bruno-like

Overview
Namebruno-like (ABC70476.1)
Smed IDSMED30023062
Length (bp)1749
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of bruno-like (SMED30023062) t-SNE clustered cells

Violin plots show distribution of expression levels for bruno-like (SMED30023062) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of bruno-like (SMED30023062) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for bruno-like (SMED30023062) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023062

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 65

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30023062SMESG000021009.1 SmedASXL_009464SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30023062SMESG000021009.1 SmedASXL_009464SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30023062SMESG000021009.1 SmedASXL_009464SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30023062SMESG000021009.1 dd_Smed_v4_2592_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30023062SMESG000021009.1 dd_Smed_v4_2592_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30023062SMESG000021009.1 dd_Smed_v4_2592_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30023062SMESG000021009.1 dd_Smed_v4_2592_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023062SMESG000021009.1 dd_Smed_v4_2592_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023062SMESG000021009.1 dd_Smed_v4_2592_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30023062SMESG000021009.1 dd_Smed_v4_2592_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023062SMESG000021009.1 dd_Smed_v4_2592_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023062SMESG000021009.1 dd_Smed_v4_2592_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023062SMESG000081654.1 SMESG000072322.1 SMESG000063593.1 SMESG000062986.1 SMESG000060560.1 SMESG000058166.1 SMESG000057422.1 SMESG000053711.1 SMESG000052011.1 SMESG000050827.1 SMESG000037693.1 SMESG000035995.1 SMESG000024657.1 SMESG000022805.1 SMESG000021435.1 SMESG000021009.1 SMESG000021005.1 SMESG000021004.1 SMESG000016537.1 SMESG000015081.1 SMESG000011727.1 SMESG000002063.1 Contig52470uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023062SMESG000081654.1 SMESG000072322.1 SMESG000063593.1 SMESG000062986.1 SMESG000060560.1 SMESG000058166.1 SMESG000057422.1 SMESG000053711.1 SMESG000052011.1 SMESG000050827.1 SMESG000037693.1 SMESG000035995.1 SMESG000024657.1 SMESG000022805.1 SMESG000021435.1 SMESG000021009.1 SMESG000021005.1 SMESG000021004.1 SMESG000016537.1 SMESG000015081.1 SMESG000011727.1 SMESG000002063.1 Contig52470newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30023062SMESG000021009.1 DQ344977.2smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
neoblastSMED30023062SMESG000021009.1 DQ344977.2smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
neoblastSMED30023062SMESG000021009.1 DQ344977.2smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
blastomereSMED30023062SMESG000021009.1 DQ344977.2smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
blastomereSMED30023062SMESG000021009.1 DQ344977.2smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 3 fluorescence in situ hybridization evidence
blastomereSMED30023062SMESG000021009.1 DQ344977.2smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 4 fluorescence in situ hybridization evidence
blastomereSMED30023062SMESG000021009.1 DQ344977.2smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 5 fluorescence in situ hybridization evidence
blastomereSMED30023062SMESG000021009.1 DQ344977.2smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 4 colorimetric in situ hybridization evidence
blastomereSMED30023062SMESG000021009.1 DQ344977.2smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 2 colorimetric in situ hybridization evidence
blastomereSMED30023062SMESG000021009.1 DQ344977.2smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 3 colorimetric in situ hybridization evidence
embryonic pharynx neuronSMED30023062SMESG000021009.1 DQ344977.2smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 4 colorimetric in situ hybridization evidence
embryonic pharynx neuronSMED30023062SMESG000021009.1 DQ344977.2smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 3 colorimetric in situ hybridization evidence
neoblastSMED30023062SMESG000021009.1 ABC70476.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
neoblastSMED30023062SMESG000021009.1 ABC70476.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
neoblastSMED30023062SMESG000021009.1 ABC70476.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
blastomereSMED30023062SMESG000021009.1 ABC70476.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 3 fluorescence in situ hybridization evidence
blastomereSMED30023062SMESG000021009.1 ABC70476.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 3 colorimetric in situ hybridization evidence
blastomereSMED30023062SMESG000021009.1 ABC70476.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 4 colorimetric in situ hybridization evidence
blastomereSMED30023062SMESG000021009.1 ABC70476.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 2 colorimetric in situ hybridization evidence
blastomereSMED30023062SMESG000021009.1 ABC70476.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 5 fluorescence in situ hybridization evidence
blastomereSMED30023062SMESG000021009.1 ABC70476.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
blastomereSMED30023062SMESG000021009.1 ABC70476.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 4 fluorescence in situ hybridization evidence
embryonic pharynx neuronSMED30023062SMESG000021009.1 ABC70476.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 3 colorimetric in situ hybridization evidence
embryonic pharynx neuronSMED30023062SMESG000021009.1 ABC70476.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 4 colorimetric in situ hybridization evidence
X1 cellSMED30023062SMESG000021009.1 DQ344977.2smed_ncbi_20200123PMID:25017721
van Wolfswinkel et al., 2014
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30023062SMESG000021009.1 DQ344977.2smed_ncbi_20200123PMID:25017721
van Wolfswinkel et al., 2014
FACS sorted cell population asexual adult RNA-sequencing evidence
gutSMED30023062SMESG000021009.1 SMED30023062smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30023062SMESG000021009.1 SMED30023062smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30023062SMESG000021009.1 SMED30023062smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30023062SMESG000021009.1 DQ344977.2smed_ncbi_20200123PMID:29357350
de Sousa et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
X1 cellSMED30023062SMESG000021009.1 isotig00744be_Smed_v2PMID:22543868
Onal et al., 2012
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30023062SMESG000021009.1 dd_Smed_v6_2592_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30023062SMESG000021009.1 dd_Smed_v4_2592_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 1 cellSMED30023062SMESG000021009.1 H.56.5gsmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
Category 1 cellSMED30023062SMESG000021009.1 H.56.5gsmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult cDNA to DNA expression microarray evidence
cephalic gangliaSMED30023062SMESG000021009.1 DQ344977smed_ncbi_20200123PMID:16890156
Guo et al., 2006
whole organism asexual adult fluorescence in situ hybridization evidence
ventral nerve cordSMED30023062SMESG000021009.1 DQ344977smed_ncbi_20200123PMID:16890156
Guo et al., 2006
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymaSMED30023062SMESG000021009.1 DQ344977smed_ncbi_20200123PMID:16890156
Guo et al., 2006
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymaSMED30023062SMESG000021009.1 DQ344977smed_ncbi_20200123PMID:16890156
Guo et al., 2006
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30023062SMESG000021009.1 SmWIOct06_100006GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30023062SMESG000021009.1 SMED_08243_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30023062SMESG000021009.1 SMED_08243_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30023062SMESG000021009.1 SMED_35217_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30023062SMESG000021009.1 SMED_35217_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30023062SMESG000021009.1 SmWIOct06_100026GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30023062SMESG000021009.1 SmWIOct06_100004GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30023062SMESG000021009.1 SmWIOct06_026381GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30023062SMESG000021009.1 SmWIOct06_100003GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30023062SMESG000021009.1 SmWIOct06_100008GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30023062SMESG000021009.1 SmWIOct06_100007GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30023062SMESG000021009.1 SmWIOct06_100002GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of bruno-like vs. Ensembl Human
Match: CELF5 (CUGBP Elav-like family member 5 [Source:HGNC Symbol;Acc:HGNC:14058])

HSP 1 Score: 228.794 bits (582), Expect = 1.135e-67
Identity = 148/405 (36.54%), Postives = 209/405 (51.60%), Query Frame = 3
Query:   42 VASPINVDSMALYSNGFTDKGNIIIQNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGYYNQGIVPMIQFPHATDQQTANLINAYALQMHLSQMYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIP--MSPALNSY--INP---AHPQLINIANINFTPEALHLPSLYSMFPQCGFNLNTPALGLSGQ--NIYPNTTALSLQYQ-QNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            +A PI V      S G  D+            KLF+GMLNK QSE+DV +L +P+G I  C +L+   G+SKGCAFV +++  EA  AI +L+G +T    P   S +V + AD ++ER LR+MQ     + +LTP     ++    P   +  A  QQ   +++     +     +SP     +   S +  P      P++ A+ + S          P +    +P  ++P  N +  + P    HP L  +      P     P++             PA     Q   +YP      + +        ++     GPEGCNLFIYHLPQ+FGD  L Q+F PFGN+IS+KV++DRATNQSKCFGFVSFDN ++A+AAI+ MNGFQIG KRLKVQLKRPK
Sbjct:  115 MARPIQVKPADSESRGGRDR------------KLFVGMLNKQQSEEDVLRLFQPFGVIDECTVLRGPDGSSKGCAFVKFSSHTEAQAAIHALHGSQT---MPGASSSLVVKFADTDKERTLRRMQQMVGQLGILTPSLTLPFS----PYSAYAQALMQQQTTVLSTSGSYLSPGVAFSPCHIQQIGAVSLNGLP----ATPIAPASGLHSP---------PLLGTTAVPGLVAPITNGFAGVVPFPGGHPALETVYANGLVPYPAQSPTVAETL--------HPAFSGVQQYTAMYPTAAITPIAHSVPQPPPLLQQQQREGPEGCNLFIYHLPQEFGDTELTQMFLPFGNIISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK 479          

HSP 2 Score: 57.7658 bits (138), Expect = 4.036e-8
Identity = 40/117 (34.19%), Postives = 60/117 (51.28%), Query Frame = 3
Query:  138 KLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSY-GNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNE----QERQ-----LRKMQMQFPAIQLLTPQNV 458
            KLF+G + ++  E D++ L E +G I    +LKD Y G  KGCAF+TY   D A  A  +L+  KT    P +   I  + AD+E    ++R+     L K Q +   ++L  P  V
Sbjct:   46 KLFVGQIPRHLDEKDLKPLFEQFGRIYELTVLKDPYTGMHKGCAFLTYCARDSAIKAQTALHEQKT---LPGMARPIQVKPADSESRGGRDRKLFVGMLNKQQSEEDVLRLFQPFGV 159          
BLAST of bruno-like vs. Ensembl Human
Match: CELF3 (CUGBP Elav-like family member 3 [Source:HGNC Symbol;Acc:HGNC:11967])

HSP 1 Score: 224.172 bits (570), Expect = 4.985e-66
Identity = 149/389 (38.30%), Postives = 210/389 (53.98%), Query Frame = 3
Query:  117 QNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTP--QNVGYYNQGIVPMIQFPHATDQQTANLINAY-----------ALQM-HLSQMYSPNL-TPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSM--NHFVLPSINNENIPMSPALNSYINPAHPQLIN--IANINFTPEALHLPSLYSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            ++  E+ KLF+GML K Q+++DVR++ EP+G I  C +L+   G SKGCAFV +    EA  AI +L+  +T    P   S +V + AD E+ER LR+MQ     + + +P     G Y+        +  A  QQ A L+ A+           A+QM H++ + +  L   P+  SS + TP      P  AA  +S+   ++  N +          P   AL  Y N  HP       A ++   +A      Y+      ++L  PA       +         Q QQ Q+   +     GP+GCN+FIYHLPQ+F D+ + Q+F PFG+VISAKV++DRATNQSKCFGFVSFDN ++A+AAI+ MNGFQIG KRLKVQLKRPK
Sbjct:   89 ESRGEDRKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRT---LPGASSSLVVKFADTEKERGLRRMQQVATQLGMFSPIALQFGAYSA-------YTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAINANGLIATPITPSSGTSTP------PAIAATPVSAIPAALGVNGYSPVPTQPTGQPAPDAL--YPNGVHPYPAQSPAAPVDPLQQAYAGMQHYTAAYPAAYSLVAPAFPQPPALVAQQPPPPPQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK 459          

HSP 2 Score: 58.9214 bits (141), Expect = 1.698e-8
Identity = 33/93 (35.48%), Postives = 51/93 (54.84%), Query Frame = 3
Query:  138 KLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSY-GNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKM 413
            KLF+G + ++  E D++ + E +G I    ++KD Y G  KGCAF+TY   D A  A  +L+  KT    P +   I  + AD+E   + RK+
Sbjct:    8 KLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHEQKT---LPGMNRPIQVKPADSESRGEDRKL 97          
BLAST of bruno-like vs. Ensembl Human
Match: CELF3 (CUGBP Elav-like family member 3 [Source:HGNC Symbol;Acc:HGNC:11967])

HSP 1 Score: 221.861 bits (564), Expect = 3.997e-65
Identity = 148/384 (38.54%), Postives = 207/384 (53.91%), Query Frame = 3
Query:  132 NTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTP--QNVGYYNQGIVPMIQFPHATDQQTANLINAY-----------ALQM-HLSQMYSPNL-TPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSM--NHFVLPSINNENIPMSPALNSYINPAHPQLIN--IANINFTPEALHLPSLYSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            + KLF+GML K Q+++DVR++ EP+G I  C +L+   G SKGCAFV +    EA  AI +L+  +T    P   S +V + AD E+ER LR+MQ     + + +P     G Y+        +  A  QQ A L+ A+           A+QM H++ + +  L   P+  SS + TP      P  AA  +S+   ++  N +          P   AL  Y N  HP       A ++   +A      Y+      ++L  PA       +         Q QQ Q+   +     GP+GCN+FIYHLPQ+F D+ + Q+F PFG+VISAKV++DRATNQSKCFGFVSFDN ++A+AAI+ MNGFQIG KRLKVQLKRPK
Sbjct:   95 DRKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRT---LPGASSSLVVKFADTEKERGLRRMQQVATQLGMFSPIALQFGAYSA-------YTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAINANGLIATPITPSSGTSTP------PAIAATPVSAIPAALGVNGYSPVPTQPTGQPAPDAL--YPNGVHPYPAQSPAAPVDPLQQAYAGMQHYTAAYPAAYSLVAPAFPQPPALVAQQPPPPPQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK 460          
BLAST of bruno-like vs. Ensembl Human
Match: CELF3 (CUGBP Elav-like family member 3 [Source:HGNC Symbol;Acc:HGNC:11967])

HSP 1 Score: 219.935 bits (559), Expect = 5.843e-65
Identity = 143/376 (38.03%), Postives = 196/376 (52.13%), Query Frame = 3
Query:  117 QNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTP--QNVGYYNQGIVPMIQFPHATDQQTANLINAYALQMHLSQMYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIPMSPALNSYINPAHPQLINIANINFTPEALHLPSLYSM----FPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            ++  E+ KLF+GML K Q+++DVR++ EP+G I  C +L+   G SKGCAFV +    EA  AI +L+  +T    P   S +V + AD E+ER LR+MQ     + + +P     G Y+        +  A  QQ A L+ A++  +                 SP  T      V M     I++N          S  +   P+ P   +Y    H          +T      P+ YS+    FPQ       PAL      +         Q QQ Q+   +     GP+GCN+FIYHLPQ+F D+ + Q+F PFG+VISAKV++DRATNQSKCFGFVSFDN ++A+AAI+ MNGFQIG KRLKVQLKRPK
Sbjct:   89 ESRGEDRKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRT---LPGASSSLVVKFADTEKERGLRRMQQVATQLGMFSPIALQFGAYSA-------YTQALMQQQAALVAAHSAYL-----------------SPMAT---MAAVQMQHMAAINANGLIATPITPSSAQSPAAPVDPLQQAYAGMQH----------YTAA---YPAAYSLVAPAFPQ------PPAL------VAQQPPPPPQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK 409          

HSP 2 Score: 57.7658 bits (138), Expect = 3.179e-8
Identity = 33/93 (35.48%), Postives = 51/93 (54.84%), Query Frame = 3
Query:  138 KLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSY-GNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKM 413
            KLF+G + ++  E D++ + E +G I    ++KD Y G  KGCAF+TY   D A  A  +L+  KT    P +   I  + AD+E   + RK+
Sbjct:    8 KLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHEQKT---LPGMNRPIQVKPADSESRGEDRKL 97          
BLAST of bruno-like vs. Ensembl Human
Match: CELF6 (CUGBP Elav-like family member 6 [Source:HGNC Symbol;Acc:HGNC:14059])

HSP 1 Score: 149.443 bits (376), Expect = 1.334e-39
Identity = 73/110 (66.36%), Postives = 85/110 (77.27%), Query Frame = 3
Query:  900 YPNTTA-LSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            YP+  A +S  + Q Q   +      GPEGCNLFIYHLPQ+FGDA L Q F PFG V+SAKV++DRATNQSKCFGFVSFDN ++A+ AI+ MNGFQIG KRLKVQLKRPK
Sbjct:  230 YPSAYAPVSTAFPQ-QPSALPQQQREGPEGCNLFIYHLPQEFGDAELIQTFLPFGAVVSAKVFVDRATNQSKCFGFVSFDNPTSAQTAIQAMNGFQIGMKRLKVQLKRPK 338          

HSP 2 Score: 102.449 bits (254), Expect = 4.243e-23
Identity = 45/100 (45.00%), Postives = 64/100 (64.00%), Query Frame = 3
Query:  117 QNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQ 416
            +   E+ KLF+GML K Q E+DVR+L +P+G I+ C +L+   G SKGCAFV + +  EA  AI  L+G +T        S +V +LAD ++ER LR+MQ
Sbjct:   13 EGRGEDRKLFVGMLGKQQGEEDVRRLFQPFGHIEECTVLRSPDGTSKGCAFVKFGSQGEAQAAIRGLHGSRTMAGA---SSSLVVKLADTDRERALRRMQ 109          
BLAST of bruno-like vs. Ensembl Celegans
Match: etr-1 (ELAV-Type RNA binding-protein family [Source:UniProtKB/TrEMBL;Acc:A0A0K3AR37])

HSP 1 Score: 177.178 bits (448), Expect = 8.570e-50
Identity = 129/394 (32.74%), Postives = 192/394 (48.73%), Query Frame = 3
Query:  117 QNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGYYNQGIVPMIQ-FPHATDQQTANLINAYALQMHLSQMYSPNLTPPLVNSSPSV-----TPQPQIGVPMSAAND----ISSNQCSMNHFVLP-----------SINNENIPMSPALNSYINPAHPQLINIANINFTPEALHLPSL--YSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPKG 1229
            +N +E  KLFIG L+K  +E+++R++   +G I++C +L+D  G S+GCAFVT+ N   A +A + ++  +T   C    + +V + AD ++++ ++   M       +T    G    G   ++Q    A  QQ     N  A+   LS +              +V     T  P +G P  AA +    I+  Q +    +L            S   + +    A     +P    L N   I  TP A    +L  +    Q     N  A G  G  +   T+A  +         + +  V GP+G NLFIYHLPQDFGD+ L   F PFG ++SAKV++D+ TN SKCFGFVS++NA +A  AI  MNGFQIG+KRLKVQLK  +G
Sbjct:   13 ENRNER-KLFIGQLSKKHNEENLREIFAKFGHIEDCSVLRDQDGKSRGCAFVTFTNRSCAVVATKEMHHSQTMEGCS---APLVVKFADTQKDKDVKTKSM-------ITGSGAGSPKGGAASLLQNLNPALLQQLGGGQNYQAVASLLSLINGQQGQQQQHQQQQNVLGILGTGNPLLGNPAMAAQNQFDAITMAQIAHQQQMLALQGFAVQQGAPSQQQQGLAGGMAGAKTTSPVAASLANHQQIALTPFAGGAAALDHFQAMQQYALLANLQATG--GVGVQATTSAAQM---------VGNGDVKGPDGANLFIYHLPQDFGDSDLINTFAPFGGILSAKVFIDKVTNLSKCFGFVSYENAQSATNAISAMNGFQIGSKRLKVQLKVDRG 384          
BLAST of bruno-like vs. Ensembl Celegans
Match: etr-1 (ELAV-Type RNA binding-protein family [Source:UniProtKB/TrEMBL;Acc:A0A0K3AR37])

