRDSN---------LKLVLSFGIGLHHAGLHERDRSVVEELFVNQKIQVLIATSTLAWGVNFPAHLVVIKGTEYFDGKKCRYVDFPITDVLQMMGRAGRPQYDDQGKAVILVHDVKKHFYKKFLYEPFPV-ESSLL 1733          

HSP 2 Score: 106.301 bits (264), Expect = 3.525e-23
Identity = 129/500 (25.80%), Postives = 204/500 (40.80%), Query Frame = 1
Query:  343 NLVYSLPTSGGKTLVAEILMLKQLAIKQR-----------SVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKC----ASVYVATIEKAHSLINSLIETNQISK-IGLLVVDELHMIGDGSRRGANLELCLLKFMRVF----GHARIVGMSATLDNLSEICQFLHA------VAFDSDFRPIELSE-FVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLT----DPKLL----IPDYKVKKRDELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFS-------QYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQNPGALGEILKSEVQYLIDH 1716
            NL+   PT  GKT +A + ++++  IKQ             ++++ P  AL  E VR  S     L   V E  G        + TK       + V T EK   +         +++ + LL++DE+H++ D   RG+ +E  + + +R         RIVG+SATL N  ++  FL         AFDS FRP+ L + F+ V                            NP +   +MD      +   +      ++F   +      A  + ++     D  L      PDY    + ++ R  + +       LR +   G   HH+G+ + +R MVE+ F  G I V+ CT+TLA GVNLPA  VII+   V  D  K S          Q+ GRAGR  FD  GE  +I        + +L+       Q+ I S     +   + + I L  +    + VE+L  S   I+       ++K+ + Y I H
Sbjct:  499 NLLICAPTGAGKTNIAMMTIVRE--IKQNIEQGVIKKDKFKIVYVAPMKALAAEMVRNFSKRLAGLGISVRELTGD------MQLTKMEILKTQMLVTTPEKWDVVTRKSTGDVALAQLVKLLIIDEVHLLHDD--RGSVIECLVARTLRQVLSSQSMIRIVGLSATLPNYLDVAHFLRVDPYKGLFAFDSRFRPVPLGQTFIGVKGL-------------------------NPFQQAHEMDKICYEKVTENVEKGYQVMVFVHARNATVRTAMTLREMASNQGDSMLFRAEQAPDYGSALK-QVMRSRNKQ-------LRDLFPDGFGTHHAGMLRTDRTMVEQYFAKGLIKVLVCTATLAWGVNLPAHAVIIKGTEV-YDAKKGSFVDLGILDVLQIFGRAGRPQFDKFGEGTIITAHDRLSHYLSLLTR-----QAPIESTLTASLTDSLNAEICLGTVTNVNEAVEWLSYSYLYIR-------MIKNPLVYGIPH 942          
BLAST of Helicase POLQ-like protein vs. Ensembl Nematostella
Match: EDO32438 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV19])

HSP 1 Score: 110.923 bits (276), Expect = 2.532e-28
Identity = 60/149 (40.27%), Postives = 90/149 (60.40%), Query Frame = 1
Query:  289 LYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLK 735
            ++ WQ +CL    + +  NLVYS PTS GKT+VAE+LMLK++   +R  + ILP++++ +EK+  L     +    VE   G  G + P        + + TIEK +SL+N L+E  ++S +G +V+DELHM+GD   RG  LEL L K
Sbjct:    1 MFQWQADCLCTGNVLQGGNLVYSAPTSAGKTMVAELLMLKRVLETKRKALLILPFVSVAREKMFYLQRLFQEAGVRVE---GFMGSHSPAGGFAATDIAICTIEKGNSLLNRLMEEGKVSTLGTVVIDELHMVGD-PNRGYLLELFLTK 145          
BLAST of Helicase POLQ-like protein vs. Ensembl Nematostella
Match: EDO49146 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH22])

HSP 1 Score: 112.849 bits (281), Expect = 4.083e-25
Identity = 127/515 (24.66%), Postives = 223/515 (43.30%), Query Frame = 1
Query:  325 GIGKTRNLVYSLPTSGGKTLVAEILMLKQLA----------IKQRSVIFILPYIALVQEKV----RALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHA----RIVGMSATLDNLSEICQFLHA------VAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDN--VIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDEL--FRQIDAECLGVCPT---------LRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIR-----APYVGKDLIKFSQYK--QMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSI--LSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQNPGALGEILKSEVQYLIDHDLVRQ 1731
             +    NL+   PT  GKT VA + +L+++            ++  +I++ P  +LVQE V    + LS +GL ++ L  ++   K +   T+      + V T EK   +     E      + L+++DE+H++ D   RG  LE  + + +R         R+VG+SATL N  ++  F+          FD+ FRP+ L                      EQ+F     +     K +++M   N  V   V E       ++F  ++++    A  +  +             +RD L  F + D+    V  +         L+ ++  G A HH+G+++ +R +VE+ F D  I V+  T+TLA GVNLPA  VII+     +P  G+  ++       QM GRAGR  +D KGE  +I    +   + +L+ +   V    I  L++N         + + L  ++T +D V +L  +   I+       +L++   Y I HD + +
Sbjct:  492 ALNSDENLLLCAPTGAGKTNVALLTILREIGKHINLDGTINTEEFKIIYVAPMRSLVQEMVLNFSKRLSTYGLTVSELTGDHNLTKEQIHGTQ------IIVCTPEKWDIITRKSGERTFTQLVRLIIIDEIHLLHDD--RGPVLESLVARTIRQIETTQELVRLVGLSATLPNYEDVATFMRVNPAKGLFFFDNSFRPVPL----------------------EQQF-----IGITEKKPIKRMQATNEVVYEKVVEHAGKNQVLVFVHSRKETAKTAKAVRDM-----------CLERDSLGLFLREDSASTEVLRSEAEQVKNGELKDLLPYGFAIHHAGMSRVDRTLVEDLFADRHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGR-WVELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLMNQQLPVESQFISKLADNLN-------AEVVLGSVQTAKDAVHWLGYTYLYIR-------MLRNPALYGISHDEIEK 945          

HSP 2 Score: 91.6633 bits (226), Expect = 1.198e-18
Identity = 101/416 (24.28%), Postives = 174/416 (41.83%), Query Frame = 1
Query:  337 TRNLVYSLPTSGGKTLVAEILMLKQLAIK-QRSVIFILPYIALVQEKVRA--LSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGH----ARIVGMSATLDNLSEICQFLHAVA-----FDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLT----DPKLLIPDYKVKKRDELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAP--YVGKDLIKFSQYK-----QMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILE 1515
            + N+    PT  GKT+ AE  +L+ L    +   +++ P  AL  E+V A   + FGL L   V    G        K     +V V+T EK   L     +   +  + L ++DE H+IG  +  G  +E+   +   +        RIV +S++L N  ++ Q+L   +     F  + RP+ L               +L    F        N+    ++++    P  V   + +  P K  ++F P++RQ + LA +I+  +    +P+  +   +      + R  D        TL++ +  GIA+ H GL+  E K+V + F  G I V+  + TL   VNL A  V++     Y GK    ++ Y       M G A R   DD G+  ++     ++ F   + E
Sbjct: 1343 SENVFIGAPTGSGKTICAEFAVLRFLQQSPEGRCVYVTPIQALA-EQVYADWQNKFGLQLGKNVVMLTGETSA--DLKLLAKGNVVVSTPEKWDVLSRRWKQRKNVQNVSLFIMDEAHLIGGDT--GPVMEIICSRMRYISSQLERTIRIVALSSSLANAKDVAQWLGVPSTGLFNFHPNVRPVPL---------------ELHIQGF--------NITHTSSRLIAMTKP--VYQAIMKHSPKKPAVVFVPSRRQTKLLALDILTFSGADNEPQRFLHCTEDDLNPFVSRLTDK-------TLKETVTYGIAFLHEGLSDAEVKIVNQLFTSGAIQVVVVSRTLCLSVNLSAHLVVVMDTQFYEGKTH-SYADYPVTDVLHMIGHASRPLLDDAGKAVILCQASKKEFFKKFLYE 1720          
BLAST of Helicase POLQ-like protein vs. Ensembl Nematostella
Match: EDO43976 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX65])

