EF-hand calcium-binding domain-containing protein 6

Overview
NameEF-hand calcium-binding domain-containing protein 6
Smed IDSMED30023059
Length (bp)4864
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of EF-hand calcium-binding domain-containing protein 6 (SMED30023059) t-SNE clustered cells

Violin plots show distribution of expression levels for EF-hand calcium-binding domain-containing protein 6 (SMED30023059) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of EF-hand calcium-binding domain-containing protein 6 (SMED30023059) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for EF-hand calcium-binding domain-containing protein 6 (SMED30023059) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023059

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30023059SMESG000052556.1 SMESG000052552.1 SmedASXL_010916SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30023059SMESG000052556.1 SMESG000052552.1 dd_Smed_v4_7065_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30023059SMESG000052556.1 SMESG000052552.1 dd_Smed_v4_7065_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30023059SMESG000052556.1 SMESG000052552.1 dd_Smed_v4_7065_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30023059SMESG000052556.1 SMESG000052552.1 dd_Smed_v4_7065_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30023059SMESG000052556.1 SMESG000052552.1 dd_Smed_v4_7065_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30023059SMESG000052556.1 SMESG000052552.1 dd_Smed_v6_7065_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30023059SMESG000052556.1 SMESG000052552.1 dd_Smed_v4_7065_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30023059SMESG000052556.1 SMESG000052552.1 dd_Smed_v4_7065_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30023059SMESG000052556.1 SMESG000052552.1 dd_Smed_v4_7065_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30023059SMESG000052556.1 SMESG000052552.1 dd_Smed_v4_7065_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Human
Match: EFCAB6 (EF-hand calcium binding domain 6 [Source:HGNC Symbol;Acc:HGNC:24204])

HSP 1 Score: 219.935 bits (559), Expect = 4.816e-57
Identity = 256/1150 (22.26%), Postives = 479/1150 (41.65%), Query Frame = 3
Query:  687 QISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETI-NIDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHKWLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKD-KKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMS----------PEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFN-GFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTN-AVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVN---QETKHQQSVDNQAVL--GTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQEK-TVGSIRINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGFN----QKLNNLDIQXXXXXXXXXXXXXTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLKKNEFDNVNYGEFV 4064
            ++ +N   +MKAF+L D N    ++   L++V+E FC  L +++++K    ++  ++  V+Y  F+K + I  D        N E ++ N   +N+K  R+  +A  E+ +  +  L+++   F  ++   +  + K     DP   G+V+   L  +L+ F + +   +F Q+M +   KAT KI W  FL  F +PQ   ++      K     N I   N   + ++++  L  H  ++ +S + A L IN    G I + EF  ILN     +S  +   +++ LDP + G ++   F+ L E  EN    K         + +    L+ ++++  + D I        +     DL  TG I   + KKI      +L +    +L +   ++D   GRI Y +L   + +D  P+      + +    D  L E    H++K E  +     R  L             EE+I + K  I Q    + + +  +   +  G IN    +K+L   G  + ++Q++ ++  + F     S +DF  GF     ++        T       S  +VN      +  +  +E   L  +++  +F D   AF K D    G +   D    LL  L+ +++D+F+     LG+     L + +F N  + R    D     ++  R   P    A  +++ E  +  L  K    + ++S  F+     G G +R R++++ L    I ++  E +KLW RYDT  +  + Y +FL  LG+            S A+    H    +   N     TK QQ  +    L   T   V    +++ RH      D + AF      KT   + +I  + ++L +    +T  +   L    G    D++++Y  F    ++S +   Q K    S+ IN    NP +   +    + S+Q+A             +   F  +D E++G+V   EF  +L  FC  LTD Q++ +   L  ++         I+++YF++ F+    +  +    +     P  +      + I   +++++          F++ D    N IS+ +FR I  R +  + D  F++ W+ +  N    + Y +F+
Sbjct:   17 KVFKNIKTVMKAFELIDVNKTGLVRPQELRRVLETFCMKLRDEEYEKFSKHYNIHKDTAVDYNVFLKNLSINNDLNLRYCMGNQEVSLENQQAKNSKKERLLGSASSED-IWRNYSLDEIERNFCLQLSKSYEKVEKALSAGDPCKGGYVSFNYLKIVLDTFVYQIPRRIFIQLMKRFGLKATTKINWKQFLTSFHEPQGLQVSSKGPLTKR----NSINSRNES-HKENIITKLFRHTEDHSASLKKALLIINTKPDGPITREEFRYILNCMAVKLSDSEFKELMQMLDPGDTGVVNTSMFIDLIE--ENCRMRK----TSPCTDAKTPFLLAWDSVEEIVHDTITRNLQAFYNMLRSYDLGDTGRIGRNNFKKIMHVFCPFLTNAHFIKLCS--KIQDIGSGRILYKKLLACIGIDGPPT-----VSPVLVPKDQLLSE----HLQKDEQQQPDLSERTKLTEDKTTLTKKMTTEEVIEKFKKCIQQQDPAFKKRFLDFS-KEPNGKINVHDFKKVLEDTGMPMDDDQYALLTTKIGFEKEGMSYLDFAAGF-----EDPPMRGPETTPPQPPTPSKSYVN------SHFITAEECLKLFPRRLKESFRDPYSAFFKTDADRDGIINMHDLHRLLLHLLLNLKDDEFERFLGLLGLRLSVTLNFREFQNLCEKRPWRTD-----EAPQRLIRPKQKVADSELACEQAHQYLVTKAKNRWSDLSKNFLETDNEGNGILRRRDIKNALYGFDIPLTPREFEKLWARYDTEGKGHITYQEFLQKLGI----------NYSPAV----HRPCAEDYFNFMGHFTKPQQLQEEMKELQQSTEKAVAARDKLMDRH-----QDISKAFTKTDQSKT--NYISICKMQEVLEECGCSLTEGELTHLLNSWGVSRHDNAINYLDFLRAVENSKSTGAQPKEKEESMPINFATLNPQEAVRKIQEVVESSQLA-------------LSTAFSALDKEDTGFVKATEFGQVLKDFCYKLTDNQYHYFLRKLRIHLTPY------INWKYFLQNFSCFLEETADEWAEKMPKGPPPTSPKATADRDILARLHKAVTSHYHAITQEFENFDTMKTNTISREEFRAICNRRVQILTDEQFDRLWNEMPVNAKGRLKYPDFL 1086          

HSP 2 Score: 84.3445 bits (207), Expect = 2.005e-15
Identity = 126/678 (18.58%), Postives = 265/678 (39.09%), Query Frame = 3
Query: 1380 ELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHKWLNSNH-----------KVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIR--------------------DDMVDGHKWLDS-------------KHRFNDPSTNAVPDMS----AEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTIN 3269
            + L     N +S     FL+ +    G + + +    L  F   ++  +   +    D   +G+I+Y  FLQ      + + H+    ++           ++ E  K+LQ S+E   +   D + ++  ++   F   D ++T YIS+  ++++ ++    L + ++  L+    +      INYL+                 + + ++S  AQ KE+ E+          +  A LN   P+E + +I++ +  ++L     +   +  D  G +  ++  ++L  F Y LT+ Q+      L    +    I++  FL  F+   E + D   +   +PK     +     D      +++   L + + +++  +   F  FD      + + +F+      + ++ ++QFD L  ++ V  K +L Y DFL+RF                        D+ +G +   S              H     ST  +P        + +   L ++I   + ++         +  G I   +   L+ +  + +SK E ++L  +YD  +  K  Y DF+ +  LL K     LM      IQN+H         +E   +      A+L     + H +  ++R  + +Y ++     +VA+ +T+   ++IN
Sbjct:  687 QYLVTKAKNRWSDLSKNFLETDNEGNGILRRRDIKNALYGFDIPLTPREFEKLWARYDTEGKGHITYQEFLQKLGINYSPAVHRPCAEDYFNFMGHFTKPQQLQEEMKELQQSTEKAVAA-RDKLMDRHQDISKAFTKTDQSKTNYISICKMQEVLEECGCSLTEGELTHLLNSWGVSRHDNAINYLDFLR--------------AVENSKSTGAQPKEKEESM--------PINFATLN---PQEAVRKIQEVVESSQLALSTAFSALDKEDT-GFVKATEFGQVLKDFCYKLTDNQYHYFLRKLRIHLTP--YINWKYFLQNFSCFLEETADEWAEK--MPKGPPPTSPKATAD------RDILARLHKAVTSHYHAITQEFENFDTMKTNTISREEFRAICNRRVQILTDEQFDRLWNEMPVNAKGRLKYPDFLSRFSSETAATPMATGDSAVAQRGSSVPDVSEGTRSALSLPTQELRPGSKSQSHPCTPASTTVIPGTPPLQNCDPIESRLRKRIQGCWRQLLKECKEKDVARQGDINASDFLALVEKFNLDISKEECQQLIIKYDLKSNGKFAYCDFIQSCVLLLKAKESSLM--HRMKIQNAHKM-------KEAGAETPSFYSALLRIQPKIVHCWRPMRRTFK-SYDEAGTGLLSVADFRTVLRQYSIN 1317          