HSP 1 Score: 177.178 bits (448), Expect = 8.570e-50
Identity = 129/394 (32.74%), Postives = 192/394 (48.73%), Query Frame = 3
Query:  117 QNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGYYNQGIVPMIQ-FPHATDQQTANLINAYALQMHLSQMYSPNLTPPLVNSSPSV-----TPQPQIGVPMSAAND----ISSNQCSMNHFVLP-----------SINNENIPMSPALNSYINPAHPQLINIANINFTPEALHLPSL--YSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPKG 1229
            +N +E  KLFIG L+K  +E+++R++   +G I++C +L+D  G S+GCAFVT+ N   A +A + ++  +T   C    + +V + AD ++++ ++   M       +T    G    G   ++Q    A  QQ     N  A+   LS +              +V     T  P +G P  AA +    I+  Q +    +L            S   + +    A     +P    L N   I  TP A    +L  +    Q     N  A G  G  +   T+A  +         + +  V GP+G NLFIYHLPQDFGD+ L   F PFG ++SAKV++D+ TN SKCFGFVS++NA +A  AI  MNGFQIG+KRLKVQLK  +G
Sbjct:   13 ENRNER-KLFIGQLSKKHNEENLREIFAKFGHIEDCSVLRDQDGKSRGCAFVTFTNRSCAVVATKEMHHSQTMEGCS---APLVVKFADTQKDKDVKTKSM-------ITGSGAGSPKGGAASLLQNLNPALLQQLGGGQNYQAVASLLSLINGQQGQQQQHQQQQNVLGILGTGNPLLGNPAMAAQNQFDAITMAQIAHQQQMLALQGFAVQQGAPSQQQQGLAGGMAGAKTTSPVAASLANHQQIALTPFAGGAAALDHFQAMQQYALLANLQATG--GVGVQATTSAAQM---------VGNGDVKGPDGANLFIYHLPQDFGDSDLINTFAPFGGILSAKVFIDKVTNLSKCFGFVSYENAQSATNAISAMNGFQIGSKRLKVQLKVDRG 384          
BLAST of bruno-like vs. Ensembl Celegans
Match: etr-1 (ELAV-Type RNA binding-protein family [Source:UniProtKB/TrEMBL;Acc:A0A0K3AR37])

HSP 1 Score: 177.178 bits (448), Expect = 8.570e-50
Identity = 129/394 (32.74%), Postives = 192/394 (48.73%), Query Frame = 3
Query:  117 QNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGYYNQGIVPMIQ-FPHATDQQTANLINAYALQMHLSQMYSPNLTPPLVNSSPSV-----TPQPQIGVPMSAAND----ISSNQCSMNHFVLP-----------SINNENIPMSPALNSYINPAHPQLINIANINFTPEALHLPSL--YSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPKG 1229
            +N +E  KLFIG L+K  +E+++R++   +G I++C +L+D  G S+GCAFVT+ N   A +A + ++  +T   C    + +V + AD ++++ ++   M       +T    G    G   ++Q    A  QQ     N  A+   LS +              +V     T  P +G P  AA +    I+  Q +    +L            S   + +    A     +P    L N   I  TP A    +L  +    Q     N  A G  G  +   T+A  +         + +  V GP+G NLFIYHLPQDFGD+ L   F PFG ++SAKV++D+ TN SKCFGFVS++NA +A  AI  MNGFQIG+KRLKVQLK  +G
Sbjct:   13 ENRNER-KLFIGQLSKKHNEENLREIFAKFGHIEDCSVLRDQDGKSRGCAFVTFTNRSCAVVATKEMHHSQTMEGCS---APLVVKFADTQKDKDVKTKSM-------ITGSGAGSPKGGAASLLQNLNPALLQQLGGGQNYQAVASLLSLINGQQGQQQQHQQQQNVLGILGTGNPLLGNPAMAAQNQFDAITMAQIAHQQQMLALQGFAVQQGAPSQQQQGLAGGMAGAKTTSPVAASLANHQQIALTPFAGGAAALDHFQAMQQYALLANLQATG--GVGVQATTSAAQM---------VGNGDVKGPDGANLFIYHLPQDFGDSDLINTFAPFGGILSAKVFIDKVTNLSKCFGFVSYENAQSATNAISAMNGFQIGSKRLKVQLKVDRG 384          
BLAST of bruno-like vs. Ensembl Celegans
Match: etr-1 (ELAV-Type RNA binding-protein family [Source:UniProtKB/TrEMBL;Acc:A0A0K3AR37])

HSP 1 Score: 177.178 bits (448), Expect = 8.570e-50
Identity = 129/394 (32.74%), Postives = 192/394 (48.73%), Query Frame = 3
Query:  117 QNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGYYNQGIVPMIQ-FPHATDQQTANLINAYALQMHLSQMYSPNLTPPLVNSSPSV-----TPQPQIGVPMSAAND----ISSNQCSMNHFVLP-----------SINNENIPMSPALNSYINPAHPQLINIANINFTPEALHLPSL--YSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPKG 1229
            +N +E  KLFIG L+K  +E+++R++   +G I++C +L+D  G S+GCAFVT+ N   A +A + ++  +T   C    + +V + AD ++++ ++   M       +T    G    G   ++Q    A  QQ     N  A+   LS +              +V     T  P +G P  AA +    I+  Q +    +L            S   + +    A     +P    L N   I  TP A    +L  +    Q     N  A G  G  +   T+A  +         + +  V GP+G NLFIYHLPQDFGD+ L   F PFG ++SAKV++D+ TN SKCFGFVS++NA +A  AI  MNGFQIG+KRLKVQLK  +G
Sbjct:   13 ENRNER-KLFIGQLSKKHNEENLREIFAKFGHIEDCSVLRDQDGKSRGCAFVTFTNRSCAVVATKEMHHSQTMEGCS---APLVVKFADTQKDKDVKTKSM-------ITGSGAGSPKGGAASLLQNLNPALLQQLGGGQNYQAVASLLSLINGQQGQQQQHQQQQNVLGILGTGNPLLGNPAMAAQNQFDAITMAQIAHQQQMLALQGFAVQQGAPSQQQQGLAGGMAGAKTTSPVAASLANHQQIALTPFAGGAAALDHFQAMQQYALLANLQATG--GVGVQATTSAAQM---------VGNGDVKGPDGANLFIYHLPQDFGDSDLINTFAPFGGILSAKVFIDKVTNLSKCFGFVSYENAQSATNAISAMNGFQIGSKRLKVQLKVDRG 384          
BLAST of bruno-like vs. Ensembl Celegans
Match: etr-1 (ELAV-Type RNA binding-protein family [Source:UniProtKB/TrEMBL;Acc:A0A0K3AR37])

HSP 1 Score: 176.022 bits (445), Expect = 3.579e-48
Identity = 129/394 (32.74%), Postives = 192/394 (48.73%), Query Frame = 3
Query:  117 QNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGYYNQGIVPMIQ-FPHATDQQTANLINAYALQMHLSQMYSPNLTPPLVNSSPSV-----TPQPQIGVPMSAAND----ISSNQCSMNHFVLP-----------SINNENIPMSPALNSYINPAHPQLINIANINFTPEALHLPSL--YSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPKG 1229
            +N +E  KLFIG L+K  +E+++R++   +G I++C +L+D  G S+GCAFVT+ N   A +A + ++  +T   C    + +V + AD ++++ ++   M       +T    G    G   ++Q    A  QQ     N  A+   LS +              +V     T  P +G P  AA +    I+  Q +    +L            S   + +    A     +P    L N   I  TP A    +L  +    Q     N  A G  G  +   T+A  +         + +  V GP+G NLFIYHLPQDFGD+ L   F PFG ++SAKV++D+ TN SKCFGFVS++NA +A  AI  MNGFQIG+KRLKVQLK  +G
Sbjct:  137 ENRNER-KLFIGQLSKKHNEENLREIFAKFGHIEDCSVLRDQDGKSRGCAFVTFTNRSCAVVATKEMHHSQTMEGCS---APLVVKFADTQKDKDVKTKSM-------ITGSGAGSPKGGAASLLQNLNPALLQQLGGGQNYQAVASLLSLINGQQGQQQQHQQQQNVLGILGTGNPLLGNPAMAAQNQFDAITMAQIAHQQQMLALQGFAVQQGAPSQQQQGLAGGMAGAKTTSPVAASLANHQQIALTPFAGGAAALDHFQAMQQYALLANLQATG--GVGVQATTSAAQM---------VGNGDVKGPDGANLFIYHLPQDFGDSDLINTFAPFGGILSAKVFIDKVTNLSKCFGFVSYENAQSATNAISAMNGFQIGSKRLKVQLKVDRG 508          

HSP 2 Score: 51.2174 bits (121), Expect = 1.430e-6
Identity = 26/66 (39.39%), Postives = 41/66 (62.12%), Query Frame = 3
Query:  138 KLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKD-SYGNSKGCAFVTYNNSDEANMAIESLNGMKT 332
            K+F+G + +  +E D R+L E YG + +C IL+D S   SKGC FVT+ +  +A  A  +L+ +K 
Sbjct:   56 KMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYHRKDAIEAQGALHNIKV 121          
BLAST of bruno-like vs. Ensembl Fly
Match: bru1 (gene:FBgn0000114 transcript:FBtr0331646)

HSP 1 Score: 194.126 bits (492), Expect = 3.407e-54
Identity = 145/394 (36.80%), Postives = 207/394 (52.54%), Query Frame = 3
Query:  117 QNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIE-SLNGMKTSMACPELGSCIVARLADNEQERQLRKM-QMQFPAIQLLTPQNV--GYYNQGIVPMIQFPHATDQQT----ANLINAYALQMHLSQMYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISS-------------NQCSMNHFVLPSINNENIPMSPALNSYINPAHPQLINIANINFT---PEALHLPSLYSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            +N +E  KLF+GMLNK  +E+DVR+L E +G I+ C +L+D  G SKGCAFVT+     A  AI+ +L+  K    C    S +V + AD ++E++ +K+ Q+Q     L +  N+  G     +   I  P+   Q +    A+ I   ++Q+ L Q+ +  L   L+ +   +  Q       S+A D S+             N  ++     PS++N       A  +  +P   QL N A + ++   P A    S  +  PQ G      A  LS       T+ L+               + GPEGCNLFIYHLPQ+F D  LA  F PFGNVISAKV++D+ T+ SKCFGFVSFDN  +A+ AI+ MNGFQ+GTKRLKVQLK+PK
Sbjct:  202 ENRNER-KLFVGMLNKKLNENDVRKLFEVHGAIEECTVLRDQNGQSKGCAFVTFATKHAAISAIKVTLSQNKIMEGCT---SPLVVKFADTQKEKEQKKIQQIQANLWNLASNINIPLGQTATSVTTPI-LPNPPQQPSPVLGADAITPASIQL-LQQLQAVGLQHQLLQALTGLGAQQS-----SSATDTSAVAAAGLLTPMTVQNLAAIAAMTQPSLSNAAA----AAAAATSPGSAQLTNTAALLWSDPNPMASAYMSTAAGLPQFG-----SASALS-------TSPLASVALSAAAAAAAGKQIEGPEGCNLFIYHLPQEFTDTDLASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPDSAQVAIKAMNGFQVGTKRLKVQLKKPK 568          

HSP 2 Score: 52.7582 bits (125), Expect = 6.490e-7
Identity = 25/69 (36.23%), Postives = 43/69 (62.32%), Query Frame = 3
Query:  129 ENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKD-SYGNSKGCAFVTYNNSDEANMAIESLNGMKT 332
            +N K+F+G + K+  E  +R++ E YG + +  +L+D + G SKGC FVT+     A  A ++L+ +KT
Sbjct:  118 DNIKMFVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFVTFYTRHAALKAQDALHNVKT 186          
BLAST of bruno-like vs. Ensembl Fly
Match: bru1 (gene:FBgn0000114 transcript:FBtr0331998)

HSP 1 Score: 194.126 bits (492), Expect = 3.407e-54
Identity = 145/394 (36.80%), Postives = 207/394 (52.54%), Query Frame = 3
Query:  117 QNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIE-SLNGMKTSMACPELGSCIVARLADNEQERQLRKM-QMQFPAIQLLTPQNV--GYYNQGIVPMIQFPHATDQQT----ANLINAYALQMHLSQMYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISS-------------NQCSMNHFVLPSINNENIPMSPALNSYINPAHPQLINIANINFT---PEALHLPSLYSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            +N +E  KLF+GMLNK  +E+DVR+L E +G I+ C +L+D  G SKGCAFVT+     A  AI+ +L+  K    C    S +V + AD ++E++ +K+ Q+Q     L +  N+  G     +   I  P+   Q +    A+ I   ++Q+ L Q+ +  L   L+ +   +  Q       S+A D S+             N  ++     PS++N       A  +  +P   QL N A + ++   P A    S  +  PQ G      A  LS       T+ L+               + GPEGCNLFIYHLPQ+F D  LA  F PFGNVISAKV++D+ T+ SKCFGFVSFDN  +A+ AI+ MNGFQ+GTKRLKVQLK+PK
Sbjct:  202 ENRNER-KLFVGMLNKKLNENDVRKLFEVHGAIEECTVLRDQNGQSKGCAFVTFATKHAAISAIKVTLSQNKIMEGCT---SPLVVKFADTQKEKEQKKIQQIQANLWNLASNINIPLGQTATSVTTPI-LPNPPQQPSPVLGADAITPASIQL-LQQLQAVGLQHQLLQALTGLGAQQS-----SSATDTSAVAAAGLLTPMTVQNLAAIAAMTQPSLSNAAA----AAAAATSPGSAQLTNTAALLWSDPNPMASAYMSTAAGLPQFG-----SASALS-------TSPLASVALSAAAAAAAGKQIEGPEGCNLFIYHLPQEFTDTDLASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPDSAQVAIKAMNGFQVGTKRLKVQLKKPK 568          

HSP 2 Score: 52.7582 bits (125), Expect = 6.490e-7
Identity = 25/69 (36.23%), Postives = 43/69 (62.32%), Query Frame = 3
Query:  129 ENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKD-SYGNSKGCAFVTYNNSDEANMAIESLNGMKT 332
            +N K+F+G + K+  E  +R++ E YG + +  +L+D + G SKGC FVT+     A  A ++L+ +KT
Sbjct:  118 DNIKMFVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFVTFYTRHAALKAQDALHNVKT 186          
BLAST of bruno-like vs. Ensembl Fly
Match: bru1 (gene:FBgn0000114 transcript:FBtr0331648)

HSP 1 Score: 194.126 bits (492), Expect = 3.407e-54
Identity = 145/394 (36.80%), Postives = 207/394 (52.54%), Query Frame = 3
Query:  117 QNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIE-SLNGMKTSMACPELGSCIVARLADNEQERQLRKM-QMQFPAIQLLTPQNV--GYYNQGIVPMIQFPHATDQQT----ANLINAYALQMHLSQMYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISS-------------NQCSMNHFVLPSINNENIPMSPALNSYINPAHPQLINIANINFT---PEALHLPSLYSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            +N +E  KLF+GMLNK  +E+DVR+L E +G I+ C +L+D  G SKGCAFVT+     A  AI+ +L+  K    C    S +V + AD ++E++ +K+ Q+Q     L +  N+  G     +   I  P+   Q +    A+ I   ++Q+ L Q+ +  L   L+ +   +  Q       S+A D S+             N  ++     PS++N       A  +  +P   QL N A + ++   P A    S  +  PQ G      A  LS       T+ L+               + GPEGCNLFIYHLPQ+F D  LA  F PFGNVISAKV++D+ T+ SKCFGFVSFDN  +A+ AI+ MNGFQ+GTKRLKVQLK+PK
Sbjct:  202 ENRNER-KLFVGMLNKKLNENDVRKLFEVHGAIEECTVLRDQNGQSKGCAFVTFATKHAAISAIKVTLSQNKIMEGCT---SPLVVKFADTQKEKEQKKIQQIQANLWNLASNINIPLGQTATSVTTPI-LPNPPQQPSPVLGADAITPASIQL-LQQLQAVGLQHQLLQALTGLGAQQS-----SSATDTSAVAAAGLLTPMTVQNLAAIAAMTQPSLSNAAA----AAAAATSPGSAQLTNTAALLWSDPNPMASAYMSTAAGLPQFG-----SASALS-------TSPLASVALSAAAAAAAGKQIEGPEGCNLFIYHLPQEFTDTDLASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPDSAQVAIKAMNGFQVGTKRLKVQLKKPK 568          

HSP 2 Score: 52.7582 bits (125), Expect = 6.490e-7
Identity = 25/69 (36.23%), Postives = 43/69 (62.32%), Query Frame = 3
Query:  129 ENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKD-SYGNSKGCAFVTYNNSDEANMAIESLNGMKT 332
            +N K+F+G + K+  E  +R++ E YG + +  +L+D + G SKGC FVT+     A  A ++L+ +KT
Sbjct:  118 DNIKMFVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFVTFYTRHAALKAQDALHNVKT 186          
BLAST of bruno-like vs. Ensembl Fly
Match: bru1 (gene:FBgn0000114 transcript:FBtr0331647)

HSP 1 Score: 194.126 bits (492), Expect = 3.407e-54
Identity = 145/394 (36.80%), Postives = 207/394 (52.54%), Query Frame = 3
Query:  117 QNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIE-SLNGMKTSMACPELGSCIVARLADNEQERQLRKM-QMQFPAIQLLTPQNV--GYYNQGIVPMIQFPHATDQQT----ANLINAYALQMHLSQMYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISS-------------NQCSMNHFVLPSINNENIPMSPALNSYINPAHPQLINIANINFT---PEALHLPSLYSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            +N +E  KLF+GMLNK  +E+DVR+L E +G I+ C +L+D  G SKGCAFVT+     A  AI+ +L+  K    C    S +V + AD ++E++ +K+ Q+Q     L +  N+  G     +   I  P+   Q +    A+ I   ++Q+ L Q+ +  L   L+ +   +  Q       S+A D S+             N  ++     PS++N       A  +  +P   QL N A + ++   P A    S  +  PQ G      A  LS       T+ L+               + GPEGCNLFIYHLPQ+F D  LA  F PFGNVISAKV++D+ T+ SKCFGFVSFDN  +A+ AI+ MNGFQ+GTKRLKVQLK+PK
Sbjct:  202 ENRNER-KLFVGMLNKKLNENDVRKLFEVHGAIEECTVLRDQNGQSKGCAFVTFATKHAAISAIKVTLSQNKIMEGCT---SPLVVKFADTQKEKEQKKIQQIQANLWNLASNINIPLGQTATSVTTPI-LPNPPQQPSPVLGADAITPASIQL-LQQLQAVGLQHQLLQALTGLGAQQS-----SSATDTSAVAAAGLLTPMTVQNLAAIAAMTQPSLSNAAA----AAAAATSPGSAQLTNTAALLWSDPNPMASAYMSTAAGLPQFG-----SASALS-------TSPLASVALSAAAAAAAGKQIEGPEGCNLFIYHLPQEFTDTDLASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPDSAQVAIKAMNGFQVGTKRLKVQLKKPK 568          

HSP 2 Score: 52.7582 bits (125), Expect = 6.490e-7
Identity = 25/69 (36.23%), Postives = 43/69 (62.32%), Query Frame = 3
Query:  129 ENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKD-SYGNSKGCAFVTYNNSDEANMAIESLNGMKT 332
            +N K+F+G + K+  E  +R++ E YG + +  +L+D + G SKGC FVT+     A  A ++L+ +KT
Sbjct:  118 DNIKMFVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFVTFYTRHAALKAQDALHNVKT 186          
BLAST of bruno-like vs. Ensembl Fly
Match: bru1 (gene:FBgn0000114 transcript:FBtr0080345)