HSP 1 Score: 107.842 bits (268), Expect = 7.642e-24
Identity = 128/503 (25.45%), Postives = 219/503 (43.54%), Query Frame = 1
Query:  280 IDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHARIVGMSATLDNLSEICQFL--------HAVAFDSDFRPIELSEFV---KVDKFIHRINSQ--LKCDTFEQKFSPERNLEPNPNKMVQKMD----PDNVIGLVSEILPD--KSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDELFRQI---DAECLG----VCPTLRQII---RMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAP--YVGKD--LIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQNPGALGEILK 1689
            +D      + CL+       ++++ S  TS GKT+VAE  +   L  KQR VI+  P  AL  +K R L     D+  +      G     PT     AS  V T E   S++    E   + ++  +V DE+H + D  R     E  +L    +  +   V +SAT+ N  +  +++        H V   +DFRP  L  ++     D     ++ +   + + F++     R    +P     +      P N   +V  I+    +  IIF  +K++CE  A  + KL        D+   +   L  ++     +CL       P +  ++   + GI  HHSGL    ++ +E  F +G I  +  T T A G+N+PAR V+      + GKD   I   +Y QM+GRAGR+G D++G   +I+D+K     G  +L+      +  L+    +    VL+ + +E I    +I+  L+ S +  QN  A+  +++
Sbjct:  130 LDPFQKEALRCLE-----NNKSVLISAHTSAGKTVVAEYAIAMSLQKKQR-VIYTTPIKALSNQKYRELYEEFQDVGLMT-----GDVTINPT-----ASALVMTTEILRSMLYRGSEV--MREVAWVVFDEIHYMRDKERGVVWEETIIL----LPDNVHYVFLSATIPNARQFAEWIVHLHKQPCHVVY--TDFRPTPLQHYIYPAGGDGLFLVVDEKGDFREENFQKAMGVIRVGGGDPGAQRGRKGGTKGPSNTFKIVKMIMERNFQPVIIFSFSKKECEAYALQMSKL--------DFNTAQEKTLVEEVFNNAIDCLSDEDKKLPQVEHVLPLLKRGIGIHHSGLLPILKETIEILFSEGLIKALFATETFALGLNMPARTVVFSNARKFDGKDFRFITSGEYIQMSGRAGRRGLDERGIVILIIDEKMGPDVGKGLLKG----HADPLNSAFHLTYNMVLNLLRVEEINP--EIM--LEKSFYQFQNYAAIPAMIE 592          
BLAST of Helicase POLQ-like protein vs. Ensembl Medaka
Match: helq (helicase, POLQ like [Source:NCBI gene;Acc:101166357])

HSP 1 Score: 604.749 bits (1558), Expect = 0.000e+0
Identity = 327/769 (42.52%), Postives = 486/769 (63.20%), Query Frame = 1
Query:  247 KIQELLKFHRGIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHARIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDELFRQI-DAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQ-----NPGALGEILKSEVQYLIDHDLVRQVKSDSDNEICVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLKIDEYSLRRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKELLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASAESRALHEILNPISGKLVRQIISSAKMNIQEKLEALSEEYKE 2535
            K++EL+   RGI KLYDWQ  CL +  + + RNL+YSLPTSGGKTLVAEIL+L++L  +++  + +LPYI+LVQEKVR L+  GL+L+FLVEEYAG +G++PP +     S+YVATIEKAHSL+NSLIET ++  +GLLVVDELHM+G+GS RGA +E+ + K   +  + +++GMSATL N+ ++  FL A  + SDFRP++L EFVKV+  I+ ++      T E  F   R L    +  +QK DPD++I LV+E++P  SC+IFCPTK+ CEN+A  I K      L   ++  ++  L + + D     +CP LR+ +  G+AYHHSGLT EER+++EEAF  G + ++ CTSTLAAG+NLPARRVI+R+PYV  + +K +QYKQM GRAGR G D  GE  +I+ +KDR     L+      C S +L E+ + +   +LS I L +  + + + +FLQG+L  +Q       G L + +   +  L   DL+    + +D     L+ T LGRA  +G +D+     +Y DL +    L L+++LH+LY+VTP+++V   +P+W  Y ++   L A+++++  +IGV E  +     G    K  +D    +RLY AL+L  L  + S++ VA  ++ S GFVQ+LL +A ++ +C  +F EE   + W ++ LL  LT RL +CV  EL+PLME+ GV + RA +LY AGY T+  +A+A+   L   +  +  K    +++SAKM + EK  AL EE  E
Sbjct:  213 KVKELMHRLRGIQKLYDWQEACLNLDCVQQRRNLIYSLPTSGGKTLVAEILILRELLCRRKDCLLVLPYISLVQEKVRGLASLGLELDFLVEEYAGSRGRFPPVRRRNRTSLYVATIEKAHSLVNSLIETGRLENLGLLVVDELHMLGEGS-RGAVMEMTVAKVQHLSKNTQVIGMSATLGNIQDLQAFLRAELYSSDFRPVQLKEFVKVNDSIYEVDP-----TQESGFRFSRLLPFKYSSSMQKTDPDHIIALVTEVIPAHSCLIFCPTKKNCENVAAMICKYLKGDFL--RHREAEKSRLLQDLQDGGGGSMCPVLRRTVPYGVAYHHSGLTTEERRLLEEAFSHGVLCLLGCTSTLAAGINLPARRVILRSPYVATEFLKRTQYKQMVGRAGRAGMDSVGESVLILQEKDRSAAKVLLCSPMENCYSRLLEEDAKGLLTLILSLIGLNVAASLQQLQDFLQGTLLCVQQRRLCTDGGLQDAVLRCIHTLCSKDLI----TAADPHAATLQVTRLGRAAYKGGVDLTFCHLLYKDLSAGLEGLLLSSFLHLLYLVTPYELVPQCSPNWMIYLRQFTSLSAAEQKMSAAIGVPESFVARKAAGQTVKK-GVDAAQAQRLYLALVLLCLLKETSVWGVAERFQLSRGFVQTLLSSAAAFCSCALHFAEEL-EELWPFRSLLAALTQRLTYCVKAELVPLMEVAGVMEARAKQLYSAGYRTLTHLANADPAVLSRTVENLYTKQAAMMVASAKMLLSEKAAALQEEVDE 967          
BLAST of Helicase POLQ-like protein vs. Ensembl Medaka
Match: ascc3 (activating signal cointegrator 1 complex subunit 3 [Source:NCBI gene;Acc:101173332])