HSP 3 Score: 76.2554 bits (186), Expect = 4.506e-13
Identity = 99/475 (20.84%), Postives = 196/475 (41.26%), Query Frame = 3
Query:  195 ISEINPIVKSQLLKNHKEILKALQTFDIECSGLVTKGELRRVLDSYCLPMTTDQYEQFLSHNSINYSKGSINYKELIDKIYDKTSAVGH--FKKNIKLPQLQRSATTICLQNKHFTLPTTRRSSGKISRSQLFXXXXXXXXXXXXXXXXWNYNAYTIDDIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGM----GIPIDNQGTIQTKNSEETINIDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNI---DDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFL 1592
            + E+   V  ++ KN K ++KA +  D+  +GLV   ELRRVL+++C+ +  ++YE+F  H +I+                 K +AV +  F KN+ +          C+ N+  +L   +  + K  R           L S  S   W    Y++D+I     +Q+S++   + KA    D      +  + LK V++ F   +  + F +L+ RF       +N+ +F+       G+ + ++G +  +NS     I++RN                   +  E ++    +  ED  + L+K  L+++   +G +T E    ILN  A  +S + F ++M       TG +    F+   ++            ++    C   +     P +   D + E++ + I+ N  +F +     +    G+I ++ F KI++ F  +++      +   +     G I Y   L
Sbjct:    7 LRELEIQVGEKVFKNIKTVMKAFELIDVNKTGLVRPQELRRVLETFCMKLRDEEYEKFSKHYNIH-----------------KDTAVDYNVFLKNLSIN--NDLNLRYCMGNQEVSLENQQAKNSKKER----------LLGSASSEDIW--RNYSLDEIERNFCLQLSKSYEKVEKALSAGDPCKGGYVSFNYLKIVLDTFVYQIPRRIFIQLMKRFGLKATTKINWKQFLTSFHEPQGLQVSSKGPLTKRNS-----INSRN------------------ESHKENIITKLFRHTEDHSASLKKALLIINTKPDGPITREEFRYILNCMAVKLSDSEFKELMQMLDPGDTGVVNTSMFIDLIEE---------NCRMRKTSPCTDAK----TPFLLAWDSVEEIVHDTITRNLQAFYNMLRSYDLGDTGRIGRNNFKKIMHVFCPFLTNAHFIKLCSKIQDIGSGRILYKKLL 414          

HSP 4 Score: 68.1662 bits (165), Expect = 1.516e-10
Identity = 49/212 (23.11%), Postives = 97/212 (45.75%), Query Frame = 3
Query: 4161 TDEMDTDESIRKNLERLLNRNWQSIFNKCKAIDQAINECQTAEGSIPIDDFVYILSEYDDSLSAENLAAINL-YKTCKNGRFIKYGDLIRSIVL---SSRGSLISNENVTEVQKKFLNVGIKTTNSDNSKDYFPQLFKLRRQILENWKDLRKNFLQSDKKQNGAVSGNIFMTIMKTVCGQLSADLFYHLMKIYDQDGTGNFHYKRFIEDFLK 4784
            T  +   + I   L + +   W+ +  +CK  D A       +G I   DF+ ++ +++  +S E    + + Y    NG+F  Y D I+S VL   +   SL+    +    K     G +T +      ++  L +++ +I+  W+ +R+ F   D+   G +S   F T+++     LS + F+H+++ YD+  +    Y  F+  FL+
Sbjct: 1152 TPPLQNCDPIESRLRKRIQGCWRQLLKECKEKDVA------RQGDINASDFLALVEKFNLDISKEECQQLIIKYDLKSNGKFA-YCDFIQSCVLLLKAKESSLMHRMKIQNAHK-MKEAGAETPS------FYSALLRIQPKIVHCWRPMRRTFKSYDEAGTGLLSVADFRTVLRQYSINLSEEEFFHILEYYDKTLSSKISYNDFLRAFLQ 1349          

HSP 5 Score: 58.5362 bits (140), Expect = 1.255e-7
Identity = 129/719 (17.94%), Postives = 267/719 (37.13%), Query Frame = 3
Query: 1002 IENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQ---DPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNIDDLLE---LLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIIL-KFLDPHNEGYISYHHFLQLFEQKENLSAH-----KWLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLN------YHELYKKYECND--KKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIR----------------GDDNRN-----------------MNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNR----FQIRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFL 2987
            + +  L   +  Q LV    K ++++S L K FL  D    G +    +   L  F  P++   F ++  +   +  G I +  FLQK      P               H   P Q       +    E      + + + +     AF + +Q+    I   +  ++L      ++  +L+ +L  +    ++  I+Y  FL+  E  ++  A      + +  N   + P++ ++   E ++S+           +   F+ +D   TG++   +  ++ K     L D+     +       +K RI+     N          L+  S  + E+ D              E  EK+ +       P        DR +  RL+      YH + +++E  D  K   I++ + R +  +    LT+EQF ++      P ++K R+ +  FL+ F+ +  ++  + T    + +    V D+                 G  +++                  NC  +E  LR++I   +  L+    + D + +G +  SDF   +    + I  ++   L  K  +    K  Y DF+       + ++  +     + + H+  +         SA    + +  KI   +  +  TF +   +GTG +   + + +L +  I++S+ E   + + YD    +K+ Y+DFL
Sbjct:  675 VADSELACEQAHQYLVT---KAKNRWSDLSKNFLETDNEGNGILRRRDIKNALYGFDIPLTPREFEKLWARYDTEGKGHITYQEFLQKLGINYSPAVHRPCAEDYFNFMGHFTKPQQLQEEMKELQQSTEKAVAARDKLMDRHQDISKAFTKTDQSKTNYISICKMQEVLEECGCSLTEGELTHLLNSWGVSRHDNAINYLDFLRAVENSKSTGAQPKEKEESMPINFATLNPQEAVRKIQEVVESS--------QLALSTAFSALDKEDTGFVKATEFGQVLKDFCYKLTDNQYHYFL-------RKLRIHLTPYINWKYF------LQNFSCFLEETAD--------------EWAEKMPKG-----PPPTSPKATADRDILARLHKAVTSHYHAITQEFENFDTMKTNTISREEFRAICNRRVQILTDEQFDRLWN--EMPVNAKGRLKYPDFLSRFS-SETAATPMATGDSAVAQRGSSVPDVSEGTRSALSLPTQELRPGSKSQSHPCTPASTTVIPGTPPLQNCDPIESRLRKRIQGCWRQLLKECKEKDVARQGDINASDFLALVEKFNLDISKEECQQLIIKYDLKSNGKFAYCDFIQSCVLLLKAKESSLMHRMKIQNAHKMKEAGAETPSFYSA---LLRIQPKIVHCWRPMRRTFKSYDEAGTGLLSVADFRTVLRQYSINLSEEEFFHILEYYDKTLSSKISYNDFL 1344          

HSP 6 Score: 56.9954 bits (136), Expect = 4.021e-7
Identity = 78/428 (18.22%), Postives = 176/428 (41.12%), Query Frame = 3
Query: 2787 EKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTH----LHVEHLFEMVKRH--LRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQEKTVGSIRINQDLENPSKIGIEEAGNLNS------TQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSL---STYIVKSANTDDKIDYRYFMKGFNQKLNNLDIQXXXXXXXXXXXXXTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLK 4025
            EK+++    +   F  +  + TG +R + L+ +L    + +   E +K  K Y+ +    +DY+ FL NL +         MG              +  V+ E +  ++   + +LG+     +   +  + ++R+  L+++ S   +     A      G+ + N L  +L      +    F+QL  R G +     +++++F   F +                 Q L+  SK  + +  ++NS        I + + +   D  + ++K  L+++ +  G ++  EFR +L    + L+D +F +    L    T +V ++   D I+    M+           ++     A     + +  ++E ++++I    + F N  +S D      I +++F++I+  F   + ++HF K  S ++
Sbjct:   16 EKVFKNIKTVMKAFELIDVNKTGLVRPQELRRVLETFCMKLRDEEYEKFSKHYNIHKDTAVDYNVFLKNLSINNDLNLRYCMG--------------NQEVSLENQQAKNSKKERLLGSASSEDIWRNYSLDEIERNFCLQLSKSYEKVEKALSAGDPCKGGYVSFNYLKIVLDTFVYQIPRRIFIQLMKRFGLKA-TTKINWKQFLTSFHEP----------------QGLQVSSKGPLTKRNSINSRNESHKENIITKLFRHTEDHSASLKKALLIINTKPDGPITREEFRYILNCMAVKLSDSEFKELMQMLDPGDTGVVNTSMFIDLIEENCRMR-----------KTSPCTDAKTPFLLAWDSVEEIVHDTITRNLQAFYNMLRSYDLGDTGRIGRNNFKKIMHVFCPFLTNAHFIKLCSKIQ 401          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Human
Match: EFCAB6 (EF-hand calcium binding domain 6 [Source:HGNC Symbol;Acc:HGNC:24204])