HSP 1 Score: 194.126 bits (492), Expect = 5.634e-54
Identity = 145/394 (36.80%), Postives = 207/394 (52.54%), Query Frame = 3
Query:  117 QNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIE-SLNGMKTSMACPELGSCIVARLADNEQERQLRKM-QMQFPAIQLLTPQNV--GYYNQGIVPMIQFPHATDQQT----ANLINAYALQMHLSQMYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISS-------------NQCSMNHFVLPSINNENIPMSPALNSYINPAHPQLINIANINFT---PEALHLPSLYSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            +N +E  KLF+GMLNK  +E+DVR+L E +G I+ C +L+D  G SKGCAFVT+     A  AI+ +L+  K    C    S +V + AD ++E++ +K+ Q+Q     L +  N+  G     +   I  P+   Q +    A+ I   ++Q+ L Q+ +  L   L+ +   +  Q       S+A D S+             N  ++     PS++N       A  +  +P   QL N A + ++   P A    S  +  PQ G      A  LS       T+ L+               + GPEGCNLFIYHLPQ+F D  LA  F PFGNVISAKV++D+ T+ SKCFGFVSFDN  +A+ AI+ MNGFQ+GTKRLKVQLK+PK
Sbjct:  233 ENRNER-KLFVGMLNKKLNENDVRKLFEVHGAIEECTVLRDQNGQSKGCAFVTFATKHAAISAIKVTLSQNKIMEGCT---SPLVVKFADTQKEKEQKKIQQIQANLWNLASNINIPLGQTATSVTTPI-LPNPPQQPSPVLGADAITPASIQL-LQQLQAVGLQHQLLQALTGLGAQQS-----SSATDTSAVAAAGLLTPMTVQNLAAIAAMTQPSLSNAAA----AAAAATSPGSAQLTNTAALLWSDPNPMASAYMSTAAGLPQFG-----SASALS-------TSPLASVALSAAAAAAAGKQIEGPEGCNLFIYHLPQEFTDTDLASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPDSAQVAIKAMNGFQVGTKRLKVQLKKPK 599          

HSP 2 Score: 52.7582 bits (125), Expect = 6.554e-7
Identity = 25/69 (36.23%), Postives = 43/69 (62.32%), Query Frame = 3
Query:  129 ENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKD-SYGNSKGCAFVTYNNSDEANMAIESLNGMKT 332
            +N K+F+G + K+  E  +R++ E YG + +  +L+D + G SKGC FVT+     A  A ++L+ +KT
Sbjct:  149 DNIKMFVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFVTFYTRHAALKAQDALHNVKT 217          
BLAST of bruno-like vs. Ensembl Zebrafish
Match: celf5a (cugbp, Elav-like family member 5a [Source:ZFIN;Acc:ZDB-GENE-050208-746])

HSP 1 Score: 236.884 bits (603), Expect = 2.067e-70
Identity = 161/397 (40.55%), Postives = 213/397 (53.65%), Query Frame = 3
Query:  117 QNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGYYNQGIV-PMIQFP--------HATDQQTANLINAY------------ALQMHLSQMYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIPMSPALNSYINPAHPQLINIANINFTPEALH---LPSLYSMFPQCGFNLNTPALGLSGQN-IYPNTT--ALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            ++  E+ KLF+GMLNK Q+E+DV +L EPYG I+ C +L+   GNSKGCAFV ++   EA  AI +L+G +T    P   S +V + AD ++ER +R+MQ           Q VG +  GI  P I  P        HA  QQ A L+ A               Q+H  QM + N     +NS P     P  G        +SS   ++    +PSI      ++P +N + +  H       N +   EA++   LP   +  P     L     G+     IYP TT   +     Q  +   +     GPEGCNLFIYHLPQ+FGD  L Q+F PFG VIS+KV++DRATNQSKCFGFVSFDN ++A+AAI+ MNGFQIG KRLKVQLKRPK
Sbjct:  160 ESRGEDRKLFVGMLNKQQTEEDVYRLFEPYGVIEECTVLRGPDGNSKGCAFVKFSTHAEAQSAISALHGSQT---MPGASSSLVVKFADTDKERTIRRMQ-----------QMVGQF--GIFNPAIALPFSTYSTYAHALMQQQAALMAASHGGYLAPSVAFPTTQIH--QMGALN-----INSLPPTPMTPVSGEFHQTLAGLSSPPANITTSAVPSI------VTPIVNGFTSIPH-----QPNGHPAVEAVYTNGLPPYSTQSPTAADTLQQAFTGVQQYTAIYPATTLTPIGQSLPQPPQVIQQQQQREGPEGCNLFIYHLPQEFGDNELMQMFLPFGTVISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK 522          

HSP 2 Score: 62.7734 bits (151), Expect = 6.981e-10
Identity = 41/113 (36.28%), Postives = 57/113 (50.44%), Query Frame = 3
Query:  102 GNIIIQNHDEN--------TKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSY-GNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKM 413
            G+  I  H EN         KLFIG + +N  E D++ L E +G I    +LKD Y G  KGCAF+TY   + A  A  +L+  KT    P +   I  + AD+E   + RK+
Sbjct:   59 GSESISIHPENGTMKDQDAIKLFIGQIPRNLEEKDLKPLFEQFGKIHELTVLKDRYTGMHKGCAFLTYCARESAIKAQNALHEQKT---LPGMTRPIQVKPADSESRGEDRKL 168          
BLAST of bruno-like vs. Ensembl Zebrafish
Match: celf5a (cugbp, Elav-like family member 5a [Source:ZFIN;Acc:ZDB-GENE-050208-746])

HSP 1 Score: 235.728 bits (600), Expect = 3.232e-70
Identity = 160/392 (40.82%), Postives = 212/392 (54.08%), Query Frame = 3
Query:  132 NTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGYYNQGIV-PMIQFP--------HATDQQTANLINAY------------ALQMHLSQMYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIPMSPALNSYINPAHPQLINIANINFTPEALH---LPSLYSMFPQCGFNLNTPALGLSGQN-IYPNTT--ALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            + KLF+GMLNK Q+E+DV +L EPYG I+ C +L+   GNSKGCAFV ++   EA  AI +L+G +T    P   S +V + AD ++ER +R+MQ           Q VG +  GI  P I  P        HA  QQ A L+ A               Q+H  QM + N     +NS P          PM+  + +SS   ++    +PSI      ++P +N + +  H       N +   EA++   LP   +  P     L     G+     IYP TT   +     Q  +   +     GPEGCNLFIYHLPQ+FGD  L Q+F PFG VIS+KV++DRATNQSKCFGFVSFDN ++A+AAI+ MNGFQIG KRLKVQLKRPK
Sbjct:  152 DRKLFVGMLNKQQTEEDVYRLFEPYGVIEECTVLRGPDGNSKGCAFVKFSTHAEAQSAISALHGSQT---MPGASSSLVVKFADTDKERTIRRMQ-----------QMVGQF--GIFNPAIALPFSTYSTYAHALMQQQAALMAASHGGYLAPSVAFPTTQIH--QMGALN-----INSLPPT--------PMTPVSGLSSPPANITTSAVPSI------VTPIVNGFTSIPH-----QPNGHPAVEAVYTNGLPPYSTQSPTAADTLQQAFTGVQQYTAIYPATTLTPIGQSLPQPPQVIQQQQQREGPEGCNLFIYHLPQEFGDNELMQMFLPFGTVISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK 501          

HSP 2 Score: 60.077 bits (144), Expect = 4.698e-9
Identity = 42/113 (37.17%), Postives = 57/113 (50.44%), Query Frame = 3
Query:  102 GNIIIQNHDEN--------TKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSY-GNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKM 413
            G+  I  H EN         KLFIG + +N  E D++ L E +G I    +LKD Y G  KGCAF+TY   + A  A  +L+  KT    P +   I  + AD+E  R  RK+
Sbjct:   47 GSESISIHPENGTMKDQDAIKLFIGQIPRNLEEKDLKPLFEQFGKIHELTVLKDRYTGMHKGCAFLTYCARESAIKAQNALHEQKT---LPGMTRPIQVKPADSE-SRGDRKL 155          
BLAST of bruno-like vs. Ensembl Zebrafish
Match: celf3b (cugbp, Elav-like family member 3b [Source:ZFIN;Acc:ZDB-GENE-110408-50])

HSP 1 Score: 228.024 bits (580), Expect = 4.345e-69
Identity = 148/375 (39.47%), Postives = 195/375 (52.00%), Query Frame = 3
Query:  129 ENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGYYNQGIVPMIQFPHATDQQTANLINAYALQMHLSQMYSPN--------LTPPL-VNSSPSVTPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIPMSPALNSYINPAHPQLINIANINFTPEALHLPSLYSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            E+ KLF+GML K QS++DVR++ EP+G I  C +L+   G SKGCAFV + +  EA  AI SL+G +T    P   S +V + AD E+ER +R+MQ     + + TP  + +                   A  ++  A  M + QM + N        +TPP   N+ P++   P   +P   A +  S+        LP   N      PA   Y N  HP           P    L   Y+          T A GL         T +S Q  Q +          GPEGCN+FIYHLPQ+F D+ + Q+F PFGNVISAKV++DRATNQSKCFGFVSFDN ++A+ AI+ MNGFQIG KRLKVQLKRPK
Sbjct:    2 EDRKLFVGMLGKQQSDEDVRKIFEPFGGIDECTVLRGPDGTSKGCAFVKFQSHSEAQSAINSLHGSRT---LPGASSSLVVKFADTEKERGVRRMQQVTSQLGVYTPVTLNFNAYNAYTQALVQQQALVAQAQYLSP-AASMQIQQMAALNASGIIATPITPPSGANTPPTLAATPVSALPQPIAVNGYSH--------LPPTTNGQ----PASEIYTNGLHPYQAQSPVAALDP----LQQAYAGMQHYTAAYPT-AYGLVSPQFLQQPTLISQQQLQRE----------GPEGCNVFIYHLPQEFTDSEMLQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPASAQTAIQAMNGFQIGMKRLKVQLKRPK 345          
BLAST of bruno-like vs. Ensembl Zebrafish
Match: celf5b (cugbp, Elav-like family member 5b [Source:ZFIN;Acc:ZDB-GENE-070912-150])

HSP 1 Score: 229.95 bits (585), Expect = 4.665e-69
Identity = 154/388 (39.69%), Postives = 207/388 (53.35%), Query Frame = 3
Query:  126 DENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGYYNQGIVPMIQFPHATDQQTANLINAY------------ALQMHLSQMYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIPMSPALNSYINPAHPQLINIANINFTP-EALH---LPSLYSMFPQCGFNLNTPALGLSGQN-IYPNTT----ALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
             E+ KLF+GMLNK Q+E+DV +L EPYG I+ C +L+   GNSKGCAFV ++   EA  AI  L+G +T    P   S +V + AD ++ER +R+MQ       +  P     ++        + HA  QQ A ++ A             A Q+H     + N  PP       +TP       +S+A  +SS   ++    +PSI      ++P +N +    H         N  P EA++   LP   +  P     L     G+     IYP TT      +L          +     GPEGCNLFIYHLPQ+FGD  L Q+F PFG+VIS+KV++DRATNQSKCFGFVSFDN ++A+AAI+ MNGFQIG KRLKVQLKRPK
Sbjct:   39 SEDRKLFVGMLNKQQTEEDVYRLFEPYGVIEECTVLRGPDGNSKGCAFVKFSTHTEAQSAIGGLHGSQTM---PGASSSLVVKFADTDKERTIRRMQQMVGQFGIFNPSVALPFSTYSSTYSTYTHALMQQQAAIMAASHGGYLAPSVAFPATQIHQVGALNMNGLPPT-----PMTPVSGHFFILSSAG-LSSPPANLASSAVPSI------VTPIVNGFSGIPH-------QPNGHPVEAVYTNGLPPYSTQSPTAADTLQQAFTGVQQYTAIYPATTLTPIGQTLPQPAQIIQQQQQQQREGPEGCNLFIYHLPQEFGDNELMQMFLPFGSVISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK 404          
BLAST of bruno-like vs. Ensembl Zebrafish
Match: celf3b (cugbp, Elav-like family member 3b [Source:ZFIN;Acc:ZDB-GENE-110408-50])

HSP 1 Score: 228.409 bits (581), Expect = 3.386e-68
Identity = 148/379 (39.05%), Postives = 196/379 (51.72%), Query Frame = 3
Query:  117 QNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGYYNQGIVPMIQFPHATDQQTANLINAYALQMHLSQMYSPN--------LTPPL-VNSSPSVTPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIPMSPALNSYINPAHPQLINIANINFTPEALHLPSLYSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            +   E+ KLF+GML K QS++DVR++ EP+G I  C +L+   G SKGCAFV + +  EA  AI SL+G +T    P   S +V + AD E+ER +R+MQ     + + TP  + +                   A  ++  A  M + QM + N        +TPP   N+ P++   P   +P   A +  S+        LP   N      PA   Y N  HP           P    L   Y+          T A GL         T +S Q  Q +          GPEGCN+FIYHLPQ+F D+ + Q+F PFGNVISAKV++DRATNQSKCFGFVSFDN ++A+ AI+ MNGFQIG KRLKVQLKRPK
Sbjct:   89 EGRGEDRKLFVGMLGKQQSDEDVRKIFEPFGGIDECTVLRGPDGTSKGCAFVKFQSHSEAQSAINSLHGSRT---LPGASSSLVVKFADTEKERGVRRMQQVTSQLGVYTPVTLNFNAYNAYTQALVQQQALVAQAQYLSP-AASMQIQQMAALNASGIIATPITPPSGANTPPTLAATPVSALPQPIAVNGYSH--------LPPTTNGQ----PASEIYTNGLHPYQAQSPVAALDP----LQQAYAGMQHYTAAYPT-AYGLVSPQFLQQPTLISQQQLQRE----------GPEGCNVFIYHLPQEFTDSEMLQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPASAQTAIQAMNGFQIGMKRLKVQLKRPK 436          

HSP 2 Score: 60.4622 bits (145), Expect = 2.663e-9
Identity = 35/93 (37.63%), Postives = 51/93 (54.84%), Query Frame = 3
Query:  138 KLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSY-GNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKM 413
            KLFIG + +N  E D++ + E YG I    ++KD Y G  KGCAF+TY   + A  A  +L+  KT    P +   I  + AD+E   + RK+
Sbjct:    8 KLFIGQIPRNLEEKDLKPIFEQYGKIYELTVIKDKYTGMHKGCAFLTYCARESAVKAQSALHEQKT---LPGMNRPIQVKPADSEGRGEDRKL 97          
BLAST of bruno-like vs. Ensembl Xenopus
Match: tada2a (transcriptional adaptor 2A [Source:Xenbase;Acc:XB-GENE-946815])

HSP 1 Score: 224.172 bits (570), Expect = 5.868e-66
Identity = 145/387 (37.47%), Postives = 205/387 (52.97%), Query Frame = 3
Query:  117 QNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGYYNQGIVPMIQFPHATDQQTANLINAYALQMHLSQMYSPNLTPPLVNSSPSVTPQPQIGV---------PMSAANDISSNQCSMNHFVLPSINNENIP--MSPALNSY-----INPAHPQLINIANINFTPEALHLPSLYSMFPQCGFNLNTPALGLSGQN-IYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            ++   + KLF+GML+K QSE++V  + + +G I+ C +L+   G+SKGCAFV +++  EA  AI++L+G +T    P   S +V + AD ++ER LR+MQ     + + TP         I P   +  A  QQ   +         LS  +   L+P +   S  +    QIG          P++ A+ + S          P I    +P  ++P  N +        +HP L  I   +  P     P+L         +L+    G+   + IYP      + +   Q   I      GPEGCNLFIYHLPQ+FGD  L Q+F PFGN+IS+KV++DRATNQSKCFGFVSFDN S+A+ AI+ MNGFQIG KRLKVQLKRPK
Sbjct:  129 ESRGGDRKLFVGMLSKQQSEEEVTSMFQAFGSIEECSVLRGPDGSSKGCAFVKFSSHAEAQAAIQALHGSQT---MPGASSSLVVKFADTDKERTLRRMQQMVGQLGIFTPS----LALPISPYSAYAQALMQQQTTV---------LSTSHGSYLSPSVAFPSCHIQ---QIGAVNLNGLPAAPITPASGLHSP---------PVIGTAAVPGLVAPLTNGFPGLVPFPSSHPALDTIYTNSIVPYPAQSPALTVE------SLHPSFTGVQQYSAIYPTAALTPVTHSTPQPPPILQQ-REGPEGCNLFIYHLPQEFGDNELTQMFLPFGNIISSKVFMDRATNQSKCFGFVSFDNPSSAQTAIQAMNGFQIGMKRLKVQLKRPK 480          

HSP 2 Score: 62.003 bits (149), Expect = 1.745e-9
Identity = 36/93 (38.71%), Postives = 50/93 (53.76%), Query Frame = 3
Query:  138 KLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSY-GNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKM 413
            KLF+G + +N  E D++ L E +G I    +LKD Y G  KGCAF+TY   D A  A  +L+  KT    P +   I  + AD+E     RK+
Sbjct:   48 KLFVGQIPRNLEEKDLKPLFEQFGKIYELTVLKDRYTGMHKGCAFLTYCARDSAIKAQTALHEQKT---LPGMARPIQVKPADSESRGGDRKL 137          
BLAST of bruno-like vs. Ensembl Xenopus
Match: tada2a (transcriptional adaptor 2A [Source:Xenbase;Acc:XB-GENE-946815])

HSP 1 Score: 222.631 bits (566), Expect = 3.327e-65
Identity = 145/391 (37.08%), Postives = 206/391 (52.69%), Query Frame = 3
Query:  117 QNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGYYNQGIVPMIQFPHATDQQTANLINAYALQMHLSQMYSPNLTPPLVNSSPSVTPQPQIGV---------PMSAANDISSNQCSMNHFV----LPSINNENIP--MSPALNSY-----INPAHPQLINIANINFTPEALHLPSLYSMFPQCGFNLNTPALGLSGQN-IYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            ++   + KLF+GML+K QSE++V  + + +G I+ C +L+   G+SKGCAFV +++  EA  AI++L+G +T    P   S +V + AD ++ER LR+MQ     + + TP         I P   +  A  QQ   +         LS  +   L+P +   S  +    QIG          P++ A+      C +   +     P I    +P  ++P  N +        +HP L  I   +  P     P+L         +L+    G+   + IYP      + +   Q   I      GPEGCNLFIYHLPQ+FGD  L Q+F PFGN+IS+KV++DRATNQSKCFGFVSFDN S+A+ AI+ MNGFQIG KRLKVQLKRPK
Sbjct:  129 ESRGGDRKLFVGMLSKQQSEEEVTSMFQAFGSIEECSVLRGPDGSSKGCAFVKFSSHAEAQAAIQALHGSQT---MPGASSSLVVKFADTDKERTLRRMQQMVGQLGIFTPS----LALPISPYSAYAQALMQQQTTV---------LSTSHGSYLSPSVAFPSCHIQ---QIGAVNLNGLPAAPITPASGEFLWGCEIRAKIGLHSPPVIGTAAVPGLVAPLTNGFPGLVPFPSSHPALDTIYTNSIVPYPAQSPALTVE------SLHPSFTGVQQYSAIYPTAALTPVTHSTPQPPPILQQ-REGPEGCNLFIYHLPQEFGDNELTQMFLPFGNIISSKVFMDRATNQSKCFGFVSFDNPSSAQTAIQAMNGFQIGMKRLKVQLKRPK 493          

HSP 2 Score: 61.2326 bits (147), Expect = 2.448e-9
Identity = 36/93 (38.71%), Postives = 50/93 (53.76%), Query Frame = 3
Query:  138 KLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSY-GNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKM 413
            KLF+G + +N  E D++ L E +G I    +LKD Y G  KGCAF+TY   D A  A  +L+  KT    P +   I  + AD+E     RK+
Sbjct:   48 KLFVGQIPRNLEEKDLKPLFEQFGKIYELTVLKDRYTGMHKGCAFLTYCARDSAIKAQTALHEQKT---LPGMARPIQVKPADSESRGGDRKL 137          
BLAST of bruno-like vs. Ensembl Xenopus
Match: celf2 (CUGBP, Elav-like family member 2 [Source:NCBI gene;Acc:100125022])