HSP 1 Score: 129.028 bits (323), Expect = 1.077e-29
Identity = 120/468 (25.64%), Postives = 201/468 (42.95%), Query Frame = 1
Query:  343 NLVYSLPTSGGKTLVAEILMLKQLAIKQRS-VIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGK------GKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHA----RIVGMSATLDNLSEICQFLHA-----VAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKL----TDPKLLIPDYKVKKRDELFRQIDAECLGVCPTLRQ-----IIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAP--YVGKDLIKFSQYK-----QMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLF 1650
            N++   PT  GKT+ AE+ M +       S V++I P  ALV+E++        D    ++E  G K         P  +    A + V T EK   +  S    + + K+ +L++DE+H++G+   RG  LE+ + +   +  H     R+VG+S  L N  ++  +L         F    RP+ L      +  IH    Q  C        P                       +    P K  +IF  ++RQ    A ++I       +PK            +   Q + E   +  T+R       +  GI  HH+GL + +RK VEE F++  I V+  TSTLA GVN PA  V+++    Y GK   ++  Y      QM GRAGR  FD++G+  ++V    +D +   + E   V +SS+LS    ++   + + I+   I + +D ++++  + F
Sbjct: 1203 NVLLGAPTGSGKTIAAEMAMFRVFNKYPSSKVVYIAPLKALVRERME-------DWKIRIQEKLGKKVVELTGDVTPDVRAIAQADLIVTTPEKWDGVSRSWQNRSYVQKVAILIIDEIHLLGED--RGPVLEVIVSRTNFISSHTSKSVRVVGLSTALANARDLADWLGIKQVGLFNFRPSVRPVPL------EVHIHGFPGQHYCPRMASMNKP-------------------TFQAIRSHSPAKPVLIFVSSRRQTRLTALDLIAYLATEDNPK------------QWLHQDEREIEDIIATVRDSNLKLTLAFGIGLHHAGLHERDRKTVEELFVNCKIQVLVATSTLAWGVNFPAHLVVVKGTEYYDGKSR-RYVDYPITDVLQMMGRAGRPQFDEQGKAVILVHDIKKDFYKKFLYEPFPV-ESSLLS----VLSDHLNAEIAAGTISSKQDAMDYITWTYF 1618          

HSP 2 Score: 101.293 bits (251), Expect = 3.608e-21
Identity = 121/496 (24.40%), Postives = 206/496 (41.53%), Query Frame = 1
Query:  343 NLVYSLPTSGGKTLVAEILMLKQL--------AIKQRS--VIFILPYIALVQEKV----RALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKI-GLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHA----RIVGMSATLDNLSEICQFLHA------VAFDSDFRPIELSE-FVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVI--GLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDEL-FRQID-AECLGVCP---------TLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVII---------RAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQ---NPGALG 1677
            NL+   PT  GKT +A + +L ++         IK+    ++++ P  AL  E      + L P G+ +  L  +    KG+   T+      + V T EK   +    +    +S+I  LL++DE+H++ +   RG  LE  + + +R         RI+G+SATL N  ++  FLH         FD  FRP+ L + FV +                              NK+ Q  D + V    ++ ++      ++F   +      A  +I++            K   E+ F Q D     G C           ++++   G   HH+G+ + +R ++E  F  G + V+ CT+TLA GVNLPA  VII         R  +V   ++      Q+ GRAGR  FD  GE  +I        +  L+ +     Q+ I S+    +   + + I+L  +   E+ V++L  +   ++   NP A G
Sbjct:  352 NLLICAPTGAGKTNIAMLTVLHEIRQHLQPGGVIKKDEFKIVYVAPMKALAAEMTNYFSKRLEPLGITVKELTGDMQLTKGEILRTQ------MLVTTPEKWDVVTRKSVGDVSLSQIVRLLILDEVHLLHED--RGPVLESLVARTIRQVESTQSMIRILGLSATLPNYLDVATFLHVNPYIGLFFFDGRFRPVPLGQTFVGIK---------------------------TTNKIQQIHDIEEVCYNKVLEQVKAGHQVMVFVHARNATVRTAMALIEM-----------AKNHGEICFFQTDQGSDYGQCEKQVQRSRNKQMKEMFPEGFGIHHAGMLRSDRSLMESLFSKGYLKVLVCTATLAWGVNLPAHAVIIKGTQIYDAKRGAFVDLGILDV---MQIFGRAGRPQFDKFGEGTIITTHDKLSHYLTLLTQ-----QNPIESQYLSSLADNLNAEIALGTVTNVEEAVKWLSYTYLYVRMRANPLAYG 793          
BLAST of Helicase POLQ-like protein vs. Ensembl Medaka
Match: mtrex (Mtr4 exosome RNA helicase [Source:NCBI gene;Acc:100304468])

HSP 1 Score: 112.464 bits (280), Expect = 8.275e-25
Identity = 133/504 (26.39%), Postives = 217/504 (43.06%), Query Frame = 1
Query:  328 IGKTRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHARIVGMSATLDNLSEICQFL--------HAVAFDSDFRPIELSEFV--KVDKFIHRI---NSQLKCDTFEQKFSPERNLEPNPNKMVQKMDP----------DNVIGLVSEILPD--KSCIIFCPTKRQCENLANNIIKLT----DPKLLIPDYKVKKRDELFRQIDAECLG----VCPTLRQII---RMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAP--YVGKD--LIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEF-LQGSLFSIQN----PGALGEILKSEVQY 1704
            I   ++++ S  TS GKT+ AE  +   L  KQR VIF  P  AL  +K R +     D+  +      G     PT     AS  V T E   S++    E   + ++  ++ DE+H + D  R     E  +L    +  +   V +SAT+ N  +  +++        H V   +D+RP  L  ++       +H +   N   + D F       R++  +      K DP           +V  +V  I+    +  IIF  +K++CE  A  + KL     D K L+        +E+F     +CL       P +  ++   + GI  HH GL    ++ +E  F +G +  +  T T A G+N+PAR V+  +   + GK    I   +Y QM+GRAGR+G DD+G    +VD+K     G  +L+ S+   +S       M+         L L++  E   E+ L+ S +  Q+    PG + +I K E QY
Sbjct:  141 IDNNQSVLVSAHTSAGKTVCAEYAIALALREKQR-VIFTSPIKALSNQKYREMYEEFQDVGLIT-----GDVTINPT-----ASCLVMTTEILRSMLYRGSEI--MREVAWVIFDEIHYMRDAERGVVWEETIIL----LPDNVHYVFLSATIPNARQFAEWICHLHKQPCHVVY--TDYRPTPLQHYIFPAGGDGLHLVVDENGDFREDNFNTAMQVLRDVGDSGGSGGGKWDPRGRKGGTKGPSSVFKIVKMIMERNFQPVIIFSFSKKECEAYALQVAKLDFNTDDEKRLV--------EEVFNNA-VDCLSDEDKKLPQVEHVLPLLKRGIGIHHGGLLPILKETIEILFSEGLLKALFATETFAMGINMPARTVLFTSARKFDGKSHRFITSGEYIQMSGRAGRRGMDDRGIVIFMVDEKMSPAVGKQLLKGSADPLNSAFHLTYNMV---------LNLLRVEEINPEYMLEKSFYQFQHYRALPGVVEKIKKLEEQY 607          
BLAST of Helicase POLQ-like protein vs. Ensembl Medaka
Match: hfm1 (helicase for meiosis 1 [Source:ZFIN;Acc:ZDB-GENE-061207-43])