HSP 1 Score: 219.164 bits (557), Expect = 9.005e-57
Identity = 255/1152 (22.14%), Postives = 481/1152 (41.75%), Query Frame = 3
Query:  687 QISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETI-NIDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSK--PNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHKWLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKD-KKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMS----------PEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFN-GFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTN-AVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVN---QETKHQQSVDNQAVL--GTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQEK-TVGSIRINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGFN----QKLNNLDIQXXXXXXXXXXXXXTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLKKNEFDNVNYGEFV 4064
            ++ +N   +MKAF+L D N    ++   L++V+E FC  L +++++K    ++  ++  V+Y  F+K + I  D        N E ++ N   +N+K  R+  +A  E+ +  +  L+++   F  ++   +  + K     DP   G+V+   L  +L+ F + +   +F Q+M +   KAT KI W  FL  F +PQ   ++      K +        +NS+   + ++++  L  H  ++ +S + A L IN    G I + EF  ILN     +S  +   +++ LDP + G ++   F+ L E  EN    K         + +    L+ ++++  + D I        +     DL  TG I   + KKI      +L +    +L +   ++D   GRI Y +L   + +D  P+      + +    D  L E    H++K E  +     R  L             EE+I + K  I Q    + + +  +   +  G IN    +K+L   G  + ++Q++ ++  + F     S +DF  GF     ++        T       S  +VN      +  +  +E   L  +++  +F D   AF K D    G +   D    LL  L+ +++D+F+     LG+     L + +F N  + R    D     ++  R   P    A  +++ E  +  L  K    + ++S  F+     G G +R R++++ L    I ++  E +KLW RYDT  +  + Y +FL  LG+            S A+    H    +   N     TK QQ  +    L   T   V    +++ RH      D + AF      KT   + +I  + ++L +    +T  +   L    G    D++++Y  F    ++S +   Q K    S+ IN    NP +   +    + S+Q+A             +   F  +D E++G+V   EF  +L  FC  LTD Q++ +   L  ++         I+++YF++ F+    +  +    +     P  +      + I   +++++          F++ D    N IS+ +FR I  R +  + D  F++ W+ +  N    + Y +F+
Sbjct:  169 KVFKNIKTVMKAFELIDVNKTGLVRPQELRRVLETFCMKLRDEEYEKFSKHYNIHKDTAVDYNVFLKNLSINNDLNLRYCMGNQEVSLENQQAKNSKKERLLGSASSED-IWRNYSLDEIERNFCLQLSKSYEKVEKALSAGDPCKGGYVSFNYLKIVLDTFVYQIPRRIFIQLMKRFGLKATTKINWKQFLTSFHEPQGLQVSSKGPLTKRN-------SINSRNESHKENIITKLFRHTEDHSASLKKALLIINTKPDGPITREEFRYILNCMAVKLSDSEFKELMQMLDPGDTGVVNTSMFIDLIE--ENCRMRK----TSPCTDAKTPFLLAWDSVEEIVHDTITRNLQAFYNMLRSYDLGDTGRIGRNNFKKIMHVFCPFLTNAHFIKLCS--KIQDIGSGRILYKKLLACIGIDGPPT-----VSPVLVPKDQLLSE----HLQKDEQQQPDLSERTKLTEDKTTLTKKMTTEEVIEKFKKCIQQQDPAFKKRFLDFS-KEPNGKINVHDFKKVLEDTGMPMDDDQYALLTTKIGFEKEGMSYLDFAAGF-----EDPPMRGPETTPPQPPTPSKSYVN------SHFITAEECLKLFPRRLKESFRDPYSAFFKTDADRDGIINMHDLHRLLLHLLLNLKDDEFERFLGLLGLRLSVTLNFREFQNLCEKRPWRTD-----EAPQRLIRPKQKVADSELACEQAHQYLVTKAKNRWSDLSKNFLETDNEGNGILRRRDIKNALYGFDIPLTPREFEKLWARYDTEGKGHITYQEFLQKLGI----------NYSPAV----HRPCAEDYFNFMGHFTKPQQLQEEMKELQQSTEKAVAARDKLMDRH-----QDISKAFTKTDQSKT--NYISICKMQEVLEECGCSLTEGELTHLLNSWGVSRHDNAINYLDFLRAVENSKSTGAQPKEKEESMPINFATLNPQEAVRKIQEVVESSQLA-------------LSTAFSALDKEDTGFVKATEFGQVLKDFCYKLTDNQYHYFLRKLRIHLTPY------INWKYFLQNFSCFLEETADEWAEKMPKGPPPTSPKATADRDILARLHKAVTSHYHAITQEFENFDTMKTNTISREEFRAICNRRVQILTDEQFDRLWNEMPVNAKGRLKYPDFL 1238          

HSP 2 Score: 83.9593 bits (206), Expect = 2.567e-15
Identity = 126/678 (18.58%), Postives = 265/678 (39.09%), Query Frame = 3
Query: 1380 ELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHKWLNSNH-----------KVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIR--------------------DDMVDGHKWLDS-------------KHRFNDPSTNAVPDMS----AEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTIN 3269
            + L     N +S     FL+ +    G + + +    L  F   ++  +   +    D   +G+I+Y  FLQ      + + H+    ++           ++ E  K+LQ S+E   +   D + ++  ++   F   D ++T YIS+  ++++ ++    L + ++  L+    +      INYL+                 + + ++S  AQ KE+ E+          +  A LN   P+E + +I++ +  ++L     +   +  D  G +  ++  ++L  F Y LT+ Q+      L    +    I++  FL  F+   E + D   +   +PK     +     D      +++   L + + +++  +   F  FD      + + +F+      + ++ ++QFD L  ++ V  K +L Y DFL+RF                        D+ +G +   S              H     ST  +P        + +   L ++I   + ++         +  G I   +   L+ +  + +SK E ++L  +YD  +  K  Y DF+ +  LL K     LM      IQN+H         +E   +      A+L     + H +  ++R  + +Y ++     +VA+ +T+   ++IN
Sbjct:  839 QYLVTKAKNRWSDLSKNFLETDNEGNGILRRRDIKNALYGFDIPLTPREFEKLWARYDTEGKGHITYQEFLQKLGINYSPAVHRPCAEDYFNFMGHFTKPQQLQEEMKELQQSTEKAVAA-RDKLMDRHQDISKAFTKTDQSKTNYISICKMQEVLEECGCSLTEGELTHLLNSWGVSRHDNAINYLDFLR--------------AVENSKSTGAQPKEKEESM--------PINFATLN---PQEAVRKIQEVVESSQLALSTAFSALDKEDT-GFVKATEFGQVLKDFCYKLTDNQYHYFLRKLRIHLTP--YINWKYFLQNFSCFLEETADEWAEK--MPKGPPPTSPKATAD------RDILARLHKAVTSHYHAITQEFENFDTMKTNTISREEFRAICNRRVQILTDEQFDRLWNEMPVNAKGRLKYPDFLSRFSSETAATPMATGDSAVAQRGSSVPDVSEGTRSALSLPTQELRPGSKSQSHPCTPASTTVIPGTPPLQNCDPIESRLRKRIQGCWRQLLKECKEKDVARQGDINASDFLALVEKFNLDISKEECQQLIIKYDLKSNGKFAYCDFIQSCVLLLKAKESSLM--HRMKIQNAHKM-------KEAGAETPSFYSALLRIQPKIVHCWRPMRRTFK-SYDEAGTGLLSVADFRTVLRQYSIN 1469          

HSP 3 Score: 76.2554 bits (186), Expect = 5.412e-13
Identity = 99/475 (20.84%), Postives = 196/475 (41.26%), Query Frame = 3
Query:  195 ISEINPIVKSQLLKNHKEILKALQTFDIECSGLVTKGELRRVLDSYCLPMTTDQYEQFLSHNSINYSKGSINYKELIDKIYDKTSAVGH--FKKNIKLPQLQRSATTICLQNKHFTLPTTRRSSGKISRSQLFXXXXXXXXXXXXXXXXWNYNAYTIDDIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGM----GIPIDNQGTIQTKNSEETINIDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNI---DDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFL 1592
            + E+   V  ++ KN K ++KA +  D+  +GLV   ELRRVL+++C+ +  ++YE+F  H +I+                 K +AV +  F KN+ +          C+ N+  +L   +  + K  R           L S  S   W    Y++D+I     +Q+S++   + KA    D      +  + LK V++ F   +  + F +L+ RF       +N+ +F+       G+ + ++G +  +NS     I++RN                   +  E ++    +  ED  + L+K  L+++   +G +T E    ILN  A  +S + F ++M       TG +    F+   ++            ++    C   +     P +   D + E++ + I+ N  +F +     +    G+I ++ F KI++ F  +++      +   +     G I Y   L
Sbjct:  159 LRELEIQVGEKVFKNIKTVMKAFELIDVNKTGLVRPQELRRVLETFCMKLRDEEYEKFSKHYNIH-----------------KDTAVDYNVFLKNLSIN--NDLNLRYCMGNQEVSLENQQAKNSKKER----------LLGSASSEDIW--RNYSLDEIERNFCLQLSKSYEKVEKALSAGDPCKGGYVSFNYLKIVLDTFVYQIPRRIFIQLMKRFGLKATTKINWKQFLTSFHEPQGLQVSSKGPLTKRNS-----INSRN------------------ESHKENIITKLFRHTEDHSASLKKALLIINTKPDGPITREEFRYILNCMAVKLSDSEFKELMQMLDPGDTGVVNTSMFIDLIEE---------NCRMRKTSPCTDAK----TPFLLAWDSVEEIVHDTITRNLQAFYNMLRSYDLGDTGRIGRNNFKKIMHVFCPFLTNAHFIKLCSKIQDIGSGRILYKKLL 566          

HSP 4 Score: 73.9442 bits (180), Expect = 2.735e-12
Identity = 103/552 (18.66%), Postives = 228/552 (41.30%), Query Frame = 3
Query: 2415 NRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTH----LHVEHLFEMVKRH--LRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQEKTVGSIRINQDLENPSKIGIEEAGNLNS------TQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSL---STYIVKSANTDDKIDYRYFMKGFNQKLNNLDIQXXXXXXXXXXXXXTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLK 4025
            N  ++  +V+ +L QKI +   +L  AF   D      + KS+ +  +   L+ +  +QF  +  ++ +     + Y  FL+RF   D  ++G K      R      N     +  ++ + + EK+++    +   F  +  + TG +R + L+ +L    + +   E +K  K Y+ +    +DY+ FL NL +         MG              +  V+ E +  ++   + +LG+     +   +  + ++R+  L+++ S   +     A      G+ + N L  +L      +    F+QL  R G +     +++++F   F +                 Q L+  SK  + +  ++NS        I + + +   D  + ++K  L+++ +  G ++  EFR +L    + L+D +F +    L    T +V ++   D I+    M+           ++     A     + +  ++E ++++I    + F N  +S D      I +++F++I+  F   + ++HF K  S ++
Sbjct:   52 NPTLSSLDVKRILFQKITDRGDELQKAFQLLDTGQNLTVSKSELRRIITDFLMPLTREQFQDVLAQIPLSTSGTVPYLAFLSRFGGIDLYINGIK------RGGGNEMNCC--RTLRELEIQVGEKVFKNIKTVMKAFELIDVNKTGLVRPQELRRVLETFCMKLRDEEYEKFSKHYNIHKDTAVDYNVFLKNLSINNDLNLRYCMG--------------NQEVSLENQQAKNSKKERLLGSASSEDIWRNYSLDEIERNFCLQLSKSYEKVEKALSAGDPCKGGYVSFNYLKIVLDTFVYQIPRRIFIQLMKRFGLKA-TTKINWKQFLTSFHEP----------------QGLQVSSKGPLTKRNSINSRNESHKENIITKLFRHTEDHSASLKKALLIINTKPDGPITREEFRYILNCMAVKLSDSEFKELMQMLDPGDTGVVNTSMFIDLIEENCRMR-----------KTSPCTDAKTPFLLAWDSVEEIVHDTITRNLQAFYNMLRSYDLGDTGRIGRNNFKKIMHVFCPFLTNAHFIKLCSKIQ 553          