HSP 1 Score: 185.652 bits (470), Expect = 2.545e-51
Identity = 138/413 (33.41%), Postives = 199/413 (48.18%), Query Frame = 3
Query:  120 NHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQ---------------FPAIQLLTPQNVGYYNQGIVPMIQFPHATDQQTANLINAYALQMHLSQMYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSMNH--FVLPSINNENIPMSPALNSYINPAHPQ-----LINIANINFTPEALHLPSLYSMFPQCGFNLNTPAL-------------GLSGQNIY-----PNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPKGEYK 1238
            N  E+ KLFIGM++K  +E+D+R +  P+G I+ C IL+   G S+GCAFVT++    A  AI++++  +T   C    S IV + AD +++++ R++Q Q                  +  LTPQ +    Q          +  QQ A       L +    ++S  L                        ND+ S + + ++  F L + +  N     A+NS  +    Q      + + NIN     +++  + S        L    L               SG   Y     P   + SL  QQ+     K+    GPEG NLFIYHLPQ+FGD  + Q+F PFGNVISAKV++D+ TN SKCFGFVS+DN  +A+AAI+ MNGFQIG KRLKVQLKR K + K
Sbjct:  123 NAVEDRKLFIGMVSKKCNENDIRVMFSPFGQIEECRILRGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCS---SPIVVKFADTQKDKEQRRLQQQLAQQMQQLNTATWGNLTGLGALTPQYLALLQQATSSSNLGAFSGIQQMAGKWRKKHLILANYALFSSAL-------------------KFFCTNDVLSWKLTFHYLIFFLVAASTANSSAGAAMNSLTSLGTLQGLAGATVGLNNINALAGTVNIAQMLSGMAALNGGLGATGLTNGTAGTMDALTQAYSGIQQYAAAALPTLYSQSLLQQQSAAGSQKE----GPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSK 509          

HSP 2 Score: 56.225 bits (134), Expect = 9.838e-8
Identity = 37/120 (30.83%), Postives = 63/120 (52.50%), Query Frame = 3
Query:   81 SNGFTDKGNIIIQNHD----ENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGN---SKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQM 419
            SNG T+K N  + + D    +  K+F+G + ++ SE +++ L EPYG +    +L+D   N   SKGC FVT+     A  A  +L+ +KT    P +   I  + AD+E+   +   ++
Sbjct:   14 SNGTTNKMNGALDHSDQPDPDAIKMFVGQIPRSWSEKELKDLFEPYGAVYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKT---LPGMHHPIQMKPADSEKSNAVEDRKL 130          
BLAST of bruno-like vs. Ensembl Xenopus
Match: tada2a (transcriptional adaptor 2A [Source:Xenbase;Acc:XB-GENE-946815])

HSP 1 Score: 181.03 bits (458), Expect = 5.636e-50
Identity = 132/393 (33.59%), Postives = 191/393 (48.60%), Query Frame = 3
Query:   99 KGNIIIQNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGYYNQGIVPMIQFPHATDQQTANLINAYALQMHLSQMYSPNLTPPLVNSSPSVTPQPQIG---------VPMSAANDISSNQCSMNHFVLPSINNENIP--MSPALNSY-----INPAHPQLINIANINFTPEALHLPSLYSMFPQCGFNLNTPALGLSGQN-IYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            +G +   +   + KLF+GML+K QSE++V  + + +G I+ C +L+   G+SKGCAFV +++  EA  AI++L+G +T    P   S +V + AD ++ER LR+MQ     + + TP         I P   +  A  QQ   +         LS  +   L+P +   S  +    QIG          P++ A+ + S          P I    +P  ++P  N +        +HP L  I   +  P     P+L         +L+    G+   + IYP      + +   Q   I      GPEGCNLFIYHLPQ+FGD  L Q+F PFGN+IS+KV                FDN S+A+ AI+ MNGFQIG KRLKVQLKRPK
Sbjct:  134 RGGMYPVHLPSDRKLFVGMLSKQQSEEEVTSMFQAFGSIEECSVLRGPDGSSKGCAFVKFSSHAEAQAAIQALHGSQT---MPGASSSLVVKFADTDKERTLRRMQQMVGQLGIFTPS----LALPISPYSAYAQALMQQQTTV---------LSTSHGSYLSPSVAFPSCHIQ---QIGAVNLNGLPAAPITPASGLHSP---------PVIGTAAVPGLVAPLTNGFPGLVPFPSSHPALDTIYTNSIVPYPAQSPALTVE------SLHPSFTGVQQYSAIYPTAALTPVTHSTPQPPPILQQ-REGPEGCNLFIYHLPQEFGDNELTQMFLPFGNIISSKV----------------FDNPSSAQTAIQAMNGFQIGMKRLKVQLKRPK 475          

HSP 2 Score: 59.6918 bits (143), Expect = 8.176e-9
Identity = 34/85 (40.00%), Postives = 47/85 (55.29%), Query Frame = 3
Query:  138 KLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSY-GNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNE 389
            KLF+G + +N  E D++ L E +G I    +LKD Y G  KGCAF+TY   D A  A  +L+  KT    P +   I  + AD+E
Sbjct:   51 KLFVGQIPRNLEEKDLKPLFEQFGKIYELTVLKDRYTGMHKGCAFLTYCARDSAIKAQTALHEQKT---LPGMARPIQVKPADSE 132          
BLAST of bruno-like vs. Ensembl Xenopus
Match: tpbg (trophoblast glycoprotein [Source:Xenbase;Acc:XB-GENE-1016283])

HSP 1 Score: 142.51 bits (358), Expect = 7.680e-40
Identity = 64/83 (77.11%), Postives = 74/83 (89.16%), Query Frame = 3
Query:  978 PEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            P GCN+FIYHLPQ+F D+ + Q+F PFGNVISAKV++DRATNQSKCFGFVSFDN  +A+AAI+ MNGFQIG KRLKVQLKRPK
Sbjct:   33 PPGCNIFIYHLPQEFTDSEILQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPGSAQAAIQAMNGFQIGMKRLKVQLKRPK 115          
BLAST of bruno-like vs. Ensembl Mouse
Match: Celf5 (CUGBP, Elav-like family member 5 [Source:MGI Symbol;Acc:MGI:2442333])

HSP 1 Score: 232.261 bits (591), Expect = 1.470e-69
Identity = 151/423 (35.70%), Postives = 217/423 (51.30%), Query Frame = 3
Query:   12 AVDKDNSKMQVASPINVDSMALYSNGFTDKGNIIIQNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGYYNQGIVPMIQFPHATDQQTANLINAYALQM---------HLSQMYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIP--MSPALNSY--INP---AHPQLINIANINFTPEALHLPSLYSMFPQCGFNLNTPALGLSGQ--NIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            A+ +  +   +A PI V      S G  D+            KLF+GMLNK QSE+DV +L +P+G I  C +L+   G+SKGCAFV +++  EA  AI +L+G +T    P   S +V + AD ++ER LR+MQ     + +LTP     ++    P   +  A  QQ   +++     +         H+ Q+ + +L     N  P+         P++ A+ + S          P +    +P  M+P  N +  + P   +HP L  +      P     P++             PA     Q   +YP      + +   Q   +      GPEGCNLFIYHLPQ+FGD  L Q+F PFGN+IS+KV++DRATNQSKCFGFVSFD+ ++A+AAI+ MNGFQIG KRLKVQLKRPK
Sbjct:   67 ALHEQKTLPGMARPIQVKPADSESRGGRDR------------KLFVGMLNKQQSEEDVLRLFQPFGVIDECTVLRGPDGSSKGCAFVKFSSHTEAQAAIHALHGSQT---MPGASSSLVVKFADTDKERTLRRMQQMVGQLGILTPSLTLPFS----PYSAYAQALMQQQTTVLSTSGSYLSPGVAFPPCHIQQIGAVSL-----NGLPAT--------PIAPASGLHSP---------PLLGTAAVPGLMAPIPNGFPGVLPFPGSHPALETVYANGLVPYPAQSPTVAETL--------HPAFSGVQQYTAMYPTAAIAPVAHSVPQPPHLLQQQREGPEGCNLFIYHLPQEFGDTELTQMFLPFGNIISSKVFMDRATNQSKCFGFVSFDHPASAQAAIQAMNGFQIGMKRLKVQLKRPK 440          

HSP 2 Score: 56.225 bits (134), Expect = 7.339e-8
Identity = 32/88 (36.36%), Postives = 48/88 (54.55%), Query Frame = 3
Query:  129 ENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSY-GNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNE 389
            +  KLF+G + ++  E D++ L E +G I    +LKD + G  KGCAF+TY   D A  A  +L+  KT    P +   I  + AD+E
Sbjct:    5 DAIKLFVGQIPRHLHEQDLKPLFEQFGRIYELTVLKDPHTGVHKGCAFLTYCARDSAIKAQTALHEQKT---LPGMARPIQVKPADSE 89          
BLAST of bruno-like vs. Ensembl Mouse
Match: Celf3 (CUGBP, Elav-like family member 3 [Source:MGI Symbol;Acc:MGI:1926034])

HSP 1 Score: 224.172 bits (570), Expect = 2.935e-67
Identity = 147/382 (38.48%), Postives = 200/382 (52.36%), Query Frame = 3
Query:  132 NTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNV--GYYNQGIVPMIQFPHATDQQTANLINAY-----------ALQMHLSQMYSPN--LTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSM--NHFVLPSINNENIPMSPALNSYINPAHPQLINIANINFTPEALHLPSLYSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            + KLF+GML K Q+++DVR++ EP+G I  C +L+   G SKGCAFV +    EA  AI +L+  +T    P   S +V + AD E+ER LR+MQ     + + +P  +  G Y+        +  A  QQ A L+ A+           A+QM      S N  +  P+  SS + TP      P  AA  +S+   ++  N +          P   AL  Y N  HP         +  EAL         P      +   +  + Q+       L   Y   Q         TGP+GCN+FIYHLPQ+F D+ + Q+F PFG+VISAKV++DRATNQSKCFGFVSFDN ++A+AAI+ MNGFQIG KRLKVQLKRPK
Sbjct:   17 DRKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRT---LPGASSSLVVKFADTEKERGLRRMQQVATQLGMFSPIALQFGAYSA-------YTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAISANGLIATPITPSSGTSTP------PAIAATPVSAIPAALGVNGYSPVPTQPTGQPAPDAL--YPNGVHP---------YPDEALSAERSAGGVPIMSQAHSWLVMLSAAQSPAAPVDPLQQAYAGMQH-------YTGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK 364          
BLAST of bruno-like vs. Ensembl Mouse
Match: Celf3 (CUGBP, Elav-like family member 3 [Source:MGI Symbol;Acc:MGI:1926034])

HSP 1 Score: 219.935 bits (559), Expect = 1.592e-65
Identity = 148/393 (37.66%), Postives = 204/393 (51.91%), Query Frame = 3
Query:  132 NTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNV--GYYNQGIVPMIQFPHATDQQTANLINAY-----------ALQMHLSQMYSPN--LTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSM--NHFVLPSINNENIPMSPALNSYINPAHPQLIN--IANINFTPEALHLPSLYSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVT---------GPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            + KLF+GML K Q+++DVR++ EP+G I  C +L+   G SKGCAFV +    EA  AI +L+  +T    P   S +V + AD E+ER LR+MQ     + + +P  +  G Y+        +  A  QQ A L+ A+           A+QM      S N  +  P+  SS + TP      P  AA  +S+   ++  N +          P   AL  Y N  HP       A ++   +A      Y+      ++L  PA        +P   AL  Q         +              GP+GCN+FIYHLPQ+F D+ + Q+F PFG+VISAKV++DRATNQSKCFGFVSFDN ++A+AAI+ MNGFQIG KRLKVQLKRPK
Sbjct:   17 DRKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRT---LPGASSSLVVKFADTEKERGLRRMQQVATQLGMFSPIALQFGAYSA-------YTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAISANGLIATPITPSSGTSTP------PAIAATPVSAIPAALGVNGYSPVPTQPTGQPAPDAL--YPNGVHPYPAQSPAAPVDPLQQAYAGMQHYTAAYPAAYSLVAPA--------FPQPPALVAQQPPPPPQQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK 383          
BLAST of bruno-like vs. Ensembl Mouse
Match: Celf3 (CUGBP, Elav-like family member 3 [Source:MGI Symbol;Acc:MGI:1926034])

HSP 1 Score: 220.32 bits (560), Expect = 2.389e-65
Identity = 146/376 (38.83%), Postives = 200/376 (53.19%), Query Frame = 3
Query:  117 QNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTP--QNVGYYNQGIVPMIQFPHATDQQTANLINAYALQMHLSQMYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIPMSPALNSYINPAHPQLINIANINFTPEALHLPSLYSM----FPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            ++  E+ KLF+GML K Q+++DVR++ EP+G I  C +L+   G SKGCAFV +    EA  AI +L+  +T    P   S +V + AD E+ER LR+MQ     + + +P     G Y+        +  A  QQ A L+ A++  +                 SP  T      V M     IS+N          S  +   P+ P   +Y    H          +T      P+ YS+    FPQ       PAL ++ Q   P       Q QQ Q+   ++    GP+GCN+FIYHLPQ+F D+ + Q+F PFG+VISAKV++DRATNQSKCFGFVSFDN ++A+AAI+ MNGFQIG KRLKVQLKRPK
Sbjct:   89 ESRGEDRKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRT---LPGASSSLVVKFADTEKERGLRRMQQVATQLGMFSPIALQFGAYSA-------YTQALMQQQAALVAAHSAYL-----------------SPMAT---MAAVQMQHMAAISANGLIATPITPSSAQSPAAPVDPLQQAYAGMQH----------YTAA---YPAAYSLVAPAFPQ------PPAL-VAQQPPPPPQQQQQQQQQQQQQQQQRE----GPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK 410          

HSP 2 Score: 57.7658 bits (138), Expect = 2.169e-8
Identity = 33/93 (35.48%), Postives = 51/93 (54.84%), Query Frame = 3
Query:  138 KLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSY-GNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKM 413
            KLF+G + ++  E D++ + E +G I    ++KD Y G  KGCAF+TY   D A  A  +L+  KT    P +   I  + AD+E   + RK+
Sbjct:    8 KLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHEQKT---LPGMNRPIQVKPADSESRGEDRKL 97          
BLAST of bruno-like vs. Ensembl Mouse
Match: Celf3 (CUGBP, Elav-like family member 3 [Source:MGI Symbol;Acc:MGI:1926034])

HSP 1 Score: 219.55 bits (558), Expect = 1.697e-64
Identity = 148/393 (37.66%), Postives = 204/393 (51.91%), Query Frame = 3
Query:  132 NTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNV--GYYNQGIVPMIQFPHATDQQTANLINAY-----------ALQMHLSQMYSPN--LTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSM--NHFVLPSINNENIPMSPALNSYINPAHPQLIN--IANINFTPEALHLPSLYSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVT---------GPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            + KLF+GML K Q+++DVR++ EP+G I  C +L+   G SKGCAFV +    EA  AI +L+  +T    P   S +V + AD E+ER LR+MQ     + + +P  +  G Y+        +  A  QQ A L+ A+           A+QM      S N  +  P+  SS + TP      P  AA  +S+   ++  N +          P   AL  Y N  HP       A ++   +A      Y+      ++L  PA        +P   AL  Q         +              GP+GCN+FIYHLPQ+F D+ + Q+F PFG+VISAKV++DRATNQSKCFGFVSFDN ++A+AAI+ MNGFQIG KRLKVQLKRPK
Sbjct:   93 DRKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRT---LPGASSSLVVKFADTEKERGLRRMQQVATQLGMFSPIALQFGAYSA-------YTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAISANGLIATPITPSSGTSTP------PAIAATPVSAIPAALGVNGYSPVPTQPTGQPAPDAL--YPNGVHPYPAQSPAAPVDPLQQAYAGMQHYTAAYPAAYSLVAPA--------FPQPPALVAQQPPPPPQQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK 459          

HSP 2 Score: 55.8398 bits (133), Expect = 8.679e-8
Identity = 34/93 (36.56%), Postives = 51/93 (54.84%), Query Frame = 3
Query:  138 KLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSY-GNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKM 413
            KLF+G + ++  E D++ + E +G I    ++KD Y G  KGCAF+TY   D A  A  +L+  KT    P +   I  + AD+E  R  RK+
Sbjct:    8 KLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHEQKT---LPGMNRPIQVKPADSE-SRGDRKL 96          
BLAST of bruno-like vs. UniProt/SwissProt
Match: sp|Q91579|CEL3A_XENLA (CUGBP Elav-like family member 3-A OS=Xenopus laevis OX=8355 GN=tnrc4-a PE=2 SV=2)

HSP 1 Score: 229.18 bits (583), Expect = 2.179e-67
Identity = 149/398 (37.44%), Postives = 209/398 (52.51%), Query Frame = 3
Query:  117 QNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGY-----YNQGIVPMIQFPHATDQQTANLINAY-----------ALQMHLSQMYSPN---LTP-----PLVNSSPSVTPQPQIGVPMSAANDISSNQCSM--NHFVLPSINNENIPMSPALNSYINPAHPQLIN--IANINFTPEALHLPSLYSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            ++  E+ KLF+GML K Q+++DVR++ EP+G I  C +L+   G SKGCAFV +    EA  AI +L+G +T    P   S +V + AD E+ER LR+MQ     + + +P  + +     Y Q +   +       QQ A L+ A+           A+QM      +PN    TP     P+ +SS + TP      P   A  +S+   ++  N +      +   P S A+  Y N  HP      +A ++   +A      Y+      + L +PA       +         Q +             GPEGCN+FIYHLPQ+F D+ + Q+F PFGNVISAKV++DRATNQSKCFGFVSFDN  +A+AAI+ MNGFQIG KRLKVQLKRPK
Sbjct:   89 ESRGEDRKLFVGMLGKQQTDEDVRRMFEPFGNIDECTVLRGPDGTSKGCAFVKFQTHTEAQAAINALHGSRT---LPGASSSLVVKFADTEKERGLRRMQQVANQLGMFSPIALQFGAYSAYTQAVSDQLM------QQQAALVAAHSAYLNPMATMAAVQMQQMATINPNGIIATPITQINPITSSSGTSTP------PTLTATQVSAIPATLGVNGYSAVPTQSTVQPSSEAI--YTNGLHPYPAQSPVAQLDPLQQAYAGMQHYTAAYPAAYGLVSPAFTQPPAILQQQPPQQQQQRE-------------GPEGCNIFIYHLPQEFTDSEILQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPGSAQAAIQAMNGFQIGMKRLKVQLKRPK 456          