HSP 1 Score: 108.997 bits (271), Expect = 8.193e-24
Identity = 110/423 (26.00%), Postives = 189/423 (44.68%), Query Frame = 1
Query:  340 RNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPY--IALVQEKVRAL---------SPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFG-----------HARIVGMSATLDNLSEICQFLHA-------VAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRDELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAP--YVGKDLIKFSQYK--QMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLI 1509
            +N V   PT  GKT++ E+ +++ L   Q       P+  +  V   ++AL           FG  L  + +E  G   +       + +++ + T EK  SL     +   +  + L ++DE+H++ D +R GA LE+ + +   V               R V +SAT+ N+S+I ++L         +  +   RP++L + V              C   + +F  + +L     KM       N+I   S+    K  ++FC T++  +  A          +L  D +     E  +Q+      V  +  +++ +GI +HH+GL   +RK+VEEAF  G +SV+  T TLA GVNLPA  V+I++   YV     ++S+    QM GRAGR  FD      ++   + RDK+  L+
Sbjct:   29 KNFVACAPTGSGKTVLFELAIIRLLMETQE------PWRDVKAVYAPIKALCSQCFENWNKKFG-HLGLICKELTGDT-EIEDFFEIQDSNIILTTPEKWDSLTRKWRDNCLLQLVRLFLIDEVHVVKDATR-GATLEVVVSRMKAVHSFRTSQNPEAGLSMRFVAVSATIPNVSDIAEWLSNEGEPATYLNMNESHRPVKLRKVVL----------GFPCSPNQTEFKFDLSLS---YKMA------NIIQTYSD---QKPALVFCSTRKGAQQSA---------AILAKDVRFNLSIE-HKQLTKYANSVLDSKLRLVPLGIGFHHAGLDLSDRKLVEEAFTQGDLSVL-TTRTLAMGVNLPAHLVVIKSTMQYVVGSCEEYSEADILQMIGRAGRPQFDTSATAVIMTKVQTRDKYMKLM 409          
BLAST of Helicase POLQ-like protein vs. Ensembl Medaka
Match: snrnp200 (small nuclear ribonucleoprotein U5 subunit 200 [Source:NCBI gene;Acc:101154872])

HSP 1 Score: 107.842 bits (268), Expect = 3.808e-23
Identity = 120/481 (24.95%), Postives = 212/481 (44.07%), Query Frame = 1
Query:  343 NLVYSLPTSGGKTLVAEILMLKQLA----------IKQRSVIFILPYIALVQEKV----RALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMR----VFGHARIVGMSATLDNLSEICQFLHA------VAFDSDFRPIELSE-FVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDY--KVKKRDELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYV-GKDLIKFSQYK-----QMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSI---QNPGALG 1677
            NL+   PT  GKT VA + ML+++           +    +I+I P  +LVQE V    + L+ +G+ ++ L  ++   K +   T+      + V T EK   +     E      + L+++DE+H++ D   RG  LE  + + +R         R++G+SATL N  ++   L          FD+ FRP+ L + +V +                          E    K  Q M+ + V   + E       ++F  ++++    A  I  +   K  +  +  +     E+ R    +C  +   L+ ++  G A HH+G+T+ +R +VE+ F D  I V+  T+TLA GVNLPA  VII+   V   +  ++++       QM GRAGR  +D KGE  +I    +   + +L+ +     Q  I S+    +   + + I L  ++T +D V +L  +   +   +NP   G
Sbjct:  496 NLLVCAPTGAGKTNVALMAMLREIGKHINMDGTINVDDFKIIYIAPMRSLVQEMVGSFSKRLASYGITVSELTGDHQLCKEEINATQ------IIVCTPEKWDIITRKGGERTYTQLVRLIIIDEIHLLHDD--RGPVLESLIARTIRNVELTQDDVRLLGLSATLPNYEDVATCLRVDPAKGLFYFDNSFRPVPLEQTYVGI-------------------------TEKKAIKRFQIMN-EIVYEKIMEHAGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNL--ELKDLLPYGFAIHHAGMTRVDRTLVEDLFSDRHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQ-----QLPIESQMVAKLPDMLNAEIVLGNVQTVKDAVNWLGYTYLYVRMLRNPTLYG 935          

HSP 2 Score: 92.4337 bits (228), Expect = 1.798e-18
Identity = 114/499 (22.85%), Postives = 204/499 (40.88%), Query Frame = 1
Query:  343 NLVYSLPTSGGKTLVAEILMLKQLAIKQRS-VIFILPYIALVQEK-VRALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMRVFGHA----RIVGMSATLDNLSEICQFL-----HAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDY-KVKKRD--ELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVII-RAPYVGKDLIKFSQYK-----QMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLF---SIQNPGALGEILKSEVQYLIDH--DLVRQVKSDSDNEICV 1764
            N+    PT  GKT+ AE  +L+ L        ++I P  AL ++  V     F   LN  V    G        K      + ++T +K   L     +   +  + L +VDE H+IG     G  LE+   +   +        RIV +S++L N  ++  +L         F  + RP+ L               +L    F        N+     +++    P  V   + +  P K  ++F P++RQ    A +I+      ++   +    ++D      +I+       PTL++ +  G+ Y H GL+  ERK+VE+ F  G + V+  + +L  G+++ A  VI+    Y    +  +  Y      QM G+A R   DD+G C ++     +D F   + E   V +S +  ++C +  +F  + I  + I+  +D V++L  +       QNP     +     ++L DH  +LV     D +   C+
Sbjct: 1343 NVFVGAPTGSGKTICAEFAILRMLLHNTEGRCVYITPMEALAEQVFVDWHQKFQDILNKKVVLLTGETST--DLKLLGKGDIIISTPDKWDILSRRWKQRKNVQNVSLFIVDEAHLIG--GENGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDMAHWLGCSTTATFNFHPNVRPVPL---------------ELHIQGF--------NVSHTQTRLLSMAKP--VYHAIMKHSPSKPAVVFVPSRRQTRLTAIDILTFCAADVVPQRFLHCTEKDLVPFLEKIND------PTLKETLANGVGYLHEGLSATERKIVEQLFNSGAVQVVVSSRSLCWGISISAHLVIVMDTQYYNGKIHAYVDYPIYDVLQMVGKANRPMLDDEGRCVIMCQGSKKDFFKKFLYEPLPV-ESHL--DHC-LHDHFN-AEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYN-LQGMSHRHLSDHLSELVENTLHDLEQSKCI 1800          
BLAST of Helicase POLQ-like protein vs. Planmine SMEST
Match: SMESG000034022.1 (SMESG000034022.1)