HSP 5 Score: 68.1662 bits (165), Expect = 1.708e-10
Identity = 49/212 (23.11%), Postives = 97/212 (45.75%), Query Frame = 3
Query: 4161 TDEMDTDESIRKNLERLLNRNWQSIFNKCKAIDQAINECQTAEGSIPIDDFVYILSEYDDSLSAENLAAINL-YKTCKNGRFIKYGDLIRSIVL---SSRGSLISNENVTEVQKKFLNVGIKTTNSDNSKDYFPQLFKLRRQILENWKDLRKNFLQSDKKQNGAVSGNIFMTIMKTVCGQLSADLFYHLMKIYDQDGTGNFHYKRFIEDFLK 4784
            T  +   + I   L + +   W+ +  +CK  D A       +G I   DF+ ++ +++  +S E    + + Y    NG+F  Y D I+S VL   +   SL+    +    K     G +T +      ++  L +++ +I+  W+ +R+ F   D+   G +S   F T+++     LS + F+H+++ YD+  +    Y  F+  FL+
Sbjct: 1304 TPPLQNCDPIESRLRKRIQGCWRQLLKECKEKDVA------RQGDINASDFLALVEKFNLDISKEECQQLIIKYDLKSNGKFA-YCDFIQSCVLLLKAKESSLMHRMKIQNAHK-MKEAGAETPS------FYSALLRIQPKIVHCWRPMRRTFKSYDEAGTGLLSVADFRTVLRQYSINLSEEEFFHILEYYDKTLSSKISYNDFLRAFLQ 1501          

HSP 6 Score: 58.151 bits (139), Expect = 1.781e-7
Identity = 129/719 (17.94%), Postives = 267/719 (37.13%), Query Frame = 3
Query: 1002 IENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQ---DPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNIDDLLE---LLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIIL-KFLDPHNEGYISYHHFLQLFEQKENLSAH-----KWLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLN------YHELYKKYECND--KKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIR----------------GDDNRN-----------------MNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNR----FQIRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFL 2987
            + +  L   +  Q LV    K ++++S L K FL  D    G +    +   L  F  P++   F ++  +   +  G I +  FLQK      P               H   P Q       +    E      + + + +     AF + +Q+    I   +  ++L      ++  +L+ +L  +    ++  I+Y  FL+  E  ++  A      + +  N   + P++ ++   E ++S+           +   F+ +D   TG++   +  ++ K     L D+     +       +K RI+     N          L+  S  + E+ D              E  EK+ +       P        DR +  RL+      YH + +++E  D  K   I++ + R +  +    LT+EQF ++      P ++K R+ +  FL+ F+ +  ++  + T    + +    V D+                 G  +++                  NC  +E  LR++I   +  L+    + D + +G +  SDF   +    + I  ++   L  K  +    K  Y DF+       + ++  +     + + H+  +         SA    + +  KI   +  +  TF +   +GTG +   + + +L +  I++S+ E   + + YD    +K+ Y+DFL
Sbjct:  827 VADSELACEQAHQYLVT---KAKNRWSDLSKNFLETDNEGNGILRRRDIKNALYGFDIPLTPREFEKLWARYDTEGKGHITYQEFLQKLGINYSPAVHRPCAEDYFNFMGHFTKPQQLQEEMKELQQSTEKAVAARDKLMDRHQDISKAFTKTDQSKTNYISICKMQEVLEECGCSLTEGELTHLLNSWGVSRHDNAINYLDFLRAVENSKSTGAQPKEKEESMPINFATLNPQEAVRKIQEVVESS--------QLALSTAFSALDKEDTGFVKATEFGQVLKDFCYKLTDNQYHYFL-------RKLRIHLTPYINWKYF------LQNFSCFLEETAD--------------EWAEKMPKG-----PPPTSPKATADRDILARLHKAVTSHYHAITQEFENFDTMKTNTISREEFRAICNRRVQILTDEQFDRLWN--EMPVNAKGRLKYPDFLSRFS-SETAATPMATGDSAVAQRGSSVPDVSEGTRSALSLPTQELRPGSKSQSHPCTPASTTVIPGTPPLQNCDPIESRLRKRIQGCWRQLLKECKEKDVARQGDINASDFLALVEKFNLDISKEECQQLIIKYDLKSNGKFAYCDFIQSCVLLLKAKESSLMHRMKIQNAHKMKEAGAETPSFYSA---LLRIQPKIVHCWRPMRRTFKSYDEAGTGLLSVADFRTVLRQYSINLSEEEFFHILEYYDKTLSSKISYNDFL 1496          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Human
Match: EFCAB6 (EF-hand calcium binding domain 6 [Source:HGNC Symbol;Acc:HGNC:24204])

HSP 1 Score: 52.373 bits (124), Expect = 1.193e-6
Identity = 25/81 (30.86%), Postives = 47/81 (58.02%), Query Frame = 3
Query:  147 NSTIKDANYKMDPKLQISEINPIVKSQLLKNHKEILKALQTFDIECSGLVTKGELRRVLDSYCLPMTTDQYEQFLSHNSIN 389
            N   +    +M+    + E+   V  ++ KN K ++KA +  D+  +GLV   ELRRVL+++C+ +  ++YE+F  H +I+
Sbjct:   37 NGIKRGGGNEMNCCRTLRELEIQVGEKVFKNIKTVMKAFELIDVNKTGLVRPQELRRVLETFCMKLRDEEYEKFSKHYNIH 117          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Xenopus
Match: immp2l (inner mitochondrial membrane peptidase subunit 2 [Source:Xenbase;Acc:XB-GENE-1010851])

HSP 1 Score: 445.277 bits (1144), Expect = 2.606e-130
Identity = 337/1312 (25.69%), Postives = 608/1312 (46.34%), Query Frame = 3
Query:  180 DPKLQISEINPIVKSQLLKNHKEILKALQTFDIECSGLVTKGELRRVLDSYCLPMTTDQYEQFLSHNSINYSKGSINYKELIDKIYDKTSAVGHFKKNIKLPQLQRSATTICLQNKHFTLPTTRRSSGKISRSQLFXXXXXXXXXXXXXXXXWNYNAYTIDDIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETIN---IDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHKWLNSNHKVVEPRKD--LQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPS-DLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTHLHVEHLFEM------VKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQEKTVGSI-RINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGFN----QKLNNLDIQXXXXXXXXXXXXXTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLKKNEFDNVNYGEFV 4064
            DP L   EI  I+  ++ +N +++  A  T D E +  VT+GE  RVL ++ LP+T  Q+ + L    +N + G+I Y + + K                   L+ S++  C +       + +RS      +Q+                       +++++   L+  +S+N   ++++ +LFD+N +  IQ+  L++++EN C  +   +F+KL  R+   +   ++Y E ++ +G+ ++       +N    +N   +     K         ++        ++ +    RKKI   +  L K F   D +  G+V+ E L  ++N F FP+    F ++M++ A K T +I W  FL++FQ P+S   NG TI +K +H+ NP++G +   + + +L+ L  H  + Y S + AFL +++  KG+I + E  +I++   F ++  Q   ++  LDP + G+ISY  FL LFE KE++S HKWL   H +  P K+  + L  E + + + + I + W++        D    G +  +  K+I +     L D   + L          G I+Y++    + V TS + DL G+ST+I   +  + + R ++   +M+ IE      +  M  EE+I ++KD ++    +  E +  +     KG I+K   RK+L +    L  +QF +++E L F   +K  + +  F+++F D   +      D      SNHHVND +      M+ ++    LR K+   + DL  AF+K D +  G +   DF++ L   + +I+  +F  L   LG+   S L Y +FL+ FQ     V    WL S H  +   +    D++ E  +  L  K    +H+++ TF  + + G G ++ ++L+++L R  + +   E +KLW RYD   +  L +++FL  LG+   F  GD  GPS  I +++   L  H  NQ  K Q+ +D       H H     +M      +K   R  Y D + AF  +   K   G  +++DL  +L  L+  + +++F  L  R+  +  D+ LSY  F  +       DG+    G   R     E P K+ ++        ++   + + +V  +  + K F   D + +G +  +E   +L  FC  L+D+QF    + L          +  ID++ F+  F+    +  ++   +   A    +   +T + I  HI E +  R       F S DYA++N +SK DFRE+  +    + D  FE  W+ L  N + N+ Y EF+
Sbjct:   51 DPTLTPLEIEGIIYRRVNENEEDVTNAFLTLDTEQNFTVTRGEFYRVLQNFILPLTESQFNELLEKIPVN-NNGTIPYLDFLAKF------------------LRTSSSATCAR-------SVKRSWSCSQANQVL----------------------SLNELEIRLKNTVSKNLKNVVRSCRLFDYNQNGQIQKQELRRILENCCFKMKTAEFEKLWNRYCIGKKNTLDYRELLRNLGVNVELHNKPTAENVASALNREAVQREQQKEKNCRPPPPLKELSAEDYTIDDIEAALRKKISASYPNLVKAFRAFDGSHSGYVSAEALQSVINNFIFPLPNGTFQKLMNRLAIKCTDRIGWEQFLRRFQGPESM-ANGQTIPMKPNHRVNPVRGESPVVSSEHILQKLQRHFQDAYPSLKQAFLVLDEGRKGRISRKELRRIVDCMMFRVTDAQFKELMIILDPQHTGFISYLQFLDLFEDKESVSGHKWL---HNMRTPLKETPVTLEWEKMGNILCEKIEHNWADFSKAMKSCDSAGCGMVDKDQFKRILQSFCPPLSDRHYNMLCEQYN-DGANGYISYMDFLRNVGVCTSAAGDLNGVSTEIVHGSQLREELRQDDLSARMKEIESQATQLVKKMPVEEVIGKLKDCVIGQEFSPRESFLAF-AKQHKGRISKKDFRKVLREHEIHLDEDQFKRLTEKLGF---TKEELSYLDFVSLFEDPTGNGPGAALDT----GSNHHVNDTKF---HYMSAEDCLAQLRDKLQQGYGDLYSAFYKIDSNRDGLVTMHDFRHLLDSFMFIIKPQEFQRLLGLLGLNLSSTLNYKEFLHLFQKPQSPV-YPPWLQSSH--SPKQSMGGEDLACEQAHYYLVTKAQGRWHDMAKTFCEIDSEGNGIVQKKDLRNVLFRFYLPIHPKEFEKLWGRYDPEGKGFLTHNEFLEKLGI--SFASGD-SGPSKQITEDNRACLEGHYNNQ-LKIQEEMD-----AFHKHQTKALDMKDIEQQIKDKFRDYYHDFSAAFAKIDRNK--DGQISVHDLRAMLQSLNFHLDDEQFANLLYRLRIKVTDNKLSYPDFLRMID-----DGRASKYGQRQRPVSAAETPPKLSLQ--------KVLLKLKEAVVSSHDALYKAFSSFDRDGTGTIKASELHQILDSFCFKLSDRQFGYLLSKLPL------GEEQTIDWKAFLHHFSTSHPEPSSSWVERVQHATRPRSTQGLTMKDILNHIREVVTARFYTVAQDFISLDYANINAVSKEDFRELFNKDFMLLTDEQFENLWNTLPLNPYGNLKYHEFL 1265          