HSP 2 Score: 57.3806 bits (137), Expect = 1.958e-7
Identity = 33/93 (35.48%), Postives = 51/93 (54.84%), Query Frame = 3
Query:  138 KLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSY-GNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKM 413
            KLFIG + +N  E D++ + E +G I    ++KD + G  KGCAF+TY   + A  A  +L+  KT    P +   I  + AD+E   + RK+
Sbjct:    8 KLFIGQIPRNLDEKDLKPIFEQFGKIYELTVIKDKFTGMHKGCAFLTYCARESALKAQSALHEQKT---LPGMNRPIQVKPADSESRGEDRKL 97          
BLAST of bruno-like vs. UniProt/SwissProt
Match: sp|Q8N6W0|CELF5_HUMAN (CUGBP Elav-like family member 5 OS=Homo sapiens OX=9606 GN=CELF5 PE=1 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 5.449e-67
Identity = 148/405 (36.54%), Postives = 209/405 (51.60%), Query Frame = 3
Query:   42 VASPINVDSMALYSNGFTDKGNIIIQNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGYYNQGIVPMIQFPHATDQQTANLINAYALQMHLSQMYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIP--MSPALNSY--INP---AHPQLINIANINFTPEALHLPSLYSMFPQCGFNLNTPALGLSGQ--NIYPNTTALSLQYQ-QNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            +A PI V      S G  D+            KLF+GMLNK QSE+DV +L +P+G I  C +L+   G+SKGCAFV +++  EA  AI +L+G +T    P   S +V + AD ++ER LR+MQ     + +LTP     ++    P   +  A  QQ   +++     +     +SP     +   S +  P      P++ A+ + S          P +    +P  ++P  N +  + P    HP L  +      P     P++             PA     Q   +YP      + +        ++     GPEGCNLFIYHLPQ+FGD  L Q+F PFGN+IS+KV++DRATNQSKCFGFVSFDN ++A+AAI+ MNGFQIG KRLKVQLKRPK
Sbjct:  115 MARPIQVKPADSESRGGRDR------------KLFVGMLNKQQSEEDVLRLFQPFGVIDECTVLRGPDGSSKGCAFVKFSSHTEAQAAIHALHGSQT---MPGASSSLVVKFADTDKERTLRRMQQMVGQLGILTPSLTLPFS----PYSAYAQALMQQQTTVLSTSGSYLSPGVAFSPCHIQQIGAVSLNGLP----ATPIAPASGLHSP---------PLLGTTAVPGLVAPITNGFAGVVPFPGGHPALETVYANGLVPYPAQSPTVAETL--------HPAFSGVQQYTAMYPTAAITPIAHSVPQPPPLLQQQQREGPEGCNLFIYHLPQEFGDTELTQMFLPFGNIISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK 479          

HSP 2 Score: 57.7658 bits (138), Expect = 1.938e-7
Identity = 40/117 (34.19%), Postives = 60/117 (51.28%), Query Frame = 3
Query:  138 KLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSY-GNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNE----QERQ-----LRKMQMQFPAIQLLTPQNV 458
            KLF+G + ++  E D++ L E +G I    +LKD Y G  KGCAF+TY   D A  A  +L+  KT    P +   I  + AD+E    ++R+     L K Q +   ++L  P  V
Sbjct:   46 KLFVGQIPRHLDEKDLKPLFEQFGRIYELTVLKDPYTGMHKGCAFLTYCARDSAIKAQTALHEQKT---LPGMARPIQVKPADSESRGGRDRKLFVGMLNKQQSEEDVLRLFQPFGV 159          
BLAST of bruno-like vs. UniProt/SwissProt
Match: sp|Q9IBD1|CELF3_DANRE (CUGBP Elav-like family member 3 OS=Danio rerio OX=7955 GN=celf3 PE=2 SV=2)

HSP 1 Score: 227.639 bits (579), Expect = 7.179e-67
Identity = 155/385 (40.26%), Postives = 214/385 (55.58%), Query Frame = 3
Query:  132 NTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQ--NVGYYNQGIVPMIQFPHATDQQTANL---INAYALQMHLSQMYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIPMSP---ALNSYIN-PAHPQLINIANINFT----PEALHLPSL------YSMFPQCGFNLNTPA-LGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            + KLF+GML K  S+ DVR++ EP+G I+ C +L+   G SKGCAFV Y ++ EA  AI +L+G +T    P   S +V + AD E+ER +R+MQ     + +++P   ++G YN     ++Q   A   Q+A L       A+QM   Q+ + N +  +     S+TP      P                   P+I    +P  P   A+NSY   PA P   + +   +T    P     P+L      Y+      +    PA  GL GQ      T ++ Q QQ Q+   ++    GPEGCN+FIYHLPQ+F D+ + Q+F PFGNVISAKV++DRATNQSKCFGFVSFDN ++A+AAI+ MNGFQIG KRLKVQLKRPK
Sbjct:   93 DRKLFVGMLGKQLSDADVRKMFEPFGSIEECTVLRGPDGASKGCAFVKYQSNAEAQAAISALHGSRT---LPGASSSLVVKFADTEKERGIRRMQQVASQLGVISPMSLHLGAYNAYTQALVQ-QQALVAQSAYLSPVATVAAVQMQ--QLAALNPSSIIATPIASITPSSGTSTP-------------------PTIAATPVPALPPPIAVNSYPPVPAAPNGQSASEALYTNGVHPYQAQSPALDPLQQAYTGMQH--YTATYPAAYGLVGQPFPHQPTLVAQQPQQPQQLQQRE----GPEGCNIFIYHLPQEFTDSEMLQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK 446          

HSP 2 Score: 55.8398 bits (133), Expect = 7.564e-7
Identity = 35/93 (37.63%), Postives = 51/93 (54.84%), Query Frame = 3
Query:  138 KLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSY-GNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKM 413
            KLFIG + +N  E D++ + E +G I    ++KD Y G  KGCAF+TY   + A  A  +L+  KT    P +   I  + AD+E  R  RK+
Sbjct:    8 KLFIGQIPRNLEEKDLKPIFEQFGKIYELTVIKDKYTGMHKGCAFLTYCARESALKAQNALHEQKT---LPGMNRPIQVKPADSE-GRGDRKL 96          
BLAST of bruno-like vs. UniProt/SwissProt
Match: sp|Q08E07|CELF3_BOVIN (CUGBP Elav-like family member 3 OS=Bos taurus OX=9913 GN=CELF3 PE=2 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 6.182e-66
Identity = 150/394 (38.07%), Postives = 211/394 (53.55%), Query Frame = 3
Query:  117 QNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTP--QNVGYYNQGIVPMIQFPHATDQQTANLINAY-----------ALQM-HLSQMYSPNL-TPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSM--NHFVLPSINNENIPMSPALNSYINPAHPQLIN--IANINFTPEALHLPSLYSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVT-----GPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            ++  E+ KLF+GML K Q+++DVR++ EP+G I  C +L+   G SKGCAFV +    EA  AI +L+  +T    P   S +V + AD E+ER LR+MQ     + + +P     G Y+        +  A  QQ A L+ A+           A+QM H++ + +  L   P+  SS + TP      P  AA  +S+   ++  N +          P   AL  Y N  HP       A ++   +A      Y+ +P   ++L  PA        +P   AL  Q         +          GP+GCN+FIYHLPQ+F D+ + Q+F PFG+VISAKV++DRATNQSKCFGFVSFDN ++A+AAI+ MNGFQIG KRLKVQLKRPK
Sbjct:   89 ESRGEDRKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRT---LPGASSSLVVKFADTEKERGLRRMQQVATQLGMFSPIALQFGAYSA-------YTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAINANGLIATPITPSSGTSTP------PAIAATPVSAIPAALGVNGYSPVPTQPTGQPAPDAL--YPNGVHPYPAQSPAAPVDPLQQAYAGMQHYTAYP-AAYSLVAPA--------FPQPPALVAQQPPPPPQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK 455          

HSP 2 Score: 58.9214 bits (141), Expect = 8.015e-8
Identity = 33/93 (35.48%), Postives = 51/93 (54.84%), Query Frame = 3
Query:  138 KLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSY-GNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKM 413
            KLF+G + ++  E D++ + E +G I    ++KD Y G  KGCAF+TY   D A  A  +L+  KT    P +   I  + AD+E   + RK+
Sbjct:    8 KLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHEQKT---LPGMNRPIQVKPADSESRGEDRKL 97          
BLAST of bruno-like vs. UniProt/SwissProt
Match: sp|Q5SZQ8|CELF3_HUMAN (CUGBP Elav-like family member 3 OS=Homo sapiens OX=9606 GN=CELF3 PE=1 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 2.394e-65
Identity = 149/389 (38.30%), Postives = 210/389 (53.98%), Query Frame = 3
Query:  117 QNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTP--QNVGYYNQGIVPMIQFPHATDQQTANLINAY-----------ALQM-HLSQMYSPNL-TPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSM--NHFVLPSINNENIPMSPALNSYINPAHPQLIN--IANINFTPEALHLPSLYSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            ++  E+ KLF+GML K Q+++DVR++ EP+G I  C +L+   G SKGCAFV +    EA  AI +L+  +T    P   S +V + AD E+ER LR+MQ     + + +P     G Y+        +  A  QQ A L+ A+           A+QM H++ + +  L   P+  SS + TP      P  AA  +S+   ++  N +          P   AL  Y N  HP       A ++   +A      Y+      ++L  PA       +         Q QQ Q+   +     GP+GCN+FIYHLPQ+F D+ + Q+F PFG+VISAKV++DRATNQSKCFGFVSFDN ++A+AAI+ MNGFQIG KRLKVQLKRPK
Sbjct:   89 ESRGEDRKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRT---LPGASSSLVVKFADTEKERGLRRMQQVATQLGMFSPIALQFGAYSA-------YTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAINANGLIATPITPSSGTSTP------PAIAATPVSAIPAALGVNGYSPVPTQPTGQPAPDAL--YPNGVHPYPAQSPAAPVDPLQQAYAGMQHYTAAYPAAYSLVAPAFPQPPALVAQQPPPPPQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK 459          

HSP 2 Score: 58.9214 bits (141), Expect = 8.152e-8
Identity = 33/93 (35.48%), Postives = 51/93 (54.84%), Query Frame = 3
Query:  138 KLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSY-GNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKM 413
            KLF+G + ++  E D++ + E +G I    ++KD Y G  KGCAF+TY   D A  A  +L+  KT    P +   I  + AD+E   + RK+
Sbjct:    8 KLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHEQKT---LPGMNRPIQVKPADSESRGEDRKL 97          
BLAST of bruno-like vs. TrEMBL
Match: Q0H219 (Bruno-like OS=Schmidtea mediterranea OX=79327 GN=bruli PE=2 SV=1)

HSP 1 Score: 819.691 bits (2116), Expect = 0.000e+0
Identity = 401/404 (99.26%), Postives = 402/404 (99.50%), Query Frame = 3
Query:   36 MQVASPINVDSMALYSNGFTDKGNIIIQNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGYYNQGIVPMI--QFPHATDQQTANLINAYALQMHLSQMYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIPMSPALNSYINPAHPQLINIANINFTPEALHLPSLYSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPKGEYKN 1241
            MQVASPINVDSMALYSNGFTDKGNIIIQNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGYYNQGIVPMI  QFPHATDQQTANLINAYALQMHLSQMYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIP+SPALNSYINPAHPQLINIANINFTPEALHLPSLYSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPKGEYKN
Sbjct:    1 MQVASPINVDSMALYSNGFTDKGNIIIQNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGYYNQGIVPMILQQFPHATDQQTANLINAYALQMHLSQMYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIPLSPALNSYINPAHPQLINIANINFTPEALHLPSLYSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPKGEYKN 404          
BLAST of bruno-like vs. TrEMBL
Match: D5JG65 (Bruno-like protein OS=Dugesia japonica OX=6161 GN=Bruli PE=2 SV=1)

HSP 1 Score: 645.966 bits (1665), Expect = 0.000e+0
Identity = 320/380 (84.21%), Postives = 349/380 (91.84%), Query Frame = 3
Query:  108 IIIQNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGYYNQGIVPMI--QFPHATDQQTANLINAYALQMHLSQMYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIPMSPALNSYINPAHPQLINIANINFTPEALHLPSLYSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPKGEYKN 1241
            ++IQN DEN KLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKD+YG S  CAFVT+N+SDEAN+AIE+LNG+KTSMACPELGS IVARLADN+QERQLRKMQMQ PA+Q LTPQNVGYYNQGIVPMI  QFPHATDQQT N+INAYAL MH +QMYSPNLTPP++NSSPSVTPQPQIGVPMSA+NDISSNQCS+NH+V+P+I+NE   +SP  NSYINP +PQLINIANINF+PEALHL SLYSMFPQCGFN+N P LGLS QN+Y N   LSLQ+QQ QKDG+KD+IVTGPEGCNLFIYHLPQDFGD ALAQLF PFGNVISAKVYLDRATNQSKCFGFVSFDNAS+AE AIRGMNGFQIGTKRLKVQLKRPKGEYKN
Sbjct:    1 MLIQNQDENAKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDAYGQS--CAFVTFNSSDEANIAIEALNGLKTSMACPELGSTIVARLADNDQERQLRKMQMQIPAVQFLTPQNVGYYNQGIVPMILQQFPHATDQQTTNIINAYAL-MHFNQMYSPNLTPPIMNSSPSVTPQPQIGVPMSASNDISSNQCSINHYVIPAISNET--LSP--NSYINP-NPQLINIANINFSPEALHLSSLYSMFPQCGFNINQP-LGLSSQNVYQNPATLSLQFQQTQKDGMKDSIVTGPEGCNLFIYHLPQDFGDTALAQLFAPFGNVISAKVYLDRATNQSKCFGFVSFDNASSAEGAIRGMNGFQIGTKRLKVQLKRPKGEYKN 371          
BLAST of bruno-like vs. TrEMBL
Match: D5JG66 (Trinucleotide repeat containing 4-like protein OS=Dugesia japonica OX=6161 GN=TNRC-4 PE=2 SV=1)

HSP 1 Score: 259.61 bits (662), Expect = 1.658e-76
Identity = 176/425 (41.41%), Postives = 220/425 (51.76%), Query Frame = 3
Query:  117 QNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTP--------------------QNVGYYNQGIVPMIQFPHATDQQTANLINAYALQMHLSQMYSP------------NLTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSMNHFVL----------------PSINNENIPMSPALNSYINPAHPQLINIANINF-TPEALHLPSLYSMFPQCGFN-LNTPALG----LSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPKG 1229
            Q+  E+ KLFIGML K  +EDDVR + +P+G I+ C IL+D  GNSKGCAFV Y    EA  AI +++G   SM  P   S +V + AD E+ERQ RK+Q       L+ P                    QN GY N  I  +        QQ   +     L   LS   S             N     V +S ++T Q  +  P +A + +  N   MN                    PS+N  N P+S       N     L      N+ T     LP +Y     CG    N P L     L+ Q       ALS+Q QQ  K+G KD I+TGP+G N+FIYHLPQ+FGDA LAQ+F+PFG VISAKVY+DRATNQSKCFGFVSFDN+++A+AAI+ MNGFQIG KRLKVQLKRPKG
Sbjct:   43 QHKGEDRKLFIGMLGKQHTEDDVRDMFKPFGMIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHG---SMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYIENLQQNTGYINP-IATLALQLQQQLQQQQQITLGATLPYSLSTGISSSDVNASQNFLGVNSLAAAVAASQNLTTQSLLS-PSTATSIMMPNNSGMNTMCQLQPQTSVMTSATGINDPSVNITNTPISNGQTRAQNLTPFSLAAATGPNWLTSNPTALPQMYGGLNLCGLAPYNPPTLNPITLLARQ-------ALSMQVQQ--KEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKG 453          
BLAST of bruno-like vs. TrEMBL
Match: A0A1S3JEN6 (CUGBP Elav-like family member 3-A isoform X5 OS=Lingula unguis OX=7574 GN=LOC106172442 PE=4 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 5.044e-76
Identity = 172/402 (42.79%), Postives = 224/402 (55.72%), Query Frame = 3
Query:  129 ENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPE-----LGSCIVARLADNEQERQLRKMQMQFPAIQLLTP----QNVGYYNQG--IVPMIQFPHATDQQTANLINAYALQMHLSQMYS-PNLTPPLVNSSPSVTPQPQIG-VPMSAANDISSNQCSMNHFVLPSINNENIPMSPALNSYINPAHPQLINIANINFTPEALHLPSLYS-MFPQCGFNLNTPALGLSGQ--NIYPNTTALSLQYQQNQKDGIKDNIV--------------------TGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            E+ KLF+GMLNK Q+E+DVRQL +P+G I+ C IL+D  GNSKGCAFV Y++  EA  AI +L+G +T    P        S IV + AD E+ERQLRKMQ     + LL P       G Y+Q   +        A   Q +  IN      HL Q+ + PN        SP    Q   G VP++ A  ++    +M   + P++    +P S   + Y N   PQ     N+  +     L  +Y+ + PQ G  +  PA   +GQ   +     A+++Q Q+  +D    N+                      GPEGCNLFIYHLPQ+FGDA LAQ+F PFGNVISAKVY+DRATNQSKCFGFVSFDN ++A+AAI+ MNGFQIG KRLKVQLKRPK
Sbjct:   49 EDRKLFVGMLNKQQTEEDVRQLFQPFGTIEECTILRDQNGNSKGCAFVKYSSHAEAQAAINALHGSQTMPVIPGPLQKGASSSIVVKFADTEKERQLRKMQQMAGNLGLLNPFALTHAYGAYSQVNLMQQQAAIMAAAAAQGSAYINPVTSLTHLGQVGTLPN------GISPQAMAQAGSGLVPVTTATAVNGGPPTM---LSPTVAFAAVPTSNGPDIYPN-GIPQYAAGQNVPPSHPGDPLQPVYTGVHPQYG-GIAYPAAYAAGQFQQVLAQHPAIAVQAQKEGQDPYNANVYMYPVVAQPASEKEHTPGSMPVGPEGCNLFIYHLPQEFGDAELAQMFMPFGNVISAKVYVDRATNQSKCFGFVSFDNPTSAQAAIQAMNGFQIGMKRLKVQLKRPK 439          
BLAST of bruno-like vs. TrEMBL
Match: A0A1S3JFF0 (CUGBP Elav-like family member 3-A isoform X8 OS=Lingula unguis OX=7574 GN=LOC106172442 PE=4 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 8.041e-75
Identity = 173/424 (40.80%), Postives = 227/424 (53.54%), Query Frame = 3
Query:  117 QNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTP----QNVGYYNQG--IVPMIQFPHATDQQTANLINAYALQMHLSQMYS-PNLTPPLVNSSPSVTPQPQIG-VPMSAANDISSNQCSMNHFVLPSINNENIPMSPALNSYINPAHPQLINIANINFTPEALHLPSLYS-MFPQCGFNLNTPALGLSGQ--NIYPNTTALSLQYQQNQKDGIKDNIV-------------------------------------------TGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            ++  E+ KLF+GMLNK Q+E+DVRQL +P+G I+ C IL+D  GNSKGCAFV Y++  EA  AI +L+G +T    P   S IV + AD E+ERQLRKMQ     + LL P       G Y+Q   +        A   Q +  IN      HL Q+ + PN        SP    Q   G VP++ A  ++    +M   + P++    +P S   + Y N   PQ     N+  +     L  +Y+ + PQ G  +  PA   +GQ   +     A+++Q Q+  +D    N+                                            TGPEGCNLFIYHLPQ+FGDA LAQ+F PFGNVISAKVY+DRATNQSKCFGFVSFDN ++A+AAI+ MNGFQIG KRLKVQLKRPK
Sbjct:   13 ESRAEDRKLFVGMLNKQQTEEDVRQLFQPFGTIEECTILRDQNGNSKGCAFVKYSSHAEAQAAINALHGSQT---MPGASSSIVVKFADTEKERQLRKMQQMAGNLGLLNPFALTHAYGAYSQVNLMQQQAAIMAAAAAQGSAYINPVTSLTHLGQVGTLPN------GISPQAMAQAGSGLVPVTTATAVNGGPPTM---LSPTVAFAAVPTSNGPDIYPN-GIPQYAAGQNVPPSHPGDPLQPVYTGVHPQYG-GIAYPAAYAAGQFQQVLAQHPAIAVQAQKEGQDPYNANVYMYPVVAQPASEKEHTPGSMPVDPLHAGITHPGQQEFERRFGNRTGPEGCNLFIYHLPQEFGDAELAQMFMPFGNVISAKVYVDRATNQSKCFGFVSFDNPTSAQAAIQAMNGFQIGMKRLKVQLKRPK 422          
BLAST of bruno-like vs. Ensembl Cavefish
Match: celf3b (cugbp, Elav-like family member 3b [Source:ZFIN;Acc:ZDB-GENE-110408-50])