HSP 1 Score: 326.635 bits (836), Expect = 3.736e-94
Identity = 237/759 (31.23%), Postives = 375/759 (49.41%), Query Frame = 1
Query:  337 TRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKV----RALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFM----------RVFGHARIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSE-ILPDKSCIIFCPTKRQCE----NLANNIIKL---TDPKLLIPDYKVKK------RDELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQNPGALGEILKSE--------VQYLIDHDLVRQVKSDS---------------------DNEICVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLKIDEYSLRRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKE-LLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASAESRALHEIL 2439
            ++NLVYS PTS GKTLV+EI++LK++   ++ V+FILPY+++ +EK+    +     GL +        G  G   P        + V TIEKA++L+N LI+   + ++ LLV+DELHM+GD   RG  LEL L K +            +   +I+GMSATL NL+ + Q+L A  +  D+RPI L E +K D  I+       C       +P R    N    V K D D ++GL  E IL    C++FCPTK+ CE    NLA  I++L    +   L   +K++K       +E    + +   G+   L ++I  G+A+HH+GLT +ER ++E  F +G I ++  TSTL++GVNLPARRVIIR P      +    Y+QM GRAGRKG D KGE  ++   KD   F   I       +S +   N   +K  +L  I   ++ T  + V +L+ S         + +  +SE        ++YL  +D+++   S+S                     +N+  +L  T LG+AV+  SI       I+ +L  A   L L T LH++Y++TP  +  +    W  +   +     ++  ++  +G+ E  +    +    S    D+   RR Y++LILY L ++ S  +V   +    G +QSL   A +Y+  +  F        WS+ E L+     R+   VS +L+ L+ +  +   RA   +KAG +TI  IA A+ + +  +L
Sbjct:   42 SKNLVYSAPTSAGKTLVSEIILLKRVLELKKKVLFILPYVSVSKEKMVYFQKLFGGIGLKI-------GGFMGDMSPKGGLATVDIAVCTIEKANNLVNRLIDDGSLEELSLLVIDELHMLGD-EHRGYILELLLTKILYHSKTMKENDPNYRETQIIGMSATLPNLNVVAQWLKAELYVCDYRPIPLQEMMKCDSKIY------DCKDLS---TPIRMF--NCPSGVIKTDEDQILGLCLETILEGHGCLVFCPTKKWCETMSKNLAKEILRLCMNAEKDNLENGFKLRKIARIPKLEECIEDLKSSPSGLDDVLEEVIPYGVAFHHAGLTTDERDIIETYFREGHIRILIATSTLSSGVNLPARRVIIRTPLFNNRFMDPMTYRQMIGRAGRKGIDVKGESVIVCKPKDLTNFKKFIEVGIQPIKSCLDRNNSLSLKRALLEVIVPGVVHTVSECVIYLKNSFLEYTLVNGVSKKNESESEALIIECLEYLEKNDMIKIKGSESQVSQKKRGRPKKQVEKSCGNLENDQRLLYPTSLGQAVLSASIGPEDGLVIFHELDRARRCLALDTDLHLIYLLTPVYLSMNTAIDWTCFYNVVNSFSEAELRVMILVGIEEKFLIKYSVSGRTSTRHSDDPKYRRFYSSLILYHLVNEFSFQQVTEKFNVEKGSLQSLQMQAATYAGMVTIFCNRLG---WSHLEVLMTSFQRRMIFGVSGDLVDLVRLSLMNACRARIFFKAGLETISSIAGAKVKEITNLL 778          
BLAST of Helicase POLQ-like protein vs. Planmine SMEST
Match: SMESG000034022.1 (SMESG000034022.1)

HSP 1 Score: 328.176 bits (840), Expect = 5.720e-94
Identity = 234/759 (30.83%), Postives = 372/759 (49.01%), Query Frame = 1
Query:  337 TRNLVYSLPTSGGKTLVAEILMLKQLAIKQRSVIFILPYIALVQEKV----RALSPFGLDLNFLVEEYAGGKGKYPPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGSRRGANLELCLLKFMR----------VFGHARIVGMSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSE-ILPDKSCIIFCPTKRQCENLANNIIK-------------LTDPKLLIPDYKVKKRDELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQNPGALGEILKSE--------VQYLIDHDLVRQVKSDS---------------------DNEICVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLKIDEYSLRRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKE-LLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASAESRALHEIL 2439
            ++NLVYS PTS GKTLV+EI++LK++   ++ V+FILPY+++ +EK+    +     GL +        G  G   P        + V TIEKA++L+N LI+   + ++ LLV+DELHM+GD   RG  LEL L K +            +   +I+GMSATL NL+ + Q+L A  +  D+RPI L E +K D  I+       C       +P R    N    V K D D ++GL  E IL    C++FCPTK+ CE ++ N+ K             L +   L    ++ K +E    + +   G+   L ++I  G+A+HH+GLT +ER ++E  F +G I ++  TSTL++GVNLPARRVIIR P      +    Y+QM GRAGRKG D KGE  ++   KD   F   I       +S +   N   +K  +L  I   ++ T  + V +L+ S         + +  +SE        ++YL  +D+++   S+S                     +N+  +L  T LG+AV+  SI       I+ +L  A   L L T LH++Y++TP  +  +    W  +   +     ++  ++  +G+ E  +    +    S    D+   RR Y++LILY L ++ S  +V   +    G +QSL   A +Y+  +  F        WS+ E L+     R+   VS +L+ L+ +  +   RA   +KAG +TI  IA A+ + +  +L
Sbjct:   52 SKNLVYSAPTSAGKTLVSEIILLKRVLELKKKVLFILPYVSVSKEKMVYFQKLFGGIGLKI-------GGFMGDMSPKGGLATVDIAVCTIEKANNLVNRLIDDGSLEELSLLVIDELHMLGD-EHRGYILELLLTKILYHSKTMKENDPNYRETQIIGMSATLPNLNVVAQWLKAELYVCDYRPIPLQEMMKCDSKIY------DCKDLS---TPIRMF--NCPSGVIKTDEDQILGLCLETILEGHGCLVFCPTKKWCETMSKNLAKEILRLCMNAEKDNLENGFKLRKIARIPKLEECIEDLKSSPSGLDDVLEEVIPYGVAFHHAGLTTDERDIIETYFREGHIRILIATSTLSSGVNLPARRVIIRTPLFNNRFMDPMTYRQMIGRAGRKGIDVKGESVIVCKPKDLTNFKKFIEVGIQPIKSCLDRNNSLSLKRALLEVIVPGVVHTVSECVIYLKNSFLEYTLVNGVSKKNESESEALIIECLEYLEKNDMIKIKGSESQVSQKKRGRPKKQVEKSCGNLENDQRLLYPTSLGQAVLSASIGPEDGLVIFHELDRARRCLALDTDLHLIYLLTPVYLSMNTAIDWTCFYNVVNSFSEAELRVMILVGIEEKFLIKYSVSGRTSTRHSDDPKYRRFYSSLILYHLVNEFSFQQVTEKFNVEKGSLQSLQMQAATYAGMVTIFCNRLG---WSHLEVLMTSFQRRMIFGVSGDLVDLVRLSLMNACRARIFFKAGLETISSIAGAKVKEITNLL 788          
BLAST of Helicase POLQ-like protein vs. Planmine SMEST
Match: SMESG000026014.1 (SMESG000026014.1)