HSP 2 Score: 192.971 bits (489), Expect = 1.054e-48
Identity = 235/1213 (19.37%), Postives = 492/1213 (40.56%), Query Frame = 3
Query:  165 ANYKMDPKLQISEINPIVKS----QLLKNH-----KEILKALQTFDIECSGLVTKGELRRVLDSYCLPMTTDQYEQFLSHNSINYSKGSINYKELIDKIYDKTSAVGH-FKKNIKLPQLQRSATTICLQNKHFTLPTTRRSSGKISRSQLFXXXXXXXXXXXXXXXXWNYNAYTIDDIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETINIDTR-----NTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHKWLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDN-RNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLM--------GPSAAIIQNSHNALVDH------------------LVNQETKHQQSVDNQAVLGTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQD-SLNIDGQEKTVGSIRINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQF 3674
             N++++P   +   +P+V S    Q L+ H       + +A    D    G +++ ELRR++D     +T  Q+++ +      ++ G I+Y + +D   DK S  GH +  N++ P L+ +  T+                                         W       + +  IL  +I  N     KA K  D      + + + K+++++FC PL+++ ++ L  +++   NG ++YM+F++ +G+     G +   ++E       R     +   +R+ E       L+    +E+++   +  +  Q    R++FL      +G ++ +   K+L +    +  + F ++ +K  F    ++ +L F+  F+DP + +  G+ +   S+H  N  +      + +D L  L + +   Y     AF +I+    G +   +F  +L+ F F I   +   +L  L  +    ++Y  FL LF++ ++     WL S+H   +      L+ E     +      +W ++   F  +D    G +  +DL+ +  + +  +   + ++L       + KG + + E    L +  +  D  G S QI E N A L+  + N ++  E ++   + +   +  +++  +IKD+      ++   + K + N K G I+   LR ML    + L +EQF+ +   L    +  +++ +  FL +  D R S            K       +   +    ++ Q+V   L++ +V++   L  AF  FDR   G +  S+    L      + + QF  L  KL +GE+  + +  FL+ F           W++       P +     ++ +D+   + E +   F+ ++  FI+L  +    +   + + L ++  + ++  + + LW     N    L YH+F      L +FG GD +        G  +  I    +AL  +                  ++N+     Q           ++ E +   ++  L+  + +   A +    ++T  G  T ND + +L Q +     ++  +L  +      +   SY  F   F++  L     EK+       Q    P   G +    LN+      I  +++D +  + + FL  D   +G++S+ EF+ +L    L+L++ +F
Sbjct:  384 PNHRVNP---VRGESPVVSSEHILQKLQRHFQDAYPSLKQAFLVLDEGRKGRISRKELRRIVDCMMFRVTDAQFKELMIILDPQHT-GFISYLQFLDLFEDKESVSGHKWLHNMRTP-LKETPVTL----------------------------------------EW-------EKMGNILCEKIEHNWADFSKAMKSCDSAGCGMVDKDQFKRILQSFCPPLSDRHYNMLCEQYNDGANGYISYMDFLRNVGVCTSAAGDLNGVSTEIVHGSQLREELRQDDLSARMKEIESQATQLVKKMPVEEVIGKLKDCVIGQEFSPRESFLAFAKQHKGRISKKDFRKVLREHEIHLDEDQFKRLTEKLGFTKE-ELSYLDFVSLFEDP-TGNGPGAALDTGSNHHVNDTKF--HYMSAEDCLAQLRDKLQQGYGDLYSAFYKIDSNRDGLVTMHDFRHLLDSFMFIIKPQEFQRLLGLLGLNLSSTLNYKEFLHLFQKPQSPVYPPWLQSSHSPKQSMGGEDLACEQAHYYLVTKAQGRWHDMAKTFCEIDSEGNGIVQKKDLRNVLFRFYLPIHPKEFEKLWGRYD-PEGKGFLTHNEFLEKLGISFASGD-SGPSKQITEDNRACLEGHYNNQLKIQEEMDAFHKHQTKALDMKDIEQQIKDKFRDYYHDFSAAFAKIDRN-KDGQISVHDLRAMLQSLNFHLDDEQFANLLYRLRIKVTD-NKLSYPDFLRMIDDGRAS------------KYGQRQRPVSAAETPPKLSLQKVLLKLKEAVVSSHDALYKAFSSFDRDGTGTIKASELHQILDSFCFKLSDRQFGYLLSKLPLGEEQTIDWKAFLHHFSTSHPEPSS-SWVERVQHATRPRSTQ--GLTMKDILNHIREVVTARFYTVAQDFISLDYANINAVSKEDFRELFNKDFMLLTDEQFENLWNTLPLNPYGNLKYHEF------LSQFGGGDALVSPYEKTAGDQSEFIYKPASALAGNHTPPESQAGIRRPKTAPAILNKPKTDTQRPKTAGASSRLVNCEQIEARLRGSLQKVWQEVLRACRDYDPERT--GEITTNDFSGVLKQFNAETNEEELERLTVKYDSRN-NGKFSYADF---FRNIMLGPKPLEKSPLHRMKVQKTRVPISTGPDGPCFLNAMM---RIQPKVLDCWRPMRRAFLSFDEARTGFISVQEFKQVLRKSGLNLSEDEF 1506          

HSP 3 Score: 89.7373 bits (221), Expect = 4.247e-17
Identity = 111/552 (20.11%), Postives = 229/552 (41.49%), Query Frame = 3
Query: 2436 EVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVL----GTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNI-DGQEKTVGSIRINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGFNQK---LNNLDIQXXXXXXXXXXXXXTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLKKNEFDNVNYGEFVK 4067
            E+E ++ +++  N  D+  AF   D      + + +F   L   ++ +   QF+ L EK+ V     + Y DFL +F          + +  K  ++    N V  +S  ++ + L   + +    +  +      +  G I+ + L+ +L      M  +E +KLW RY    +N LDY + L NLG+       ++   +    +N  +AL    V +E + +++      L         ++ +   +++ +  +Y +   AF+A     + SG+ +   L  +++     + N  F +L  R+  +   D + +E+F   FQ   ++ +GQ  T+  ++ N  + NP +    E+  ++S  I   + +   D Y  +++ FLV+D    G +S  E R ++      +TD QF +        I+        I Y  F+  F  K     +  + +M          + ++++   + E I+     F  + KS D A    + K  F+ I++ F   + D H+              ++Y +F++
Sbjct:   58 EIEGIIYRRVNENEEDVTNAFLTLDTEQNFTVTRGEFYRVLQNFILPLTESQFNELLEKIPVNNNGTIPYLDFLAKFLRTSSSATCARSV--KRSWSCSQANQV--LSLNELEIRLKNTVSKNLKNVVRSCRLFDYNQNGQIQKQELRRILENCCFKMKTAEFEKLWNRYCIGKKNTLDYRELLRNLGV-------NVELHNKPTAENVASALNREAVQREQQKEKNCRPPPPLKELSAEDYTIDDIEAALRKKISASYPNLVKAFRAFDG--SHSGYVSAEALQSVINNFIFPLPNGTFQKLMNRLAIKC-TDRIGWEQFLRRFQGPESMANGQ--TI-PMKPNHRV-NPVR---GESPVVSSEHILQKLQRHFQDAYPSLKQAFLVLDEGRKGRISRKELRRIVDCMMFRVTDAQFKEL------MIILDPQHTGFISYLQFLDLFEDKESVSGHKWLHNMRTPLKETPVTLEWEKMGNILCEKIEHNWADFSKAMKSCDSAGCGMVDKDQFKRILQSFCPPLSDRHYNMLCEQYNDGANGYISYMDFLR 582          

HSP 4 Score: 77.0258 bits (188), Expect = 3.075e-13
Identity = 48/202 (23.76%), Postives = 93/202 (46.04%), Query Frame = 3
Query: 4182 ESIRKNLERLLNRNWQSIFNKCKAIDQAINECQTAEGSIPIDDFVYILSEYDDSLSAENLAAINL-YKTCKNGRFIKYGDLIRSIVLSSRGSLISNENVTEVQKKFLNVGIKTTNSDNSKDYFPQLFKLRRQILENWKDLRKNFLQSDKKQNGAVSGNIFMTIMKTVCGQLSADLFYHLMKIYDQDGTGNFHYKRFIEDFLK 4784
            E I   L   L + WQ +   C+  D          G I  +DF  +L +++   + E L  + + Y +  NG+F  Y D  R+I+L  +    S  +  +VQK      +  +   +   +   + +++ ++L+ W+ +R+ FL  D+ + G +S   F  +++     LS D F+H++  +D+D      Y  F+  FL+
Sbjct: 1342 EQIEARLRGSLQKVWQEVLRACRDYDPE------RTGEITTNDFSGVLKQFNAETNEEELERLTVKYDSRNNGKF-SYADFFRNIMLGPKPLEKSPLHRMKVQK----TRVPISTGPDGPCFLNAMMRIQPKVLDCWRPMRRAFLSFDEARTGFISVQEFKQVLRKSGLNLSEDEFFHILGFFDKDLKAKVSYNDFLRAFLR 1532          