HSP 1 Score: 231.876 bits (590), Expect = 2.327e-70
Identity = 152/393 (38.68%), Postives = 202/393 (51.40%), Query Frame = 3
Query:  117 QNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQ--NVGYYNQGIVPMIQFPHATDQQTANLIN-AYALQMHLSQMYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIPMSP---ALNSYINPAHPQLINIANINFTPEALHLPSLYSMFPQCGFNLNTP-----------------ALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            +   E+ KLF+GML K Q +DDVR++ E +G I  C IL+   G SKGCAFV + +  EA  AI SL+G +T    P   S +V + AD E+ER LR+MQ     + + +P   N+G YN     ++Q       Q+A L   A    + + QM + N    +      +TP      P                   PSI    +P  P   ALN Y +P    +   AN     E ++   ++    Q    +  P                 A GL   + +P    L  Q QQ ++         GPEGCN+FIYHLPQ+F D+ L Q+F PFGNVISAKV++DRATNQSKCFGFVSFDN ++A+ AI+ MNGFQIG KRLKVQLKRPK
Sbjct:   13 EGRGEDRKLFVGMLGKQQEDDDVRKMFELFGRIDECTILRAPDGTSKGCAFVKFQSHAEAQAAINSLHGSRT---LPGASSSLVVKFADTEKERGLRRMQQVASQLSVFSPMTLNLGAYNAYAQALVQQQQTLVAQSAYLSPIATVATVQMQQMAALNANGIIATPITPITPSSGTNTP-------------------PSIAATPVPALPPPIALNGY-SP----VPTAANGQSASETIYTNGIHPFQAQSAVAVLDPLQQAYTGMQHYTAAYPAAYGLVS-SPFPQQPTLVPQQQQQRE---------GPEGCNIFIYHLPQEFTDSELLQMFVPFGNVISAKVFVDRATNQSKCFGFVSFDNPTSAQTAIQAMNGFQIGMKRLKVQLKRPK 368          
BLAST of bruno-like vs. Ensembl Cavefish
Match: ENSAMXT00000012369.2 (CUGBP Elav-like family member 5 [Source:NCBI gene;Acc:103039850])

HSP 1 Score: 236.113 bits (601), Expect = 6.927e-70
Identity = 152/392 (38.78%), Postives = 203/392 (51.79%), Query Frame = 3
Query:  117 QNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGYYNQGIVPMIQFPHATDQQTANLINAY------------ALQMHLSQMYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIPMSPALNSYINPA-----HPQLINIANINFTPEALHLPSLYSMFPQCGFNLNTPALGLSGQN-IYPNTT----ALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            ++  E+ KLF+GMLNK Q+E+DV ++ EPYG I+ C +L+   GNSKGCAFV ++   EA  AI  L+G +T    P   S +V + AD ++ER +R+MQ       +  P     ++        + HA  QQ A ++ A             A Q+H     + N  PP                PM+  + +SS   ++   V PSI      ++P +N +   A     HP     AN         LP   +  P     L     G+     IYP TT      +L          +     GPEGCNLFIYHLPQ+FGD  L Q+F PFG+VIS+KV++DRATNQSKCFGFVSFDN ++A AAI+ MNGFQIG KRLKVQLKRPK
Sbjct:  192 ESRGEDRKLFVGMLNKQQTEEDVYRIFEPYGVIEECTVLRGPDGNSKGCAFVKFSTHTEAQSAIGGLHGSQT---MPGASSSLVVKFADTDKERTIRRMQQMVGQFGIFNPAVALPFSTYSSTYSTYTHALMQQQAAIMAASHGAYLAPSMAFPATQIHQVGALNMNGLPP---------------TPMTPVSGLSSPPANLASSV-PSI------VTPIVNGFTGIAPQPNGHPVEAVYAN--------GLPPYSTQSPTAADTLQQAFTGVQQYTAIYPTTTLTPIGQTLPQPPQVIQQQQQQQREGPEGCNLFIYHLPQEFGDNELMQMFLPFGSVISSKVFMDRATNQSKCFGFVSFDNPASAHAAIQAMNGFQIGMKRLKVQLKRPK 550          

HSP 2 Score: 63.1586 bits (152), Expect = 4.630e-10
Identity = 42/130 (32.31%), Postives = 70/130 (53.85%), Query Frame = 3
Query:   30 SKMQVASPIN-VDSMALYSNGFTDKGNIIIQNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSY-GNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKM 413
            +++  A P++  ++++++++G T K    I       KLFIG + +N  E D++ L E +G I    +LKD Y G  KGCAF+TY   + A  A  +L+  KT    P +   I  + AD+E   + RK+
Sbjct:   81 AQITFAKPMSGSEAVSIHADGGTMKDQDAI-------KLFIGQIPRNLEEKDLKPLFEQFGKIHELTVLKDRYTGMHKGCAFLTYCARESAIKAQNALHEQKT---LPGMTRPIQVKPADSESRGEDRKL 200          
BLAST of bruno-like vs. Ensembl Cavefish
Match: celf3a (cugbp, Elav-like family member 3a [Source:NCBI gene;Acc:57922])

HSP 1 Score: 230.72 bits (587), Expect = 7.075e-70
Identity = 152/379 (40.11%), Postives = 212/379 (55.94%), Query Frame = 3
Query:  132 NTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQ--NVGYYNQGIVPMIQFPHATDQQTANL---INAYALQMHLSQMYSPN--LTPPLVNSSPSV---TPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIPMSPALNSYINPAHPQLINIANINFTPEAL----HLPSLYSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            + KLF+GML K QS+ DVR++ EP+G I+ C +L+   G SKGCAFV Y ++ EA  AI +L+G +T    P   S +V + AD E+ER +R+MQ     + +++P   ++G YN     ++Q   A   Q+A L       A+QM      +PN  +  P+ + +PS    TP      P+ A       Q ++N +  P +       S +   Y N  HP       ++   +A     H  + Y             A GL GQ      T ++ Q QQ Q+   ++    GPEGCN+FIYHLPQ+F D+ + Q+F PFGNVISAKV++DRATNQSKCFGFVSFDN ++A+ AI+ MNGFQIG KRLKVQLKRPK
Sbjct:   17 DRKLFVGMLGKQQSDADVRKMFEPFGSIEECTVLRGPDGVSKGCAFVKYQSNAEAQAAISALHGSRT---LPGASSSLVVKFADTEKERGIRRMQQVASQLGVISPMSLHLGAYNAYTQALVQ-QQALVAQSAYLSPVATVAAVQMQQLAALNPNSIIATPIASITPSSGTSTPPAIAATPVPALPP----QIAVNSY--PPVPAPPSGQSASEALYTNGVHPYQAQSPALDPLQQAYTGMQHYTATYPA-----------AYGLVGQPFPHQHTLVAQQPQQPQQLQQRE----GPEGCNIFIYHLPQEFTDSEMLQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPASAQTAIQAMNGFQIGMKRLKVQLKRPK 370          
BLAST of bruno-like vs. Ensembl Cavefish
Match: si:dkey-205h23.2 (si:dkey-205h23.2 [Source:ZFIN;Acc:ZDB-GENE-120215-101])

HSP 1 Score: 231.491 bits (589), Expect = 6.370e-69
Identity = 149/392 (38.01%), Postives = 201/392 (51.28%), Query Frame = 3
Query:  117 QNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGYYNQGIVPMIQFPHATDQQTANLINA------------------YALQMHLSQMYSPNLTPPLVNSSP---SVTPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIPMSPALNSYINPAHPQLINIANINFTPEALHLPSLYSMFPQCGFNLNTP-ALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            +   E+ KLF+GML K QSE+DVR+L E +G I+ C +L+   G SKGCAFV +++  EA  AI +L+G +T    P   S +V + AD ++ER +R+M      + + +P  + +   G      + HA  QQ A L+ A                       +++ + +  +TP    S+P   S T  P I  P+   N  S+         LP  N +  P S  +  Y N  HP                       +P     +  P     +G   Y    +    Y     +    + V  PEGCNLFIYHLPQ+FGDA L Q+F PFGNVISAKV++DRATNQSKCFGFVSFDN S+A+AAI+ MNGFQIG KRLKVQLKRPK
Sbjct:  135 EGRGEDRKLFVGMLGKQQSEEDVRRLFEAFGQIEECTVLRGPDGASKGCAFVKFSSHAEAQAAINTLHGGQT---MPGASSSLVVKFADTDKERTMRRMHQMAGQLGIFSPMTIQFGAYGA-----YTHAMMQQQAALMAASQGSYLNPMAAIAAAQMQQMAAFNVNGLVAAPMTPSSGTSTPPGISATAVPSIAAPI-GVNGFSA---------LPQSNGQ--PASEPI--YTNGIHP-----------------------YPAQSPTVTDPLQQAYAGVQHYAGAFSFPFIYFSIPSNISSSSSVLWPEGCNLFIYHLPQEFGDAELMQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPSSAQAAIQAMNGFQIGMKRLKVQLKRPK 481          
BLAST of bruno-like vs. Ensembl Cavefish
Match: ENSAMXT00000034315.1 (pep primary_assembly:Astyanax_mexicanus-2.0:5:21901697:21908852:1 gene:ENSAMXG00000034719.1 transcript:ENSAMXT00000034315.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 149.058 bits (375), Expect = 1.927e-42
Identity = 67/84 (79.76%), Postives = 76/84 (90.48%), Query Frame = 3
Query:  975 GPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            GPEGCNLFIYHLPQ+FGD  L Q+F PFG VIS+KV++DRATNQSKCFGFVSFDN ++A+AAI+ MNGFQIG KRLKVQLKRPK
Sbjct:   35 GPEGCNLFIYHLPQEFGDNELMQMFLPFGTVISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK 118          
BLAST of bruno-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008846.1 (pep scaffold:Pmarinus_7.0:GL480623:147895:156346:1 gene:ENSPMAG00000008007.1 transcript:ENSPMAT00000008846.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 135.191 bits (339), Expect = 1.728e-38
Identity = 62/88 (70.45%), Postives = 74/88 (84.09%), Query Frame = 3
Query:  975 GPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPKGEYK 1238
            GPEG NLFIYHLPQ+FGD  L Q F PFG+V+S+KV++D+ TN SKCFGFVS+DN  +A+AAI+ MNGFQIGTKRLKVQLKR K + K
Sbjct:    1 GPEGANLFIYHLPQEFGDQDLMQTFMPFGSVVSSKVFVDKQTNLSKCFGFVSYDNPISAQAAIQAMNGFQIGTKRLKVQLKRSKNDSK 88          
BLAST of bruno-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002852.1 (pep scaffold:Pmarinus_7.0:GL477021:232626:260651:-1 gene:ENSPMAG00000002591.1 transcript:ENSPMAT00000002852.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.6406 bits (187), Expect = 7.618e-16
Identity = 35/103 (33.98%), Postives = 62/103 (60.19%), Query Frame = 3
Query:  129 ENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQ 437
            E  KLFIGM++K  SE+D+R +  P+G ++ C +L+   G SKGCAF+TY     A  AI+ ++  +T   C    +  + + AD +++++ +++Q Q   +Q
Sbjct:  142 EERKLFIGMISKKCSENDIRAMFSPFGQMEECRVLRGPDGQSKGCAFITYTARAMAQNAIKGMHQSQTMEGC----AAPLVKFADTQKDKEQKRLQQQLAHMQ 240          
BLAST of bruno-like vs. Ensembl Sea Lamprey
Match: pabpc4 (poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:ZFIN;Acc:ZDB-GENE-030131-9663])

HSP 1 Score: 65.855 bits (159), Expect = 1.003e-11
Identity = 41/122 (33.61%), Postives = 64/122 (52.46%), Query Frame = 3
Query:  882 LSGQNIYPNTTALSLQYQQNQK---DGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPKGEYK 1238
            L+G+ IY        + Q   K   + +K   ++  +G NL++ +L  +  D  L + F+PFG + SAKV ++    +S+ FGFV F +   A  A+  MNG  IG+K L V L + K E K
Sbjct:  117 LNGRAIYVGRAQKKAERQTELKRKFEMLKQERMSKYQGVNLYVKNLDDNINDERLWKEFSPFGTITSAKVMME--EGRSRGFGFVCFSSPEEATKAVTEMNGRIIGSKPLYVALAQRKEERK 236          
BLAST of bruno-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007448.1 (pep scaffold:Pmarinus_7.0:GL479027:131562:138944:-1 gene:ENSPMAG00000006727.1 transcript:ENSPMAT00000007448.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 8.174e-11
Identity = 26/66 (39.39%), Postives = 38/66 (57.58%), Query Frame = 3
Query:  990 NLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQI 1187
            NL+I  LP    D  L +L  P+G ++S K  LD+ TNQ K +GFV FD+ + A+ A+  +    I
Sbjct:   56 NLYIRGLPPHTSDQDLVKLCHPYGKIVSTKAILDKTTNQCKGYGFVDFDSPTAAQKAVTALKATGI 121          
BLAST of bruno-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008168.1 (pep scaffold:Pmarinus_7.0:GL476829:41182:80090:-1 gene:ENSPMAG00000007358.1 transcript:ENSPMAT00000008168.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 1.723e-10
Identity = 31/82 (37.80%), Postives = 43/82 (52.44%), Query Frame = 3
Query:  990 NLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPKGEY 1235
            NL+I  LP    D  L +L  P+G ++S K  LD+ TNQ K +GFV FD  S A+ A+  +    I  +  K Q + P   Y
Sbjct:   36 NLYIRGLPPGTTDQDLVKLCQPYGKIVSTKAILDKTTNQCKGYGFVDFDGPSAAQKAVTALKASGIQAQMAKQQEQDPTNLY 117          
BLAST of bruno-like vs. Ensembl Yeast
Match: NSR1 (Nucleolar protein that binds nuclear localization sequences; required for pre-rRNA processing and ribosome biogenesis; binds to single stranded telomeric DNA and mRNA; methylated by Hmt1p; interaction with Top1p and nucleolar localization are negatively regulated by polyphosphorylation [Source:SGD;Acc:S000003391])

HSP 1 Score: 55.8398 bits (133), Expect = 9.841e-9
Identity = 26/69 (37.68%), Postives = 39/69 (56.52%), Query Frame = 3
Query:  981 EGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQI 1187
            E   +F+  L     D  L + F   G VI A+V  +R T++S+ +G+V F+N S AE AI+ M G +I
Sbjct:  166 EPATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEMQGKEI 234          
BLAST of bruno-like vs. Ensembl Yeast
Match: RNA15 (Component of the cleavage and polyadenylation factor I (CF I); CF 1, composed of the CF 1A complex (Rna14p, Rna15p, Clp1p, Pcf11p) and Hrp1, is involved in cleavage and polyadenylation of mRNA 3' ends; interacts with the A-rich polyadenylation signal in complex with Rna14p and Hrp1p; mutant displays reduced transcription elongation in the G-less-based run-on (GLRO) assay; required for gene looping and maintenance of genome stability [Source:SGD;Acc:S000003012])

HSP 1 Score: 52.373 bits (124), Expect = 7.245e-8
Identity = 24/89 (26.97%), Postives = 50/89 (56.18%), Query Frame = 3
Query:  939 NQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLK 1205
            N++ G+   +   P    +++  +P D  +  +  L +  G VI+ K+  D  T +SK + F+ F +  ++ +A+R +NG+Q+G++ LK
Sbjct:    2 NRQSGVNAGVQNNPPSRVVYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAVRNLNGYQLGSRFLK 90          
BLAST of bruno-like vs. Ensembl Yeast
Match: PAB1 (Poly(A) binding protein; part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G; stimulates, but is not required for the deadenylation activity of the Pan2p-Pan3p poly(A)-ribonuclease complex [Source:SGD;Acc:S000000967])

HSP 1 Score: 51.9878 bits (123), Expect = 1.737e-7
Identity = 33/106 (31.13%), Postives = 51/106 (48.11%), Query Frame = 3
Query:  990 NLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGF-----------QIGTKRLKVQLKRPKGEYKN*FYFSCQSKDT 1274
            N+FI +L  D  + AL   F+ FG+++S+K+  D    +SK FGFV F+    A+ AI  +NG             +  K    QL+  K  Y N +  +  S+ T
Sbjct:  127 NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDE-NGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETT 231          

HSP 2 Score: 48.1358 bits (113), Expect = 2.616e-6
Identity = 29/82 (35.37%), Postives = 40/82 (48.78%), Query Frame = 3
Query:  981 EGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            +G NLF+ +L     D  L + F P+G + SAKV +     +SK FGFV F     A  AI   N   +  K L V + + K
Sbjct:  320 QGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKV-MRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 400          
BLAST of bruno-like vs. Ensembl Yeast
Match: NAM8 (RNA binding protein, component of the U1 snRNP protein; mutants are defective in meiotic recombination and in formation of viable spores, involved in the formation of DSBs through meiosis-specific splicing of REC107 pre-mRNA; Nam8p regulon embraces the meiotic pre-mRNAs of REC107, HFM1, AMA1 SPO22 and PCH2; the putative RNA binding domains RRM2 and RRM3 are required for Nam8p meiotic function [Source:SGD;Acc:S000001128])

HSP 1 Score: 50.447 bits (119), Expect = 5.208e-7
Identity = 29/86 (33.72%), Postives = 41/86 (47.67%), Query Frame = 3
Query:  963 NIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKR 1220
            N  T P    +FI  L     +  L   F PFG ++  K+ +       KC GFV + +  +AEAAI GM GF I   R+++   R
Sbjct:  305 NHFTDPNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPV------GKCCGFVQYVDRLSAEAAIAGMQGFPIANSRVRLSWGR 384          
BLAST of bruno-like vs. Ensembl Yeast
Match: NGR1 (RNA binding protein that negatively regulates growth rate; interacts with the 3' UTR of the mitochondrial porin (POR1) mRNA and enhances its degradation; overexpression impairs mitochondrial function; interacts with Dhh1p to mediate POR1 mRNA decay; expressed in stationary phase [Source:SGD;Acc:S000000416])

HSP 1 Score: 48.521 bits (114), Expect = 2.244e-6
Identity = 26/84 (30.95%), Postives = 43/84 (51.19%), Query Frame = 3
Query:  972 TGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRP 1223
            T P    +F+  L     +  L  LF PFG +++ ++      N   C GFV F+   +AEA+I+G+ GF +G   +++   RP
Sbjct:  355 TDPTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRI-----PNGKNC-GFVKFEKRIDAEASIQGLQGFIVGGSPIRLSWGRP 432          
BLAST of bruno-like vs. Ensembl Nematostella
Match: EDO29519 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3E7])

HSP 1 Score: 134.42 bits (337), Expect = 5.509e-37
Identity = 65/99 (65.66%), Postives = 76/99 (76.77%), Query Frame = 3
Query:  930 YQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            YQQ  +   K+    GP+G NLFIYHLPQ+F DA L Q F PFG VISAKV++D+ TN SKCFGFVS+DN  +A+ AI+ MNGFQIG KRLKVQLKRPK
Sbjct:   59 YQQTARQPQKE----GPDGSNLFIYHLPQEFTDADLMQTFQPFGTVISAKVFIDKQTNMSKCFGFVSYDNVMSAQNAIQHMNGFQIGAKRLKVQLKRPK 153          
BLAST of bruno-like vs. Ensembl Nematostella
Match: EDO30576 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0E1])

HSP 1 Score: 135.576 bits (340), Expect = 1.761e-34
Identity = 65/101 (64.36%), Postives = 77/101 (76.24%), Query Frame = 3
Query:  930 YQQNQKDGIKD--NIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            YQQ  +   K+  +   GP+G NLFIYHLPQ+F DA L Q F PFG VISAKV++D+ TN SKCFGFVS+DN  +A+ AI+ MNGFQIG KRLKVQLKRPK
Sbjct:  349 YQQTARQPQKEESHYTPGPDGSNLFIYHLPQEFTDADLMQTFQPFGTVISAKVFIDKQTNMSKCFGFVSYDNVMSAQNAIQHMNGFQIGAKRLKVQLKRPK 449          