HSP 1 Score: 216.468 bits (550), Expect = 2.462e-63
Identity = 104/164 (63.41%), Postives = 131/164 (79.88%), Query Frame = 1
Query: 1792 VVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLKIDEYSLRRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKELLPKL 2283
            ++R    ++ + EIY++L+SAENSLNL TYLHML+IVTPHDM+AS+ P W  +++RIGK      +LL+ IGV+E++IF+LE G  +SKLKID+Y LRR Y  LILYDLWDQKSIYEVANYYE S GFVQSLLH AV+YSACL+NFVEEF  +FW +K+L  KL
Sbjct:   80 ILRDFQMILHLTEIYNNLQSAENSLNLVTYLHMLHIVTPHDMIASLNPCWYNFSRRIGK------DLLQLIGVDEEIIFILENGF-KSKLKIDDYFLRRFYLTLILYDLWDQKSIYEVANYYELSIGFVQSLLHPAVAYSACLSNFVEEFNTEFWRFKKLFQKL 236          
BLAST of Helicase POLQ-like protein vs. Planmine SMEST
Match: SMESG000026014.1 (SMESG000026014.1)

HSP 1 Score: 216.083 bits (549), Expect = 2.796e-63
Identity = 104/164 (63.41%), Postives = 131/164 (79.88%), Query Frame = 1
Query: 1792 VVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLKIDEYSLRRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKELLPKL 2283
            ++R    ++ + EIY++L+SAENSLNL TYLHML+IVTPHDM+AS+ P W  +++RIGK      +LL+ IGV+E++IF+LE G  +SKLKID+Y LRR Y  LILYDLWDQKSIYEVANYYE S GFVQSLLH AV+YSACL+NFVEEF  +FW +K+L  KL
Sbjct:   76 ILRDFQMILHLTEIYNNLQSAENSLNLVTYLHMLHIVTPHDMIASLNPCWYNFSRRIGK------DLLQLIGVDEEIIFILENGF-KSKLKIDDYFLRRFYLTLILYDLWDQKSIYEVANYYELSIGFVQSLLHPAVAYSACLSNFVEEFNTEFWRFKKLFQKL 232          
BLAST of Helicase POLQ-like protein vs. Planmine SMEST
Match: SMESG000034022.1 (SMESG000034022.1)