HSP 5 Score: 73.559 bits (179), Expect = 2.901e-12
Identity = 156/834 (18.71%), Postives = 316/834 (37.89%), Query Frame = 3
Query:  642 YNAYTIDDIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETINIDTRNTKGSRIFEAALIENGLLGSNEL--EQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNIDDLLELLSNH-----------------ISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPH-NEGYISYHHFLQLFEQKENLSAHKWLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVA--PLTLKDKKGRINYLELFNLLNVDTSPSDLEGL--STQIAESNDAQLKERHENHIEKMESIE---------KLGEARLNLMSPEELIVRI-KDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFG-----YTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLM---TDVCFL--PKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSK--HRFNDPSTNAVPDMSAED------VYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFL 2987
            ++  + +D +  L+ ++ +    +  AF   D N D  +  H  + ++++F   +  Q+F +L+     + +  +NY EF+     P   Q  +                      +++      +G  +L  EQ       K + ++  + KTF  +D    G V  + L  +L +F  P+    F ++  +   +  G +    FL+K     +   +G +  I  D++       N++  I + ++    H                   + Y  F  AF +I++   G+I   +   +L    F++  +Q + +L  L     +  +SY  FL++ +      A K+      V       +LS + +   + + + +    +   F+  D + TG I   +L +I       L D     L++  PL  +       +L  F+  + + S S +E +  +T+   +    +K+   NHI ++ +            L  A +N +S E+      KD ++     +  L+     N         +  + L+QFG      +   +     SE +  P S+         LA      ES   +    T    L  PK++       G  +R +NC+++E  LR  +   + +++ A   +D    G +  +DF   L         ++ + L  K       K +Y DF     +      G K L+    HR     T  VP  +  D        M +  K+   +  +   F++   + TGFI  +  + +L +  +++S+ E   +   +D + + K+ Y+DFL
Sbjct:  738 FHYMSAEDCLAQLRDKLQQGYGDLYSAFYKIDSNRDGLVTMHDFRHLLDSFMFIIKPQEFQRLLGLLGLNLSSTLNYKEFLHLFQKP---QSPVYPP-----------------WLQSSHSPKQSMGGEDLACEQAHYYLVTKAQGRWHDMAKTFCEIDSEGNGIVQKKDLRNVLFRFYLPIHPKEFEKLWGRYDPEGKGFLTHNEFLEKLGISFASGDSGPSKQITEDNRACLEGHYNNQLKIQEEMDAFHKHQTKALDMKDIEQQIKDKFRDYYHDFSAAFAKIDRNKDGQISVHDLRAMLQSLNFHLDDEQFANLLYRLRIKVTDNKLSYPDFLRMIDDGR---ASKYGQRQRPVSAAETPPKLSLQKVLLKLKEAVVSSHDALYKAFSSFDRDGTGTIKASELHQILDSFCFKLSDRQFGYLLSKLPLGEEQTIDWKAFLHHFSTSHPEPSSSWVERVQHATRPRSTQGLTMKDIL-NHIREVVTARFYTVAQDFISLDYANINAVSKEDFRELFNKDFMLLTDEQFENLWNTLPLNP----YGNLKYHEFLSQFGGGDALVSPYEKTAGDQSEFIYKPASA---------LAGNHTPPESQAGIRRPKTAPAILNKPKTDTQRPKTAGASSRLVNCEQIEARLRGSLQKVWQEVLRACRDYDPERTGEITTNDFSGVLKQFNAETNEEELERLTVKYDSRNNGKFSYADFFRNIML------GPKPLEKSPLHRMKVQKTR-VPISTGPDGPCFLNAMMRIQPKVLDCWRPMRRAFLSFDEARTGFISVQEFKQVLRKSGLNLSEDEFFHILGFFDKDLKAKVSYNDFL 1527          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Xenopus
Match: immp2l (inner mitochondrial membrane peptidase subunit 2 [Source:Xenbase;Acc:XB-GENE-1010851])

HSP 1 Score: 420.624 bits (1080), Expect = 8.361e-122
Identity = 327/1310 (24.96%), Postives = 595/1310 (45.42%), Query Frame = 3
Query:  180 DPKLQISEINPIVKSQLLKNHKEILKALQTFDIECSGLVTKGELRRVLDSYCLPMTTDQYEQFLSHNSINYSKGSINYKELIDKIYDKTSAVGHFKKNIKLPQLQRSATTICLQNKHFTLPTTRRSSGKISRSQLFXXXXXXXXXXXXXXXXWNYNAYTIDDIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETIN---IDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHKWLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPS-DLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTHLHVEHLFEM------VKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQEKTVGSI-RINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGFN----QKLNNLDIQXXXXXXXXXXXXXTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLKKNEFDNVNYGEFV 4064
            DP L   EI  I+  ++ +N +++  A  T D E +  VT+GE  RVL ++ LP+T  Q+ + L    +N + G+I Y + + K                   L+ S++  C +       + +RS      +Q+                       +++++   L+  +S+N   ++++ +LFD+N +  IQ+  L++++EN C  +   +F+KL  R+   +   ++Y E ++ +G+ ++       +N    +N   +     K         ++        ++ +    RKKI   +  L K F   D +  G+V+ E L  ++N F FP+    F ++M++ A K T +I W  FL++FQ P+S   NG TI +K +H+ NP++G +   + + +L+ L  H  + Y S + AFL +++  KG+I + E  +I++   F ++  Q   ++  LDP + G+ISY  FL LFE KE++                         + + + + I + W++        D    G +  +  K+I +     L D   + L          G I+Y++    + V TS + DL G+ST+I   +  + + R ++   +M+ IE      +  M  EE+I ++KD ++    +  E +  +     KG I+K   RK+L +    L  +QF +++E L F   +K  + +  F+++F D   +      D      SNHHVND +      M+ ++    LR K+   + DL  AF+K D +  G +   DF++ L   + +I+  +F  L   LG+   S L Y +FL+ FQ     V    WL S H  +   +    D++ E  +  L  K    +H+++ TF  + + G G ++ ++L+++L R  + +   E +KLW RYD   +  L +++FL  LG+   F  GD  GPS  I +++   L  H  NQ  K Q+ +D       H H     +M      +K   R  Y D + AF  +   K   G  +++DL  +L  L+  + +++F  L  R+  +  D+ LSY  F  +       DG+    G   R     E P K+ ++        ++   + + +V  +  + K F   D + +G +  +E   +L  FC  L+D+QF    + L          +  ID++ F+  F+    +  ++   +   A    +   +T + I  HI E +  R       F S DYA++N +SK DFRE+  +    + D  FE  W+ L  N + N+ Y EF+
Sbjct:   51 DPTLTPLEIEGIIYRRVNENEEDVTNAFLTLDTEQNFTVTRGEFYRVLQNFILPLTESQFNELLEKIPVN-NNGTIPYLDFLAKF------------------LRTSSSATCAR-------SVKRSWSCSQANQVL----------------------SLNELEIRLKNTVSKNLKNVVRSCRLFDYNQNGQIQKQELRRILENCCFKMKTAEFEKLWNRYCIGKKNTLDYRELLRNLGVNVELHNKPTAENVASALNREAVQREQQKEKNCRPPPPLKELSAEDYTIDDIEAALRKKISASYPNLVKAFRAFDGSHSGYVSAEALQSVINNFIFPLPNGTFQKLMNRLAIKCTDRIGWEQFLRRFQGPESM-ANGQTIPMKPNHRVNPVRGESPVVSSEHILQKLQRHFQDAYPSLKQAFLVLDEGRKGRISRKELRRIVDCMMFRVTDAQFKELMIILDPQHTGFISYLQFLDLFEDKESV-------------------------MGNILCEKIEHNWADFSKAMKSCDSAGCGMVDKDQFKRILQSFCPPLSDRHYNMLCEQYN-DGANGYISYMDFLRNVGVCTSAAGDLNGVSTEIVHGSQLREELRQDDLSARMKEIESQATQLVKKMPVEEVIGKLKDCVIGQEFSPRESFLAF-AKQHKGRISKKDFRKVLREHEIHLDEDQFKRLTEKLGF---TKEELSYLDFVSLFEDPTGNGPGAALDT----GSNHHVNDTKF---HYMSAEDCLAQLRDKLQQGYGDLYSAFYKIDSNRDGLVTMHDFRHLLDSFMFIIKPQEFQRLLGLLGLNLSSTLNYKEFLHLFQKPQSPV-YPPWLQSSH--SPKQSMGGEDLACEQAHYYLVTKAQGRWHDMAKTFCEIDSEGNGIVQKKDLRNVLFRFYLPIHPKEFEKLWGRYDPEGKGFLTHNEFLEKLGI--SFASGD-SGPSKQITEDNRACLEGHYNNQ-LKIQEEMD-----AFHKHQTKALDMKDIEQQIKDKFRDYYHDFSAAFAKIDRNK--DGQISVHDLRAMLQSLNFHLDDEQFANLLYRLRIKVTDNKLSYPDFLRMID-----DGRASKYGQRQRPVSAAETPPKLSLQ--------KVLLKLKEAVVSSHDALYKAFSSFDRDGTGTIKASELHQILDSFCFKLSDRQFGYLLSKLPL------GEEQTIDWKAFLHHFSTSHPEPSSSWVERVQHATRPRSTQGLTMKDILNHIREVVTARFYTVAQDFISLDYANINAVSKEDFRELFNKDFMLLTDEQFENLWNTLPLNPYGNLKYHEFL 1241          