HSP 2 Score: 66.2402 bits (160), Expect = 1.226e-11
Identity = 39/108 (36.11%), Postives = 60/108 (55.56%), Query Frame = 3
Query:   93 TDKGNIIIQNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSY-GNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKM 413
            T+ G   +++ + + KLF+G + +   E D+R + EPYG I    ILKD Y G  KGCAF+T+ + D  N A + L+  KT    P +   I  + AD+E +   RK+
Sbjct:    7 TNGGTTSVRDSN-SVKLFVGQVPRTWEEKDLRPIFEPYGQIYELTILKDKYTGQHKGCAFLTFCSRDACNAAQKHLHEKKT---LPGMHHPIQVKPADSETKSDDRKL 110          
BLAST of bruno-like vs. Ensembl Nematostella
Match: EDO34879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN30])

HSP 1 Score: 67.781 bits (164), Expect = 2.623e-12
Identity = 41/102 (40.20%), Postives = 54/102 (52.94%), Query Frame = 3
Query:  972 TGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPKG-EYKN-*FYFSCQSKD 1271
            T  E  NL I ++P       + ++F   GNV S K+  DRAT QS  + FV++DN  +A  A+R MNG ++  K LKV   RP   E KN   Y S   KD
Sbjct:    5 TSDERTNLIINYVPPSMSQEDIKKIFGTVGNVTSCKLIRDRATGQSLGYAFVNYDNPDDANKAVREMNGARLQNKTLKVSFARPSSTEIKNANLYISGLPKD 106          

HSP 2 Score: 52.373 bits (124), Expect = 2.546e-7
Identity = 24/69 (34.78%), Postives = 43/69 (62.32%), Query Frame = 3
Query:  126 DENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKD-SYGNSKGCAFVTYNNSDEANMAIESLNGMK 329
            DE T L I  +  + S++D++++    G + +C +++D + G S G AFV Y+N D+AN A+  +NG +
Sbjct:    7 DERTNLIINYVPPSMSQEDIKKIFGTVGNVTSCKLIRDRATGQSLGYAFVNYDNPDDANKAVREMNGAR 75          

HSP 3 Score: 51.9878 bits (123), Expect = 3.040e-7
Identity = 26/76 (34.21%), Postives = 42/76 (55.26%), Query Frame = 3
Query:  990 NLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLK 1217
            NL+I  LP+D  +  +  LF PFG +I++KV  D  + + +  GFV FD    A+ AI  +N   +    +K+ +K
Sbjct:   97 NLYISGLPKDMKEEEVEALFKPFGKIITSKVLKD-VSGEGRGTGFVRFDKRCEAQTAIDDLNNKTLPGTNVKLTVK 171          

HSP 4 Score: 50.447 bits (119), Expect = 1.034e-6
Identity = 24/64 (37.50%), Postives = 36/64 (56.25%), Query Frame = 3
Query:  129 ENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLN 320
            +N  L+I  L K+  E++V  L +P+G I    +LKD  G  +G  FV ++   EA  AI+ LN
Sbjct:   94 KNANLYISGLPKDMKEEEVEALFKPFGKIITSKVLKDVSGEGRGTGFVRFDKRCEAQTAIDDLN 157          

HSP 5 Score: 50.0618 bits (118), Expect = 1.192e-6
Identity = 29/83 (34.94%), Postives = 45/83 (54.22%), Query Frame = 3
Query:  978 PEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            P+G  +F+Y LPQ+     L +LF+P+G + + ++ LD+       +GFV+  N   A  AI  +NG     K L+V  K PK
Sbjct:  252 PQGWCIFVYGLPQEATPLFLYKLFSPYGAITNIELKLDKG------YGFVNMSNYEEACHAICCLNGTPQHGKILQVSFKTPK 328          
BLAST of bruno-like vs. Ensembl Nematostella
Match: EDO35562 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL69])

HSP 1 Score: 57.7658 bits (138), Expect = 6.674e-11
Identity = 24/67 (35.82%), Postives = 44/67 (65.67%), Query Frame = 3
Query:  132 NTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKT 332
            + KLF+GM++K+  E+D+R +  P+G I+   +L+++   SKGCAF+ + N  +A  AI +++   T
Sbjct:    1 DRKLFVGMISKHAKEEDLRVMFSPFGTIEELTVLRNADSTSKGCAFIKFANRMQAQNAIATMHNSTT 67          
BLAST of bruno-like vs. Ensembl Nematostella
Match: EDO33926 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQW0])

HSP 1 Score: 63.929 bits (154), Expect = 8.087e-11
Identity = 36/113 (31.86%), Postives = 59/113 (52.21%), Query Frame = 3
Query:  873 ALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEG-CNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKV 1208
            A+GLSGQ +      + L   +  +   +   +  P G   L++  L  +  +A +  +F PFG V S ++  D  TN+SK +GFV F  A  A+ A+  MNGF++  + LK+
Sbjct:  176 AIGLSGQKLLGAPIMVMLTQAEKNRLAAEAERLKQPLGPTRLYVGSLHFNITEAMVKAVFEPFGTVDSVQLIYDSETNRSKGYGFVQFREAEAAKRAMEQMNGFELAGRPLKI 288          

HSP 2 Score: 49.6766 bits (117), Expect = 2.252e-6
Identity = 23/66 (34.85%), Postives = 41/66 (62.12%), Query Frame = 3
Query:  135 TKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGN-SKGCAFVTYNNSDEANMAIESLNGMK 329
            T+L++G L+ N +E  V+ + EP+G + +  ++ DS  N SKG  FV +  ++ A  A+E +NG +
Sbjct:  215 TRLYVGSLHFNITEAMVKAVFEPFGTVDSVQLIYDSETNRSKGYGFVQFREAEAAKRAMEQMNGFE 280          
BLAST of bruno-like vs. Ensembl Medaka
Match: celf5b (CUGBP Elav-like family member 5 [Source:NCBI gene;Acc:101171069])

HSP 1 Score: 235.728 bits (600), Expect = 3.680e-70
Identity = 156/387 (40.31%), Postives = 209/387 (54.01%), Query Frame = 3
Query:  117 QNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGYYNQGIV-PMIQFPHATDQQTANLINAYALQMHLSQMYSPNLTPPL----------VNSSPSVTPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIPMSPALNSYIN-PAHPQLINIANINFTPEALHLPSLYSMFPQCGFNLNTPALGLSGQN-IYPNTTALSLQYQQNQKDGI----KDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            ++  E+ KLF+GMLNK Q+E+DV +L EPYG I+ C +L+   GNSKGCAFV ++   EA  AI +L+G +T    P   S +V + AD ++ER +R+MQ           Q VG +  GI  P I  P +T    A+   A  +        +P++  P           +NS P   P P    P+SA   +SS   ++    +PSI      ++P +N +   P  P         +T     LP   +  P     L     G+     IYP TT   +     Q   +    +     GPEGCNLFIYHLPQ+FGD  L Q+F PFG VIS+KV++DRATNQSKCFGFVSFDN ++A+AAI+ MNGFQIG KRLKVQLKRPK
Sbjct:  159 ESRGEDRKLFVGMLNKQQTEEDVYRLFEPYGVIEECTVLRGPDGNSKGCAFVKFSAHTEAQSAIGALHGSQT---MPGASSSLVVKFADTDKERTIRRMQ-----------QMVGQF--GIFNPAIALPFSTYSSYAHAQQAAIMAASHGGYLTPSVAFPATQIHQMGPLNINSLP---PTPM--TPVSAG--LSSPPANITTSAVPSI------VTPIVNGFTGIPHQPNGHPAVETVYT---NGLPPYSTQSPNAADTLQQAFTGVQQYTAIYPATTLTPISQTLPQAPQVIQQQQQQQREGPEGCNLFIYHLPQEFGDNELMQMFLPFGTVISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK 513          

HSP 2 Score: 61.6178 bits (148), Expect = 1.280e-9
Identity = 36/93 (38.71%), Postives = 51/93 (54.84%), Query Frame = 3
Query:  138 KLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSY-GNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKM 413
            KLFIG + +N  E D++ L E +G I    +LKD Y G  KGCAF+TY   + A  A  +L+  KT    P +   I  + AD+E   + RK+
Sbjct:   78 KLFIGQIPRNLEEKDLKPLFEQFGKIHELTVLKDRYTGMHKGCAFLTYCARESAIKAQNALHEQKT---LPGMTRPIQVKPADSESRGEDRKL 167          
BLAST of bruno-like vs. Ensembl Medaka
Match: celf5b (CUGBP Elav-like family member 5 [Source:NCBI gene;Acc:101171069])

HSP 1 Score: 234.187 bits (596), Expect = 4.469e-70
Identity = 157/393 (39.95%), Postives = 208/393 (52.93%), Query Frame = 3
Query:  129 ENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGYYNQGIV-PMIQFP--------HATDQQTANLINAY------------ALQMHLSQMYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIPMSPALNSYIN-PAHPQLINIANINFTPEALHLPSLYSMFPQCGFNLNTPALGLSGQN-IYPNTTALSLQYQQNQKDGI----KDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            ++ KLF+GMLNK Q+E+DV +L EPYG I+ C +L+   GNSKGCAFV ++   EA  AI +L+G +T    P   S +V + AD ++ER +R+MQ           Q VG +  GI  P I  P        HA  QQ A ++ A             A Q+H        + P  +NS P          PM+  + +SS   ++    +PSI      ++P +N +   P  P         +T     LP   +  P     L     G+     IYP TT   +     Q   +    +     GPEGCNLFIYHLPQ+FGD  L Q+F PFG VIS+KV++DRATNQSKCFGFVSFDN ++A+AAI+ MNGFQIG KRLKVQLKRPK
Sbjct:  118 KDRKLFVGMLNKQQTEEDVYRLFEPYGVIEECTVLRGPDGNSKGCAFVKFSAHTEAQSAIGALHGSQT---MPGASSSLVVKFADTDKERTIRRMQ-----------QMVGQF--GIFNPAIALPFSTYSSYAHALMQQQAAIMAASHGGYLTPSVAFPATQIH-------QMGPLNINSLPPT--------PMTPVSGLSSPPANITTSAVPSI------VTPIVNGFTGIPHQPNGHPAVETVYT---NGLPPYSTQSPNAADTLQQAFTGVQQYTAIYPATTLTPISQTLPQAPQVIQQQQQQQREGPEGCNLFIYHLPQEFGDNELMQMFLPFGTVISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK 470          

HSP 2 Score: 55.8398 bits (133), Expect = 8.512e-8
Identity = 29/66 (43.94%), Postives = 39/66 (59.09%), Query Frame = 3
Query:  138 KLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSY-GNSKGCAFVTYNNSDEANMAIESLNGMKT 332
            KLFIG + +N  E D++ L E +G I    +LKD Y G  KGCAF+TY   + A  A  +L+  KT
Sbjct:   48 KLFIGQIPRNLEEKDLKPLFEQFGKIHELTVLKDRYTGMHKGCAFLTYCARESAIKAQNALHEQKT 113          
BLAST of bruno-like vs. Ensembl Medaka
Match: celf3a (CUGBP Elav-like family member 3 [Source:NCBI gene;Acc:101163095])

HSP 1 Score: 232.646 bits (592), Expect = 7.989e-70
Identity = 158/383 (41.25%), Postives = 213/383 (55.61%), Query Frame = 3
Query:  126 DENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQ--NVGYYNQGIVPMIQFPHATDQQTANL---INAYALQMHLSQMYSPN--LTPPLVNSSPSVTPQPQIGVPMS-AANDISSNQCSMNHFVLPSINNENIPMSPALNS--------YINPAHPQLINIANINFTPEALHLPSLYSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            DE+ KLF+GML K Q++ DVR++ EP+G I+ C +L+   G SKGCAFV + ++ EA  AI +L+G +T    P   S +V + AD+E+ER LR+MQ     + +++P   ++G YN     ++Q   A   Q+A L       A+QM      +PN  +  P+     S+TP      P S AA  + +        + P I   + P  PA  S        Y N  H      A  NF      L S+ + +P         A  L GQ      T ++ Q QQ Q+         GPEGCN+FIYHLPQ+F D+ + Q+F PFGNVISAKV++DRATNQSKCFGFVSFDN S+A+ AI+ MNGFQIG KRLKVQLKRPK
Sbjct:   90 DEDRKLFVGMLGKQQTDADVRKMFEPFGSIEECTVLRGPDGTSKGCAFVKFQSNAEAQAAINALHGSRT---LPGASSSLVVKFADSEKERGLRRMQQVASQLGVISPMTLHLGAYNAYTQALMQ-QQALVAQSAYLSPVATVAAVQMQQLAALNPNSIIATPIA----SITPSSGTSTPPSIAATPVPA--------LPPPIAVNSYPSVPAPPSGQSATEALYTNGVH--AYQGAKHNFLLVVKLLQSMLATYPA--------AYSLVGQPFPHQPTLVAQQPQQLQQR-------EGPEGCNIFIYHLPQEFTDSEILQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPSSAQTAIQAMNGFQIGMKRLKVQLKRPK 439          

HSP 2 Score: 53.1434 bits (126), Expect = 5.298e-7
Identity = 27/66 (40.91%), Postives = 39/66 (59.09%), Query Frame = 3
Query:  138 KLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSY-GNSKGCAFVTYNNSDEANMAIESLNGMKT 332
            KLFIG + +N  E D++ + E +G I    ++KD Y G  KGCAF+TY   + A  A  +L+  KT
Sbjct:    8 KLFIGQIPRNLEEKDLKPIFEQFGKIYELTVIKDKYTGMHKGCAFLTYCARESALKAQNALHEQKT 73          
BLAST of bruno-like vs. Ensembl Medaka
Match: celf3b (CUGBP Elav-like family member 3 [Source:NCBI gene;Acc:101160192])

HSP 1 Score: 226.098 bits (575), Expect = 9.435e-67
Identity = 154/393 (39.19%), Postives = 208/393 (52.93%), Query Frame = 3
Query:  117 QNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGY-----YNQGIVPMIQFPHATDQQTANL---INAYALQMHLSQMYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIPMSP---ALNSYIN---PAHPQLINIANINF-------TPEALH-LPSLYSMFPQCGFNLNTPA-LGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPK 1226
            +   E+ KLF+GML K Q+++DVR+L EP+G I  C +L+   G SKGCAFV +    EA  AI SL+G +T    P   S +V + AD E+ER LR+MQ     + + +P  + +     Y Q +   +    A   Q+A L       A+QM   QM + N    +      +TP      P                   P+I    +P  P    +N Y +   P + Q       N        +P AL  L   Y+      +    PA  GL GQ      T ++ Q+QQ Q+   ++    GPEGCN+FIYHLPQ+F D+ + Q+F PFGNVISAKV++DRATNQSKCFGFVSFDN ++A+AAI+ MNGFQIG KRLKVQLKRPK
Sbjct:  122 EGRGEDRKLFVGMLGKQQTDEDVRRLFEPFGTIDECTVLRGPDGTSKGCAFVKFQGHAEAQAAINSLHGSRT---MPGASSSLVVKFADTEKERGLRRMQQVASQLGIFSPMTLNFPAYNAYTQAVNAQLVQHQALVAQSAYLSPVATVAAVQMQ--QMAALNANGIIATPITPITPSSGTNTP-------------------PAIAATPVPALPPPIGMNGYSSVPAPTNGQQTETLYTNGVHQYQAQSPAALDPLQQAYAGMQH--YTAAYPAAYGLVGQPFPQQQTLVAQQHQQPQQQQQRE----GPEGCNIFIYHLPQEFSDSEMLQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK 484          

HSP 2 Score: 60.077 bits (144), Expect = 3.621e-9
Identity = 33/104 (31.73%), Postives = 55/104 (52.88%), Query Frame = 3
Query:  105 NIIIQNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSY-GNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKM 413
            + ++    +  KLF+G + +N  E D++ + E +G I    ++KD Y G  KGCAF+TY   + A  A  +L+  KT    P +   I  + AD+E   + RK+
Sbjct:   30 HFVLMKEADAIKLFVGQIPRNLEEKDLKPIFEQFGKIYELTVIKDKYTGMHKGCAFLTYCARESALKAQSALHEQKT---LPGMNRPIQVKPADSEGRGEDRKL 130          
BLAST of bruno-like vs. Ensembl Medaka
Match: CELF2 (CUGBP Elav-like family member 2 [Source:NCBI gene;Acc:101168417])

HSP 1 Score: 182.956 bits (463), Expect = 1.911e-50
Identity = 138/403 (34.24%), Postives = 198/403 (49.13%), Query Frame = 3
Query:  120 NHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQM----------------QFPAIQLLTPQNVGYYNQGIVPMIQFPHATDQQTANLINAYALQMHLSQMYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIPMSPALNSYINPAHPQLINIANINFTPEALHLPSLYSMFPQ------------CGFNLNTPALGLSGQNIYPNTTALSLQYQQN--QKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPKGEYK 1238
            N  E+ KLFIGM++K  +E+D+R +   +G I+ C IL+   G S+GCAFVT++    A  AI++++  +T   C    S IV + AD +++++ R++Q                     +  LTPQ +    Q          +  QQ A +    ALQ+      +        ++SPS             AN +SSN  S+     P+    +   + A+NS  +    Q +  A +          SL SM                   ++      SG   Y    AL   Y Q+  Q+ G   +   GPEG NLFIYHLPQ+FGD  + Q+F PFGNV+SAKV++D+ TN SKCFGFVS+DN  +A+AAI+ MNGFQIG KRLKVQLKR K + K
Sbjct:  139 NAVEDRKLFIGMVSKKCNENDIRVMFSAFGQIEECRILRGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCS---SPIVVKFADTQKDKEQRRLQQQLAQQMQQLNSATTWGSLTGLGGLTPQYLALLQQATSSGNLGAFSGIQQMAGM---SALQLQNLATLAAAAAAAQNSASPST------------ANPLSSNAASLGALASPAGTTAS-SNAGAMNSLTSLGTLQGLAGATVGLNNINALAGSLNSMAALNGGLGGAGLTNGTAGTMDALTQAYSGIQQYA-AAALPTLYSQSLLQQQGAAGSQKEGPEGANLFIYHLPQEFGDQDILQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSK 521          

HSP 2 Score: 57.3806 bits (137), Expect = 2.776e-8
Identity = 34/96 (35.42%), Postives = 54/96 (56.25%), Query Frame = 3
Query:   66 SMALYSNGFTDKGNIIIQNHD----ENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGN---SKGCAFVTYNNSDEANMAIESLNGMKT 332
            S A+ SNG   K N  +++ D    +  K+F+G + ++ SE ++++L EPYG +    IL+D   N   SKGC FVT+     A  A  +L+ +KT
Sbjct:   25 SGAIQSNGTAGKMNGALEHSDQPDPDAIKMFVGQIPRSWSEKELKELFEPYGAVYQINILRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKT 120          
BLAST of bruno-like vs. Planmine SMEST
Match: SMESG000021009.1 (SMESG000021009.1)

HSP 1 Score: 824.313 bits (2128), Expect = 0.000e+0
Identity = 401/402 (99.75%), Postives = 402/402 (100.00%), Query Frame = 3
Query:   36 MQVASPINVDSMALYSNGFTDKGNIIIQNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGYYNQGIVPMIQFPHATDQQTANLINAYALQMHLSQMYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIPMSPALNSYINPAHPQLINIANINFTPEALHLPSLYSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPKGEYKN 1241
            MQVASPINVDSMALYSNGFTDKGNIIIQNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGYYNQGIVPMIQFPHATDQQTANLINAYALQMHLSQMYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIP+SPALNSYINPAHPQLINIANINFTPEALHLPSLYSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPKGEYKN
Sbjct:    1 MQVASPINVDSMALYSNGFTDKGNIIIQNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGYYNQGIVPMIQFPHATDQQTANLINAYALQMHLSQMYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIPLSPALNSYINPAHPQLINIANINFTPEALHLPSLYSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPKGEYKN 402          
BLAST of bruno-like vs. Planmine SMEST
Match: SMESG000021009.1 (SMESG000021009.1)