HSP 1 Score: 234.572 bits (597), Expect = 3.416e-63
Identity = 175/600 (29.17%), Postives = 282/600 (47.00%), Query Frame = 1
Query:  772 MSATLDNLSEICQFLHAVAFDSDFRPIELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDNVIGLVSE-ILPDKSCIIFCPTKRQCENLANNIIK-------------LTDPKLLIPDYKVKKRDELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTISVICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDDKGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLELIKTFEDIVEFLQGSLFSIQNPGALGEILKSE--------VQYLIDHDLVRQVKSDS---------------------DNEICVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYIVTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCCQSKLKIDEYSLRRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTAVSYSACLANFVEEFRNDFWSYKE-LLPKLTTRLAHCVSPELIPLMEIHGVQKFRAAKLYKAGYDTIVKIASAESRALHEIL 2439
            MSATL NL+ + Q+L A  +  D+RPI L E +K D  I+       C       +P R    N    V K D D ++GL  E IL    C++FCPTK+ CE ++ N+ K             L +   L    ++ K +E    + +   G+   L ++I  G+A+HH+GLT +ER ++E  F +G I ++  TSTL++GVNLPARRVIIR P      +    Y+QM GRAGRKG D KGE  ++   KD   F   I       +S +   N   +K  +L  I   ++ T  + V +L+ S         + +  +SE        ++YL  +D+++   S+S                     +N+  +L  T LG+AV+  SI       I+ +L  A   L L T LH++Y++TP  +  +    W  +   +     ++  ++  +G+ E  +    +    S    D+   RR Y++LILY L ++ S  +V   +    G +QSL   A +Y+  +  F        WS+ E L+     R+   VS +L+ L+ +  +   RA   +KAG +TI  IA A+ + +  +L
Sbjct:    1 MSATLPNLNVVAQWLKAELYVCDYRPIPLQEMMKCDSKIY------DCKDLS---TPIRMF--NCPSGVIKTDEDQILGLCLETILEGHGCLVFCPTKKWCETMSKNLAKEILRLCMNAEKDNLENGFKLRKIARIPKLEECIEDLKSSPSGLDDVLEEVIPYGVAFHHAGLTTDERDIIETYFREGHIRILIATSTLSSGVNLPARRVIIRTPLFNNRFMDPMTYRQMIGRAGRKGIDVKGESVIVCKPKDLTNFKKFIEVGIQPIKSCLDRNNSLSLKRALLEVIVPGVVHTVSECVIYLKNSFLEYTLVNGVSKKNESESEALIIECLEYLEKNDMIKIKGSESQVSQKKRGRPKKQVEKSCGNLENDQRLLYPTSLGQAVLSASIGPEDGLVIFHELDRARRCLALDTDLHLIYLLTPVYLSMNTAIDWTCFYNVVNSFSEAELRVMILVGIEEKFLIKYSVSGRTSTRHSDDPKYRRFYSSLILYHLVNEFSFQQVTEKFNVEKGSLQSLQMQAATYAGMVTIFCNRLG---WSHLEVLMTSFQRRMIFGVSGDLVDLVRLSLMNACRARIFFKAGLETISSIAGAKVKEITNLL 586          
The following BLAST results are available for this feature:
BLAST of Helicase POLQ-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HELQ0.000e+042.51helicase, POLQ like [Source:HGNC Symbol;Acc:HGNC:1... [more]
HELQ6.401e-15236.18helicase, POLQ like [Source:HGNC Symbol;Acc:HGNC:1... [more]
POLQ1.748e-9532.73DNA polymerase theta [Source:HGNC Symbol;Acc:HGNC:... [more]
POLQ2.324e-9532.64DNA polymerase theta [Source:HGNC Symbol;Acc:HGNC:... [more]
HELQ4.204e-5758.79helicase, POLQ like [Source:HGNC Symbol;Acc:HGNC:1... [more]
back to top
BLAST of Helicase POLQ-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
helq-14.741e-16637.85HELicase Q homolog [Source:UniProtKB/TrEMBL;Acc:Q... [more]
helq-12.583e-8235.81HELicase Q homolog [Source:UniProtKB/TrEMBL;Acc:Q... [more]
polq-11.775e-6128.30DNA polymerase theta [Source:UniProtKB/Swiss-Prot... [more]
Y54E2A.47.448e-2926.81pep chromosome:WBcel235:II:14768462:14778149:1 gen... [more]
Y54E2A.42.548e-2826.81pep chromosome:WBcel235:II:14754622:14778149:1 gen... [more]
back to top
BLAST of Helicase POLQ-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mus3017.372e-17236.52gene:FBgn0002899 transcript:FBtr0076689[more]
DNApol-theta5.498e-9131.54gene:FBgn0002905 transcript:FBtr0082662[more]
obe2.283e-2826.81gene:FBgn0038344 transcript:FBtr0083147[more]
Mtr41.379e-2729.22gene:FBgn0001986 transcript:FBtr0080760[more]
l(3)72Ab1.623e-2525.25gene:FBgn0263599 transcript:FBtr0075527[more]
back to top
BLAST of Helicase POLQ-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
helq0.000e+043.23helicase, POLQ like [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
helq0.000e+041.81helicase, POLQ like [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
BX649525.21.975e-11838.66pep chromosome:GRCz11:CHR_ALT_CTG21_1_10:19337278:... [more]
polq3.324e-9130.75polymerase (DNA directed), theta [Source:ZFIN;Acc:... [more]
polq5.784e-9030.33polymerase (DNA directed), theta [Source:ZFIN;Acc:... [more]
back to top
BLAST of Helicase POLQ-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HELQ0.000e+042.82helicase, POLQ like [Source:NCBI gene;Acc:10048518... [more]
HELQ0.000e+042.27helicase, POLQ like [Source:NCBI gene;Acc:10048518... [more]
HELQ0.000e+042.46helicase, POLQ like [Source:NCBI gene;Acc:10048518... [more]
HELQ1.035e-13238.13helicase, POLQ like [Source:NCBI gene;Acc:10048518... [more]
polq1.972e-9332.94polymerase (DNA directed), theta [Source:NCBI gene... [more]
back to top
BLAST of Helicase POLQ-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Helq0.000e+043.86helicase, POLQ-like [Source:MGI Symbol;Acc:MGI:217... [more]
Helq9.911e-16844.76helicase, POLQ-like [Source:MGI Symbol;Acc:MGI:217... [more]
Polq2.871e-9131.52polymerase (DNA directed), theta [Source:MGI Symbo... [more]
Ascc32.396e-2925.77activating signal cointegrator 1 complex subunit 3... [more]
Mtrex9.331e-2626.95Mtr4 exosome RNA helicase [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Helicase POLQ-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2VPA6|HELQ_MOUSE0.000e+043.86Helicase POLQ-like OS=Mus musculus OX=10090 GN=Hel... [more]
sp|Q8TDG4|HELQ_HUMAN0.000e+042.51Helicase POLQ-like OS=Homo sapiens OX=9606 GN=HELQ... [more]
sp|Q588V7|TEB_ARATH1.591e-10232.60Helicase and polymerase-containing protein TEBICHI... [more]
sp|O75417|DPOLQ_HUMAN8.395e-9532.73DNA polymerase theta OS=Homo sapiens OX=9606 GN=PO... [more]
sp|Q8CGS6|DPOLQ_MOUSE2.008e-9031.52DNA polymerase theta OS=Mus musculus OX=10090 GN=P... [more]
back to top
BLAST of Helicase POLQ-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1QZF00.000e+045.04Helicase POLQ-like protein OS=Crassostrea gigas OX... [more]
A0A1V4JUT90.000e+044.06Helicase POLQ-like isoform A OS=Patagioenas fascia... [more]
A0A433TIF40.000e+043.19Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A2I0MGL70.000e+044.32Helicase, POLQ-like OS=Columba livia OX=8932 GN=HE... [more]
A0A1V4JUX30.000e+044.06Helicase POLQ-like isoform B OS=Patagioenas fascia... [more]
back to top
BLAST of Helicase POLQ-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
helq0.000e+041.67helicase, POLQ like [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
polq4.470e-9230.82DNA polymerase theta [Source:NCBI gene;Acc:1030397... [more]
helq5.075e-5856.89helicase, POLQ like [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
hfm11.293e-2624.03helicase for meiosis 1 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
mtrex4.089e-2526.76Mtr4 exosome RNA helicase [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Helicase POLQ-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
helq0.000e+042.69helicase, POLQ like [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
helq0.000e+041.32helicase, POLQ like [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
ascc31.309e-2925.69activating signal cointegrator 1 complex subunit 3... [more]
ascc33.061e-2925.58activating signal cointegrator 1 complex subunit 3... [more]
mtrex1.156e-2626.73Mtr4 exosome RNA helicase [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Helicase POLQ-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HFM13.126e-3724.91Meiosis specific DNA helicase; involved in the con... [more]
BRR22.519e-3229.51RNA-dependent ATPase RNA helicase (DEIH box); requ... [more]
SLH13.897e-2625.89Putative RNA helicase related to Ski2p; involved i... [more]
MTR46.720e-2326.26ATP-dependent 3'-5' RNA helicase of the DExD/H fam... [more]
SKI21.855e-1232.34Ski complex component and putative RNA helicase; m... [more]
back to top
BLAST of Helicase POLQ-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO447480.000e+041.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467141.920e-2827.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO324382.532e-2840.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491464.083e-2524.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439767.642e-2425.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Helicase POLQ-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
helq0.000e+042.52helicase, POLQ like [Source:NCBI gene;Acc:10116635... [more]
ascc31.077e-2925.64activating signal cointegrator 1 complex subunit 3... [more]
mtrex8.275e-2526.39Mtr4 exosome RNA helicase [Source:NCBI gene;Acc:10... [more]
hfm18.193e-2426.00helicase for meiosis 1 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
snrnp2003.808e-2324.95small nuclear ribonucleoprotein U5 subunit 200 [So... [more]
back to top
BLAST of Helicase POLQ-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000034022.13.736e-9431.23SMESG000034022.1[more]
SMESG000034022.15.720e-9430.83SMESG000034022.1[more]
SMESG000026014.12.462e-6363.41SMESG000026014.1[more]
SMESG000026014.12.796e-6363.41SMESG000026014.1[more]
SMESG000034022.13.416e-6329.17SMESG000034022.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023063 ID=SMED30023063|Name=Helicase POLQ-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2922bp
GTTTTTGTTTGTATAAGTAAGTTATTCAAAAATAAGTAACTTTTAATTTT
AGAAAATCTATTTTTTCGTTCTATTCAAATTTTCATAATATTATTTAAAA
TGCCTATAAAGAAGTTTTCTGGAGTTGACAAAGTTAATGAACATTATAAT
AGTTTTACAGTTAGAAAGCGAGCTTATGGACAATTAGATTCAATAGAAAA
TTCATTAACTAATAATTCACTTAATGAATCAATTAACATGTCCATAAAAA
TCCAGGAATTATTAAAATTTCACCGTGGAATAGACAAGCTATATGATTGG
CAAATCGAATGCCTTAAAATTCCCGGAATCGGCAAAACAAGGAATCTCGT
TTATTCTCTTCCAACTAGCGGCGGGAAAACACTAGTTGCTGAGATTTTAA
TGCTTAAACAGTTAGCTATTAAGCAGAGATCTGTGATTTTCATTTTGCCC
TATATTGCACTAGTGCAGGAGAAAGTCAGAGCGCTTTCTCCCTTTGGATT
GGATTTGAATTTCCTGGTTGAAGAATACGCCGGAGGCAAGGGGAAATATC
CGCCAACAAAGCACACAAAATGCGCCTCGGTTTATGTAGCAACAATAGAG
AAAGCCCATTCGCTCATCAACAGCTTAATAGAGACAAATCAAATCAGTAA
AATCGGGCTTCTCGTTGTCGATGAGCTGCACATGATCGGTGACGGCTCGA
GGAGAGGCGCAAATTTGGAGCTTTGTCTGTTGAAATTTATGCGAGTTTTC
GGCCACGCCAGGATTGTCGGAATGAGCGCAACGCTGGACAATTTATCTGA
GATCTGTCAGTTTCTCCACGCAGTCGCGTTTGATAGCGATTTCCGGCCAA
TCGAATTGAGCGAGTTTGTCAAGGTCGACAAGTTCATCCACAGAATCAAC
AGCCAATTGAAATGTGACACATTCGAGCAGAAATTCTCGCCCGAGCGCAA
TTTGGAACCGAATCCCAATAAAATGGTACAAAAAATGGATCCTGATAACG
TTATCGGTCTCGTTTCTGAGATTTTGCCAGATAAATCGTGCATTATATTC
TGTCCCACGAAAAGACAATGCGAGAATCTAGCAAACAATATCATTAAGCT
GACAGATCCAAAATTGCTCATTCCCGATTATAAAGTGAAAAAGCGAGATG
AATTATTTCGGCAGATCGATGCCGAATGCCTGGGAGTATGCCCGACATTA
AGGCAAATCATACGAATGGGAATAGCGTATCATCACAGTGGCTTGACGCA
GGAGGAAAGGAAAATGGTAGAAGAGGCATTTCTTGATGGGACAATATCCG
TGATTTGCTGTACAAGCACTTTGGCGGCTGGAGTTAATTTACCCGCTAGG
AGGGTGATTATCCGAGCGCCTTATGTCGGGAAGGATTTAATTAAGTTCAG
CCAATACAAGCAAATGGCGGGTAGAGCTGGCCGCAAAGGTTTCGATGACA
AGGGGGAGTGCTTTGTTATAGTGGATAAAAAGGATAGGGACAAGTTCGGA
AACCTGATACTGGAGGCCTCATCTGTGTGCCAGAGCAGCATCTTATCCGA
GAATTGCCGAATGATTAAATATTTTGTGTTGTCAGCTATCAGCTTAGAAC
TCATTAAAACCTTTGAGGATATCGTTGAGTTTTTGCAAGGATCTCTTTTT
AGCATTCAAAATCCAGGAGCTCTCGGAGAAATCCTGAAGTCAGAGGTGCA
ATATCTGATTGATCACGATCTCGTTAGACAAGTTAAATCGGATTCGGACA
ATGAGATTTGTGTTTTGAAAGCCACAGAACTAGGGAGAGCCGTCGTCAGG
GGCTCCATTGACGTGATCCGGGTGAAGGAAATCTACAGCGATTTGAAATC
TGCTGAAAACTCCCTGAATTTGGCCACGTATTTGCACATGCTTTATATCG
TAACCCCGCACGACATGGTTGCCTCGATAACTCCCAGCTGGAATCCTTAT
GCAAAGCGAATCGGCAAGCTATTGGCCAGTGATAAAGAGCTGCTGAAATC
GATCGGAGTCAATGAGGACATGATATTCATGCTAGAAATGGGCTGCTGCC
AGTCTAAACTGAAAATCGATGAATATTCTCTGAGACGGCTTTATGCAGCT
CTGATTCTCTACGACCTCTGGGACCAGAAATCGATCTATGAAGTCGCCAA
TTACTACGAGCAGTCGAGTGGATTTGTGCAGTCCCTGCTCCACACCGCCG
TATCGTATTCCGCGTGTCTCGCTAATTTTGTCGAGGAATTCAGGAATGAT
TTCTGGAGCTATAAGGAATTGCTGCCGAAGCTGACAACGCGATTGGCTCA
TTGCGTGTCACCGGAACTGATTCCATTGATGGAGATTCATGGGGTTCAAA
AGTTCAGAGCAGCTAAATTGTACAAGGCCGGTTATGACACAATTGTCAAA
ATTGCATCGGCAGAATCTCGGGCGCTTCACGAGATTCTAAATCCAATTTC
CGGGAAATTAGTTAGGCAAATTATATCCTCGGCTAAGATGAATATCCAGG
AGAAACTGGAGGCGCTTTCTGAGGAATATAAGGAGCTTGTAGTGGTGAGG
GGGGCTAGTATTGCTACCGCCGATGAAATGGATACTTGCACTCACAGCAC
GCCCATGAAGAGCAGAAACACATCAATATTAGACGGCAGCGGTCTCGATT
GTTTTTCAAGCGATGAATGAAGAAAATTTTCAATCTTTTCTTTTTTGTAA
AATTTTGTTTTCTTTTAGTTGCTGTGCAACATTCATAGTAAGGTAGCATT
GCTAAGGTTTCGTTAAGTTTTATATGGTATGTTAACACGATTTGGAACTG
TATTGGTCAAGCGCAAAATGACTGGAATGCTTCCTCCTGTCCTTGTGCAA
TTAGAAAACCATTTCTAACAGTAATATATATTTGACCAACATAAATATAC
GTGTATATTCTCAATACAATTC
back to top