HSP 2 Score: 185.267 bits (469), Expect = 2.453e-46
Identity = 203/1033 (19.65%), Postives = 427/1033 (41.34%), Query Frame = 3
Query:  675 ILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETINIDTR-----NTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHKWLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDN-RNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLM--------GPSAAIIQNSHNALVDH------------------LVNQETKHQQSVDNQAVLGTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQD-SLNIDGQEKTVGSIRINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQF 3674
            IL  +I  N     KA K  D      + + + K+++++FC PL+++ ++ L  +++   NG ++YM+F++ +G+     G +   ++E       R     +   +R+ E       L+    +E+++   +  +  Q    R++FL      +G ++ +   K+L +    +  + F ++ +K  F    ++ +L F+  F+DP + +  G+ +   S+H  N  +      + +D L  L + +   Y     AF +I+    G +   +F  +L+ F F I   +   +L  L  +    ++Y  FL LF++ ++     WL S+H   +      L+ E     +      +W ++   F  +D    G +  +DL+ +  + +  +   + ++L       + KG + + E    L +  +  D  G S QI E N A L+  + N ++  E ++   + +   +  +++  +IKD+      ++   + K + N K G I+   LR ML    + L +EQF+ +   L    +  +++ +  FL +  D R S            K       +   +    ++ Q+V   L++ +V++   L  AF  FDR   G +  S+    L      + + QF  L  KL +GE+  + +  FL+ F           W++       P +     ++ +D+   + E +   F+ ++  FI+L  +    +   + + L ++  + ++  + + LW     N    L YH+F      L +FG GD +        G  +  I    +AL  +                  ++N+     Q           ++ E +   ++  L+  + +   A +    ++T  G  T ND + +L Q +     ++  +L  +      +   SY  F   F++  L     EK+       Q    P   G +    LN+      I  +++D +  + + FL  D   +G++S+ EF+ +L    L+L++ +F
Sbjct:  488 ILCEKIEHNWADFSKAMKSCDSAGCGMVDKDQFKRILQSFCPPLSDRHYNMLCEQYNDGANGYISYMDFLRNVGVCTSAAGDLNGVSTEIVHGSQLREELRQDDLSARMKEIESQATQLVKKMPVEEVIGKLKDCVIGQEFSPRESFLAFAKQHKGRISKKDFRKVLREHEIHLDEDQFKRLTEKLGFTKE-ELSYLDFVSLFEDP-TGNGPGAALDTGSNHHVNDTKF--HYMSAEDCLAQLRDKLQQGYGDLYSAFYKIDSNRDGLVTMHDFRHLLDSFMFIIKPQEFQRLLGLLGLNLSSTLNYKEFLHLFQKPQSPVYPPWLQSSHSPKQSMGGEDLACEQAHYYLVTKAQGRWHDMAKTFCEIDSEGNGIVQKKDLRNVLFRFYLPIHPKEFEKLWGRYD-PEGKGFLTHNEFLEKLGISFASGD-SGPSKQITEDNRACLEGHYNNQLKIQEEMDAFHKHQTKALDMKDIEQQIKDKFRDYYHDFSAAFAKIDRN-KDGQISVHDLRAMLQSLNFHLDDEQFANLLYRLRIKVTD-NKLSYPDFLRMIDDGRAS------------KYGQRQRPVSAAETPPKLSLQKVLLKLKEAVVSSHDALYKAFSSFDRDGTGTIKASELHQILDSFCFKLSDRQFGYLLSKLPLGEEQTIDWKAFLHHFSTSHPEPSS-SWVERVQHATRPRSTQ--GLTMKDILNHIREVVTARFYTVAQDFISLDYANINAVSKEDFRELFNKDFMLLTDEQFENLWNTLPLNPYGNLKYHEF------LSQFGGGDALVSPYEKTAGDQSEFIYKPASALAGNHTPPESQAGIRRPKTAPAILNKPKTDTQRPKTAGASSRLVNCEQIEARLRGSLQKVWQEVLRACRDYDPERT--GEITTNDFSGVLKQFNAETNEEELERLTVKYDSRN-NGKFSYADF---FRNIMLGPKPLEKSPLHRMKVQKTRVPISTGPDGPCFLNAMM---RIQPKVLDCWRPMRRAFLSFDEARTGFISVQEFKQVLRKSGLNLSEDEF 1482          

HSP 3 Score: 86.6557 bits (213), Expect = 3.124e-16
Identity = 111/552 (20.11%), Postives = 223/552 (40.40%), Query Frame = 3
Query: 2436 EVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVL----GTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNI-DGQEKTVGSIRINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGFNQK---LNNLDIQXXXXXXXXXXXXXTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLKKNEFDNVNYGEFVK 4067
            E+E ++ +++  N  D+  AF   D      + + +F   L   ++ +   QF+ L EK+ V     + Y DFL +F          + +  K  ++    N V  +S  ++ + L   + +    +  +      +  G I+ + L+ +L      M  +E +KLW RY    +N LDY + L NLG+       ++   +    +N  +AL    V +E + +++      L         ++ +   +++ +  +Y +   AF+A     + SG+ +   L  +++     + N  F +L  R+  +   D + +E+F   FQ   ++ +GQ  T+  ++ N  + NP +    E+  ++S  I   + +   D Y  +++ FLV+D    G +S  E R ++      +TD QF +        I+        I Y  F+  F  K   + N+                        + E I+     F  + KS D A    + K  F+ I++ F   + D H+              ++Y +F++
Sbjct:   58 EIEGIIYRRVNENEEDVTNAFLTLDTEQNFTVTRGEFYRVLQNFILPLTESQFNELLEKIPVNNNGTIPYLDFLAKFLRTSSSATCARSV--KRSWSCSQANQV--LSLNELEIRLKNTVSKNLKNVVRSCRLFDYNQNGQIQKQELRRILENCCFKMKTAEFEKLWNRYCIGKKNTLDYRELLRNLGV-------NVELHNKPTAENVASALNREAVQREQQKEKNCRPPPPLKELSAEDYTIDDIEAALRKKISASYPNLVKAFRAFDG--SHSGYVSAEALQSVINNFIFPLPNGTFQKLMNRLAIKC-TDRIGWEQFLRRFQGPESMANGQ--TI-PMKPNHRV-NPVR---GESPVVSSEHILQKLQRHFQDAYPSLKQAFLVLDEGRKGRISRKELRRIVDCMMFRVTDAQFKEL------MIILDPQHTGFISYLQFLDLFEDKESVMGNI------------------------LCEKIEHNWADFSKAMKSCDSAGCGMVDKDQFKRILQSFCPPLSDRHYNMLCEQYNDGANGYISYMDFLR 558          

HSP 4 Score: 76.6406 bits (187), Expect = 3.304e-13
Identity = 48/202 (23.76%), Postives = 93/202 (46.04%), Query Frame = 3
Query: 4182 ESIRKNLERLLNRNWQSIFNKCKAIDQAINECQTAEGSIPIDDFVYILSEYDDSLSAENLAAINL-YKTCKNGRFIKYGDLIRSIVLSSRGSLISNENVTEVQKKFLNVGIKTTNSDNSKDYFPQLFKLRRQILENWKDLRKNFLQSDKKQNGAVSGNIFMTIMKTVCGQLSADLFYHLMKIYDQDGTGNFHYKRFIEDFLK 4784
            E I   L   L + WQ +   C+  D          G I  +DF  +L +++   + E L  + + Y +  NG+F  Y D  R+I+L  +    S  +  +VQK      +  +   +   +   + +++ ++L+ W+ +R+ FL  D+ + G +S   F  +++     LS D F+H++  +D+D      Y  F+  FL+
Sbjct: 1318 EQIEARLRGSLQKVWQEVLRACRDYDPE------RTGEITTNDFSGVLKQFNAETNEEELERLTVKYDSRNNGKF-SYADFFRNIMLGPKPLEKSPLHRMKVQK----TRVPISTGPDGPCFLNAMMRIQPKVLDCWRPMRRAFLSFDEARTGFISVQEFKQVLRKSGLNLSEDEFFHILGFFDKDLKAKVSYNDFLRAFLR 1508          

HSP 5 Score: 73.559 bits (179), Expect = 2.889e-12
Identity = 156/834 (18.71%), Postives = 316/834 (37.89%), Query Frame = 3
Query:  642 YNAYTIDDIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETINIDTRNTKGSRIFEAALIENGLLGSNEL--EQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNIDDLLELLSNH-----------------ISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPH-NEGYISYHHFLQLFEQKENLSAHKWLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVA--PLTLKDKKGRINYLELFNLLNVDTSPSDLEGL--STQIAESNDAQLKERHENHIEKMESIE---------KLGEARLNLMSPEELIVRI-KDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFG-----YTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLM---TDVCFL--PKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSK--HRFNDPSTNAVPDMSAED------VYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFL 2987
            ++  + +D +  L+ ++ +    +  AF   D N D  +  H  + ++++F   +  Q+F +L+     + +  +NY EF+     P   Q  +                      +++      +G  +L  EQ       K + ++  + KTF  +D    G V  + L  +L +F  P+    F ++  +   +  G +    FL+K     +   +G +  I  D++       N++  I + ++    H                   + Y  F  AF +I++   G+I   +   +L    F++  +Q + +L  L     +  +SY  FL++ +      A K+      V       +LS + +   + + + +    +   F+  D + TG I   +L +I       L D     L++  PL  +       +L  F+  + + S S +E +  +T+   +    +K+   NHI ++ +            L  A +N +S E+      KD ++     +  L+     N         +  + L+QFG      +   +     SE +  P S+         LA      ES   +    T    L  PK++       G  +R +NC+++E  LR  +   + +++ A   +D    G +  +DF   L         ++ + L  K       K +Y DF     +      G K L+    HR     T  VP  +  D        M +  K+   +  +   F++   + TGFI  +  + +L +  +++S+ E   +   +D + + K+ Y+DFL
Sbjct:  714 FHYMSAEDCLAQLRDKLQQGYGDLYSAFYKIDSNRDGLVTMHDFRHLLDSFMFIIKPQEFQRLLGLLGLNLSSTLNYKEFLHLFQKP---QSPVYPP-----------------WLQSSHSPKQSMGGEDLACEQAHYYLVTKAQGRWHDMAKTFCEIDSEGNGIVQKKDLRNVLFRFYLPIHPKEFEKLWGRYDPEGKGFLTHNEFLEKLGISFASGDSGPSKQITEDNRACLEGHYNNQLKIQEEMDAFHKHQTKALDMKDIEQQIKDKFRDYYHDFSAAFAKIDRNKDGQISVHDLRAMLQSLNFHLDDEQFANLLYRLRIKVTDNKLSYPDFLRMIDDGR---ASKYGQRQRPVSAAETPPKLSLQKVLLKLKEAVVSSHDALYKAFSSFDRDGTGTIKASELHQILDSFCFKLSDRQFGYLLSKLPLGEEQTIDWKAFLHHFSTSHPEPSSSWVERVQHATRPRSTQGLTMKDIL-NHIREVVTARFYTVAQDFISLDYANINAVSKEDFRELFNKDFMLLTDEQFENLWNTLPLNP----YGNLKYHEFLSQFGGGDALVSPYEKTAGDQSEFIYKPASA---------LAGNHTPPESQAGIRRPKTAPAILNKPKTDTQRPKTAGASSRLVNCEQIEARLRGSLQKVWQEVLRACRDYDPERTGEITTNDFSGVLKQFNAETNEEELERLTVKYDSRNNGKFSYADFFRNIML------GPKPLEKSPLHRMKVQKTR-VPISTGPDGPCFLNAMMRIQPKVLDCWRPMRRAFLSFDEARTGFISVQEFKQVLRKSGLNLSEDEFFHILGFFDKDLKAKVSYNDFL 1503          