HSP 1 Score: 819.691 bits (2116), Expect = 0.000e+0
Identity = 401/404 (99.26%), Postives = 402/404 (99.50%), Query Frame = 3
Query:   36 MQVASPINVDSMALYSNGFTDKGNIIIQNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGYYNQGIVPMI--QFPHATDQQTANLINAYALQMHLSQMYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIPMSPALNSYINPAHPQLINIANINFTPEALHLPSLYSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPKGEYKN 1241
            MQVASPINVDSMALYSNGFTDKGNIIIQNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGYYNQGIVPMI  QFPHATDQQTANLINAYALQMHLSQMYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIP+SPALNSYINPAHPQLINIANINFTPEALHLPSLYSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPKGEYKN
Sbjct:    1 MQVASPINVDSMALYSNGFTDKGNIIIQNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGYYNQGIVPMILQQFPHATDQQTANLINAYALQMHLSQMYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIPLSPALNSYINPAHPQLINIANINFTPEALHLPSLYSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPKGEYKN 404          
BLAST of bruno-like vs. Planmine SMEST
Match: SMESG000021009.1 (SMESG000021009.1)

HSP 1 Score: 810.446 bits (2092), Expect = 0.000e+0
Identity = 399/404 (98.76%), Postives = 400/404 (99.01%), Query Frame = 3
Query:   36 MQVASPINVDSMALYSNGFTDKGNIIIQNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGYYNQGIVPMI--QFPHATDQQTANLINAYALQMHLSQMYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIPMSPALNSYINPAHPQLINIANINFTPEALHLPSLYSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPKGEYKN 1241
            MQVASPINVDSMALYSNGFTDKGNIIIQNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNS  CAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGYYNQGIVPMI  QFPHATDQQTANLINAYALQMHLSQMYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIP+SPALNSYINPAHPQLINIANINFTPEALHLPSLYSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPKGEYKN
Sbjct:    1 MQVASPINVDSMALYSNGFTDKGNIIIQNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNS--CAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGYYNQGIVPMILQQFPHATDQQTANLINAYALQMHLSQMYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIPLSPALNSYINPAHPQLINIANINFTPEALHLPSLYSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPKGEYKN 402          
BLAST of bruno-like vs. Planmine SMEST
Match: SMESG000005424.1 (SMESG000005424.1)

HSP 1 Score: 261.536 bits (667), Expect = 4.002e-81
Identity = 178/425 (41.88%), Postives = 224/425 (52.71%), Query Frame = 3
Query:  117 QNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTP--------------------QNVGYYNQGIVPMIQFPHATDQQTANLINAYALQMHLSQ------------MYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIPMSPALNS-YINPAHPQLINIANI--NFTPEALH--------------LPSLYSMFPQCGFN-LNTPALG----LSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPKG 1229
            Q+  E+ KLFIGML K  +EDDVR L +PYG I+ C IL+D  GNSKGCAFV Y    EA  AI +++G   SM  P   S +V + AD E+ERQ RK+Q       L+ P                    QN GY N  I  +        QQ   +     L   LS                 N     V +S ++T Q  +  P +AA+ +  N   MN           I  +  +N   +N +H Q+ N      N TP +L               LP++Y     CG    N P L     L+ Q       ALS+Q QQ  K+G KD I+TGP+G N+FIYHLPQ+FGDA LAQ+F+PFG VISAKVY+DRATNQSKCFGFVSFDN+++A+AAI+ MNGFQIG KRLKVQLKRPKG
Sbjct:    6 QHKGEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHG---SMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENLQQNTGYINP-IATLALQLQQQLQQQQQIALGATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLS-PSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQ-------ALSMQVQQ--KEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKG 416          
BLAST of bruno-like vs. Planmine SMEST
Match: SMESG000005424.1 (SMESG000005424.1)

HSP 1 Score: 260.766 bits (665), Expect = 1.721e-80
Identity = 178/425 (41.88%), Postives = 224/425 (52.71%), Query Frame = 3
Query:  117 QNHDENTKLFIGMLNKNQSEDDVRQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTSMACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTP--------------------QNVGYYNQGIVPMIQFPHATDQQTANLINAYALQMHLSQ------------MYSPNLTPPLVNSSPSVTPQPQIGVPMSAANDISSNQCSMNHFVLPSINNENIPMSPALNS-YINPAHPQLINIANI--NFTPEALH--------------LPSLYSMFPQCGFN-LNTPALG----LSGQNIYPNTTALSLQYQQNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVYLDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPKG 1229
            Q+  E+ KLFIGML K  +EDDVR L +PYG I+ C IL+D  GNSKGCAFV Y    EA  AI +++G   SM  P   S +V + AD E+ERQ RK+Q       L+ P                    QN GY N  I  +        QQ   +     L   LS                 N     V +S ++T Q  +  P +AA+ +  N   MN           I  +  +N   +N +H Q+ N      N TP +L               LP++Y     CG    N P L     L+ Q       ALS+Q QQ  K+G KD I+TGP+G N+FIYHLPQ+FGDA LAQ+F+PFG VISAKVY+DRATNQSKCFGFVSFDN+++A+AAI+ MNGFQIG KRLKVQLKRPKG
Sbjct:   43 QHKGEDRKLFIGMLGKQHTEDDVRDLFKPYGAIEECTILRDQNGNSKGCAFVKYTTRSEAYTAIGAMHG---SMTIPGASSSLVVKFADTEKERQTRKLQQFINPFGLINPGLTLSALGGSAYSQYLENLQQNTGYINP-IATLALQLQQQLQQQQQIALGATLPYTLSTGIPTNDANASQNFLGVNPLAAAVAASQNLTTQSLLS-PSTAASMMMPNNSGMNTMCQVQQQTPIISSATQMNDPSVNISHTQMSNGQTRPQNLTPFSLAAATGANWLASNSTTLPAMYGGLNLCGLAPYNPPTLNPITLLARQ-------ALSMQVQQ--KEGTKDFILTGPDGSNVFIYHLPQEFGDAELAQMFSPFGTVISAKVYIDRATNQSKCFGFVSFDNSNSAQAAIQAMNGFQIGMKRLKVQLKRPKG 453          
The following BLAST results are available for this feature:
BLAST of bruno-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CELF51.135e-6736.54CUGBP Elav-like family member 5 [Source:HGNC Symbo... [more]
CELF34.985e-6638.30CUGBP Elav-like family member 3 [Source:HGNC Symbo... [more]
CELF33.997e-6538.54CUGBP Elav-like family member 3 [Source:HGNC Symbo... [more]
CELF35.843e-6538.03CUGBP Elav-like family member 3 [Source:HGNC Symbo... [more]
CELF61.334e-3966.36CUGBP Elav-like family member 6 [Source:HGNC Symbo... [more]
back to top
BLAST of bruno-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
etr-18.570e-5032.74ELAV-Type RNA binding-protein family [Source:UniP... [more]
etr-18.570e-5032.74ELAV-Type RNA binding-protein family [Source:UniP... [more]
etr-18.570e-5032.74ELAV-Type RNA binding-protein family [Source:UniP... [more]
etr-18.570e-5032.74ELAV-Type RNA binding-protein family [Source:UniP... [more]
etr-13.579e-4832.74ELAV-Type RNA binding-protein family [Source:UniP... [more]
back to top
BLAST of bruno-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bru13.407e-5436.80gene:FBgn0000114 transcript:FBtr0331646[more]
bru13.407e-5436.80gene:FBgn0000114 transcript:FBtr0331998[more]
bru13.407e-5436.80gene:FBgn0000114 transcript:FBtr0331648[more]
bru13.407e-5436.80gene:FBgn0000114 transcript:FBtr0331647[more]
bru15.634e-5436.80gene:FBgn0000114 transcript:FBtr0080345[more]
back to top
BLAST of bruno-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
celf5a2.067e-7040.55cugbp, Elav-like family member 5a [Source:ZFIN;Acc... [more]
celf5a3.232e-7040.82cugbp, Elav-like family member 5a [Source:ZFIN;Acc... [more]
celf3b4.345e-6939.47cugbp, Elav-like family member 3b [Source:ZFIN;Acc... [more]
celf5b4.665e-6939.69cugbp, Elav-like family member 5b [Source:ZFIN;Acc... [more]
celf3b3.386e-6839.05cugbp, Elav-like family member 3b [Source:ZFIN;Acc... [more]
back to top
BLAST of bruno-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tada2a5.868e-6637.47transcriptional adaptor 2A [Source:Xenbase;Acc:XB-... [more]
tada2a3.327e-6537.08transcriptional adaptor 2A [Source:Xenbase;Acc:XB-... [more]
celf22.545e-5133.41CUGBP, Elav-like family member 2 [Source:NCBI gene... [more]
tada2a5.636e-5033.59transcriptional adaptor 2A [Source:Xenbase;Acc:XB-... [more]
tpbg7.680e-4077.11trophoblast glycoprotein [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of bruno-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Celf51.470e-6935.70CUGBP, Elav-like family member 5 [Source:MGI Symbo... [more]
Celf32.935e-6738.48CUGBP, Elav-like family member 3 [Source:MGI Symbo... [more]
Celf31.592e-6537.66CUGBP, Elav-like family member 3 [Source:MGI Symbo... [more]
Celf32.389e-6538.83CUGBP, Elav-like family member 3 [Source:MGI Symbo... [more]
Celf31.697e-6437.66CUGBP, Elav-like family member 3 [Source:MGI Symbo... [more]
back to top
BLAST of bruno-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91579|CEL3A_XENLA2.179e-6737.44CUGBP Elav-like family member 3-A OS=Xenopus laevi... [more]
sp|Q8N6W0|CELF5_HUMAN5.449e-6736.54CUGBP Elav-like family member 5 OS=Homo sapiens OX... [more]
sp|Q9IBD1|CELF3_DANRE7.179e-6740.26CUGBP Elav-like family member 3 OS=Danio rerio OX=... [more]
sp|Q08E07|CELF3_BOVIN6.182e-6638.07CUGBP Elav-like family member 3 OS=Bos taurus OX=9... [more]
sp|Q5SZQ8|CELF3_HUMAN2.394e-6538.30CUGBP Elav-like family member 3 OS=Homo sapiens OX... [more]
back to top
BLAST of bruno-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q0H2190.000e+099.26Bruno-like OS=Schmidtea mediterranea OX=79327 GN=b... [more]
D5JG650.000e+084.21Bruno-like protein OS=Dugesia japonica OX=6161 GN=... [more]
D5JG661.658e-7641.41Trinucleotide repeat containing 4-like protein OS=... [more]
A0A1S3JEN65.044e-7642.79CUGBP Elav-like family member 3-A isoform X5 OS=Li... [more]
A0A1S3JFF08.041e-7540.80CUGBP Elav-like family member 3-A isoform X8 OS=Li... [more]
back to top
BLAST of bruno-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
celf3b2.327e-7038.68cugbp, Elav-like family member 3b [Source:ZFIN;Acc... [more]
ENSAMXT00000012369.26.927e-7038.78CUGBP Elav-like family member 5 [Source:NCBI gene;... [more]
celf3a7.075e-7040.11cugbp, Elav-like family member 3a [Source:NCBI gen... [more]
si:dkey-205h23.26.370e-6938.01si:dkey-205h23.2 [Source:ZFIN;Acc:ZDB-GENE-120215-... [more]
ENSAMXT00000034315.11.927e-4279.76pep primary_assembly:Astyanax_mexicanus-2.0:5:2190... [more]
back to top
BLAST of bruno-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008846.11.728e-3870.45pep scaffold:Pmarinus_7.0:GL480623:147895:156346:1... [more]
ENSPMAT00000002852.17.618e-1633.98pep scaffold:Pmarinus_7.0:GL477021:232626:260651:-... [more]
pabpc41.003e-1133.61poly(A) binding protein, cytoplasmic 4 (inducible ... [more]
ENSPMAT00000007448.18.174e-1139.39pep scaffold:Pmarinus_7.0:GL479027:131562:138944:-... [more]
ENSPMAT00000008168.11.723e-1037.80pep scaffold:Pmarinus_7.0:GL476829:41182:80090:-1 ... [more]
back to top
BLAST of bruno-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
NSR19.841e-937.68Nucleolar protein that binds nuclear localization ... [more]
RNA157.245e-826.97Component of the cleavage and polyadenylation fact... [more]
PAB11.737e-731.13Poly(A) binding protein; part of the 3'-end RNA-pr... [more]
NAM85.208e-733.72RNA binding protein, component of the U1 snRNP pro... [more]
NGR12.244e-630.95RNA binding protein that negatively regulates grow... [more]
back to top
BLAST of bruno-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO295195.509e-3765.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO305761.761e-3464.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348792.623e-1240.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355626.674e-1135.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339268.087e-1131.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of bruno-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
celf5b3.680e-7040.31CUGBP Elav-like family member 5 [Source:NCBI gene;... [more]
celf5b4.469e-7039.95CUGBP Elav-like family member 5 [Source:NCBI gene;... [more]
celf3a7.989e-7041.25CUGBP Elav-like family member 3 [Source:NCBI gene;... [more]
celf3b9.435e-6739.19CUGBP Elav-like family member 3 [Source:NCBI gene;... [more]
CELF21.911e-5034.24CUGBP Elav-like family member 2 [Source:NCBI gene;... [more]
back to top
BLAST of bruno-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000021009.10.000e+099.75SMESG000021009.1[more]
SMESG000021009.10.000e+099.26SMESG000021009.1[more]
SMESG000021009.10.000e+098.76SMESG000021009.1[more]
SMESG000005424.14.002e-8141.88SMESG000005424.1[more]
SMESG000005424.11.721e-8041.88SMESG000005424.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30023062
GenBankABC70476.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023062 ID=SMED30023062|Name=bruno-like|organism=Schmidtea mediterranea sexual|type=transcript|length=1749bp
TGTAATTGAAGGCTGTAGACAAAGACAACTCTAAAATGCAAGTTGCTTCT
CCTATTAATGTCGATAGCATGGCTTTATATTCTAACGGGTTTACAGATAA
AGGAAATATTATAATTCAAAACCATGATGAAAATACAAAGTTGTTTATTG
GGATGCTTAATAAAAATCAATCAGAAGATGATGTACGTCAACTTTGTGAA
CCATATGGTTGTATTAAAAACTGTATGATATTAAAAGATTCCTATGGCAA
TAGTAAAGGCTGTGCATTTGTAACATATAATAATTCTGATGAAGCTAATA
TGGCAATAGAATCCTTAAATGGTATGAAAACATCTATGGCTTGTCCGGAA
TTGGGGTCTTGTATTGTTGCAAGGTTAGCAGATAACGAACAGGAAAGACA
ATTACGAAAAATGCAAATGCAATTTCCTGCCATTCAATTGTTAACACCTC
AGAATGTCGGTTATTATAACCAAGGCATTGTTCCAATGATACAATTTCCA
CATGCCACTGATCAACAAACTGCAAATTTAATAAATGCATATGCATTGCA
AATGCATTTAAGTCAAATGTATAGCCCAAATTTAACACCTCCGCTCGTAA
ATTCCAGTCCCAGTGTTACACCACAGCCTCAAATTGGCGTGCCAATGTCT
GCAGCAAACGATATCTCATCAAACCAGTGCTCAATGAATCACTTTGTATT
GCCATCTATCAACAATGAAAACATTCCTATGTCACCAGCACTTAATTCAT
ATATTAATCCTGCTCATCCACAGTTAATAAATATTGCCAATATCAACTTC
ACTCCAGAAGCGTTGCATTTACCTTCTCTTTATTCAATGTTTCCACAATG
TGGATTTAATTTAAACACTCCCGCATTAGGCTTATCTGGTCAAAATATTT
ACCCAAATACCACTGCTTTGTCTCTACAATATCAACAAAATCAGAAAGAT
GGGATAAAAGACAATATTGTAACTGGTCCTGAAGGGTGTAATTTGTTCAT
TTATCACCTTCCTCAAGATTTTGGAGATGCAGCATTGGCTCAATTGTTTA
CTCCTTTCGGGAATGTTATCAGTGCAAAGGTGTATTTAGATCGTGCAACT
AATCAGAGCAAATGTTTTGGATTTGTTAGTTTTGATAATGCATCAAATGC
TGAAGCAGCTATTAGGGGAATGAATGGGTTTCAAATTGGTACCAAACGTC
TCAAAGTTCAATTAAAACGACCAAAGGGAGAATACAAGAATTGATTTTAT
TTTTCTTGTCAGAGTAAAGATACTTTCTATTCGAATATATTTTTTGTATG
CTATTGTATATAGTGCTGCATAACTCAATATTGTAATTTTTTATTGTACA
TACAAGATACTACATTGATAATATAATTCAAGCATTGTAAAGCACCATTT
TGTTTTGGGTTAGGCTTGAAATTTTTTATAAAATATTTAAAAGGCCATTT
TGATTTTGTAAAAACTTTTAGGTATTATTAATTTGTACTTTTTGAAAGCC
AAATAATTTGTGTGAATTTTGCGGCAAACATTTATCTGAGTGCATTTGAA
GTTGTTTTTAAATTGTAAAGAGTTTATAGAGATTATGTAGATATCGAAAT
ATTTTTATGATATATTATAAAGTAAAATTAATTGAAACACGTTGGATTTT
AGTCAGGGAGATGGAGTTGGATTTTCAATTTGAATTATTTTGCATTTGTA
TCTTTAATGCTATTTATATATTTTTACAAAGAAATATAATTTTCACTTG
back to top

protein sequence of SMED30023062-orf-1

>SMED30023062-orf-1 ID=SMED30023062-orf-1|Name=SMED30023062-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=403bp
MQVASPINVDSMALYSNGFTDKGNIIIQNHDENTKLFIGMLNKNQSEDDV
RQLCEPYGCIKNCMILKDSYGNSKGCAFVTYNNSDEANMAIESLNGMKTS
MACPELGSCIVARLADNEQERQLRKMQMQFPAIQLLTPQNVGYYNQGIVP
MIQFPHATDQQTANLINAYALQMHLSQMYSPNLTPPLVNSSPSVTPQPQI
GVPMSAANDISSNQCSMNHFVLPSINNENIPMSPALNSYINPAHPQLINI
ANINFTPEALHLPSLYSMFPQCGFNLNTPALGLSGQNIYPNTTALSLQYQ
QNQKDGIKDNIVTGPEGCNLFIYHLPQDFGDAALAQLFTPFGNVISAKVY
LDRATNQSKCFGFVSFDNASNAEAAIRGMNGFQIGTKRLKVQLKRPKGEY
KN*
back to top
Aliases
The feature 'bruno-like' has the following synonyms
Synonym
bruno-like
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000044cephalic ganglia
PLANA:0000097ventral nerve cord
PLANA:0000429neoblast
PLANA:0002013Category 1 cell
PLANA:0002075pigment cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
PLANA:0004517blastomere
PLANA:0004519embryonic pharynx neuron
Vocabulary: INTERPRO
TermDefinition
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
GO:0003723RNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006397mRNA processing
GO:0048026positive regulation of mRNA splicing, via spliceosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 319..392
e-value: 1.2E-22
score: 91.2
coord: 35..107
e-value: 1.1E-13
score: 61.5
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 36..98
e-value: 1.1E-16
score: 60.3
coord: 320..390
e-value: 5.9E-18
score: 64.4
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 318..396
score: 16.995
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 34..117
score: 15.204
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 27..131
e-value: 1.7E-20
score: 75.0
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 295..401
e-value: 1.3E-26
score: 94.8
NoneNo IPR availablePANTHERPTHR24012RNA BINDING PROTEINcoord: 33..399
NoneNo IPR availablePANTHERPTHR24012:SF716CUGBP ELAV-LIKE FAMILY MEMBER 6coord: 33..399
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 31..398