protein sequence of SMED30023063-orf-1

>SMED30023063-orf-1 ID=SMED30023063-orf-1|Name=SMED30023063-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=857bp
MPIKKFSGVDKVNEHYNSFTVRKRAYGQLDSIENSLTNNSLNESINMSIK
IQELLKFHRGIDKLYDWQIECLKIPGIGKTRNLVYSLPTSGGKTLVAEIL
MLKQLAIKQRSVIFILPYIALVQEKVRALSPFGLDLNFLVEEYAGGKGKY
PPTKHTKCASVYVATIEKAHSLINSLIETNQISKIGLLVVDELHMIGDGS
RRGANLELCLLKFMRVFGHARIVGMSATLDNLSEICQFLHAVAFDSDFRP
IELSEFVKVDKFIHRINSQLKCDTFEQKFSPERNLEPNPNKMVQKMDPDN
VIGLVSEILPDKSCIIFCPTKRQCENLANNIIKLTDPKLLIPDYKVKKRD
ELFRQIDAECLGVCPTLRQIIRMGIAYHHSGLTQEERKMVEEAFLDGTIS
VICCTSTLAAGVNLPARRVIIRAPYVGKDLIKFSQYKQMAGRAGRKGFDD
KGECFVIVDKKDRDKFGNLILEASSVCQSSILSENCRMIKYFVLSAISLE
LIKTFEDIVEFLQGSLFSIQNPGALGEILKSEVQYLIDHDLVRQVKSDSD
NEICVLKATELGRAVVRGSIDVIRVKEIYSDLKSAENSLNLATYLHMLYI
VTPHDMVASITPSWNPYAKRIGKLLASDKELLKSIGVNEDMIFMLEMGCC
QSKLKIDEYSLRRLYAALILYDLWDQKSIYEVANYYEQSSGFVQSLLHTA
VSYSACLANFVEEFRNDFWSYKELLPKLTTRLAHCVSPELIPLMEIHGVQ
KFRAAKLYKAGYDTIVKIASAESRALHEILNPISGKLVRQIISSAKMNIQ
EKLEALSEEYKELVVVRGASIATADEMDTCTHSTPMKSRNTSILDGSGLD
CFSSDE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002056medial muscle cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR001650Helicase_C
IPR014001Helicase_ATP-bd
IPR027417P-loop_NTPase
IPR011545DEAD/DEAH_box_helicase_dom
IPR011991WHTH_DNA-bd_dom
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0003676nucleic acid binding
GO:0004386helicase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.10.150.20coord: 2..55
e-value: 2.5E-7
score: 32.8