HSP 6 Score: 52.7582 bits (125), Expect = 7.002e-6
Identity = 94/459 (20.48%), Postives = 173/459 (37.69%), Query Frame = 3
Query: 3504 LNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGFNQKLNNLDIQXXXXXX---XXXXXXXTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLKKNEFDNVNYGEFVKMXXXXXXXXXXXXXXXXXXXXXXXXXXNNIETDEMDTDESIRKNLERLLNRNWQSIFNKCK---------AIDQAINECQTA-----EGSIPIDDFVYILSEYDDS----LSAENLAAI--NLYKTCKNGRF--------IKYGDLIRSIVLSSR---GSLISNENVTEVQKKFLNVGIKTTNSDNSKDYFPQLFKLRRQILENWKDLRKNFLQSDKKQNGAVSGNIFMTIMKTVCGQLSADLFYHLMKIYDQDGTGNFHYKRFIEDF 4778
            L   +I  II +R+ +   ++   FL +D E +  V+  EF  +L  F L LT+ QFN+    +        N +  I Y  F+  F +  ++             +     ++  +++  +  ++    K  + S +  DY     I K + R I+E   F +  + FEK W+     + + ++Y E ++ +                          N+E     T E++   L R   +  Q     C+         A D  I++ + A       S P  + V     +D S    +SAE L ++  N      NG F        IK  D I       R      ++N     ++       ++  +   S ++  Q  KL+R   + +  L++ FL  D+ + G +S      I+  +  +++   F  LM I D   TG   Y +F++ F
Sbjct:   54 LTPLEIEGIIYRRVNENEEDVTNAFLTLDTEQNFTVTRGEFYRVLQNFILPLTESQFNELLEKIPV------NNNGTIPYLDFLAKFLRTSSSATCARSVKRSWSCSQANQVLSLNELEIRLKNTVSKNLKNVVRSCRLFDYNQNGQIQKQELRRILENCCFKMKTAEFEKLWNRYCIGKKNTLDYRELLRNLGV------------------------NVELHNKPTAENVASALNREAVQREQQKEKNCRPPPPLKELSAEDYTIDDIEAALRKKISASYP--NLVKAFRAFDGSHSGYVSAEALQSVINNFIFPLPNGTFQKLMNRLAIKCTDRIGWEQFLRRFQGPESMANGQTIPMKPNHRVNPVRGESPVVSSEHILQ--KLQRHFQDAYPSLKQAFLVLDEGRKGRISRKELRRIVDCMMFRVTDAQFKELMIILDPQHTGFISYLQFLDLF 478          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Xenopus
Match: immp2l (inner mitochondrial membrane peptidase subunit 2 [Source:Xenbase;Acc:XB-GENE-1010851])

HSP 1 Score: 339.732 bits (870), Expect = 7.694e-95
Identity = 243/941 (25.82%), Postives = 448/941 (47.61%), Query Frame = 3
Query:  180 DPKLQISEINPIVKSQLLKNHKEILKALQTFDIECSGLVTKGELRRVLDSYCLPMTTDQYEQFLSHNSINYSKGSINYKELIDKIYDKTSAVGHFKKNIKLPQLQRSATTICLQNKHFTLPTTRRSSGKISRSQLFXXXXXXXXXXXXXXXXWNYNAYTIDDIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETIN---IDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHKWLNSNHKVVEPRKD--LQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPS-DLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDF 2984
            DP L   EI  I+  ++ +N +++  A  T D E +  VT+GE  RVL ++ LP+T  Q+ + L    +N + G+I Y + + K                   L+ S++  C +       + +RS      +Q+                       +++++   L+  +S+N   ++++ +LFD+N +  IQ+  L++++EN C  +   +F+KL  R+   +   ++Y E ++ +G+ ++       +N    +N   +     K         ++        ++ +    RKKI   +  L K F   D +  G+V+ E L  ++N F FP+    F ++M++ A K T +I W  FL++FQ P+S   NG TI +K +H+ NP++G +   + + +L+ L  H  + Y S + AFL +++  KG+I + E  +I++   F ++  Q   ++  LDP + G+ISY  FL LFE KE++S HKWL   H +  P K+  + L  E + + + + I + W++        D    G +  +  K+I +     L D   + L          G I+Y++    + V TS + DL G+ST+I   +  + + R ++   +M+ IE      +  M  EE+I ++KD ++    +  E +  +     KG I+K   RK+L +    L  +QF +++E L F   +K  + +  F+++F D   +      D      SNHHVND +      M+ ++    LR K+   + DL  AF+K D +  G +   DF++ L   + +I+  +F  L   LG+   S L Y +FL+ FQ     V    WL S H  +   +    D++ E  +  L  K    +H+++ TF  + + G G ++ ++L+++L R  + +   E +KLW R    ++ +  YHDF
Sbjct:   51 DPTLTPLEIEGIIYRRVNENEEDVTNAFLTLDTEQNFTVTRGEFYRVLQNFILPLTESQFNELLEKIPVN-NNGTIPYLDFLAKF------------------LRTSSSATCAR-------SVKRSWSCSQANQVL----------------------SLNELEIRLKNTVSKNLKNVVRSCRLFDYNQNGQIQKQELRRILENCCFKMKTAEFEKLWNRYCIGKKNTLDYRELLRNLGVNVELHNKPTAENVASALNREAVQREQQKEKNCRPPPPLKELSAEDYTIDDIEAALRKKISASYPNLVKAFRAFDGSHSGYVSAEALQSVINNFIFPLPNGTFQKLMNRLAIKCTDRIGWEQFLRRFQGPESM-ANGQTIPMKPNHRVNPVRGESPVVSSEHILQKLQRHFQDAYPSLKQAFLVLDEGRKGRISRKELRRIVDCMMFRVTDAQFKELMIILDPQHTGFISYLQFLDLFEDKESVSGHKWL---HNMRTPLKETPVTLEWEKMGNILCEKIEHNWADFSKAMKSCDSAGCGMVDKDQFKRILQSFCPPLSDRHYNMLCEQYN-DGANGYISYMDFLRNVGVCTSAAGDLNGVSTEIVHGSQLREELRQDDLSARMKEIESQATQLVKKMPVEEVIGKLKDCVIGQEFSPRESFLAF-AKQHKGRISKKDFRKVLREHEIHLDEDQFKRLTEKLGF---TKEELSYLDFVSLFEDPTGNGPGAALDT----GSNHHVNDTKF---HYMSAEDCLAQLRDKLQQGYGDLYSAFYKIDSNRDGLVTMHDFRHLLDSFMFIIKPQEFQRLLGLLGLNLSSTLNYKEFLHLFQKPQSPV-YPPWLQSSH--SPKQSMGGEDLACEQAHYYLVTKAQGRWHDMAKTFCEIDSEGNGIVQKKDLRNVLFRFYLPIHPKEFEKLWGR----DKFRDYYHDF 920          

HSP 2 Score: 198.364 bits (503), Expect = 2.426e-50
Identity = 260/1209 (21.51%), Postives = 488/1209 (40.36%), Query Frame = 3
Query:  663 DIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETINIDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKF-------QDPQSKHLNGS--TIAIKSDHK----CNPIQGVNSKP----NIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHKW--LNSNHKVVEPRKDLQL-SSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSD---LEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGG-INKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDD-------NRNMNCQEVEDLLRQKIVNNFPDLMI--------AFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGH-KWLD--SKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFL----------YNLGLLEKFGCGDLMGPSAAIIQNSHNALVD------HLVNQETKHQQSVDNQAVLGTHL-----------HVEHLFEMVKR-HLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQEKTVGSI-RINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGFN----QKLNNLDIQXXXXXXXXXXXXXTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLKKNEFDNVNYGEFV 4064
            +I  I+  +++ N   +  AF   D   ++ + R    +V++NF  PLTE QF++L+ +   + NG + Y++F+            ++T +S        R+   S+        N +L  NELE   +  +  +      + ++  + D N  G +  + L +IL    F M    F ++ ++        + +   L+           P ++++  +    A++ + +    C P   +         IDD+   L   IS +Y +   AF   + +H G +       ++N F F +       ++  L       I +  FL+ F+  E+++  +   +  NH+V   R +  + SSE I   +  +  + + ++   F ++D  R G IS ++L++I   +   + D     L+  L  +   G I+YL+  +L     S S    L  + T + E+             EKM +I                   + ++I  N  ++ +  K   C+    G ++K Q +++L  F   L++  ++ + E  N    +   I +  FL        ++ DL      +   +    ++R DD         +   Q V+ +  ++++    D +I        +F  F + +KG + K DF+  L  + I ++ DQF  L EKLG   K +L+Y DF++ F+  D   +G    LD  S H  ND   +    MSAED    L +K+ Q + ++   F  + ++  G +   + +HLL      +   E ++L      N  + L+Y +FL          Y   L         MG      + +H  LV       H + +      S  N  V    L           H +   ++  R   R  Y D + AF  +   K   G  +++DL  +L  L+  + +++F  L  R+  +  D+ LSY  F  +  D     G+    G   R     E P K+ ++        ++   + + +V  +  + K F   D + +G +  +E   +L  FC  L+D+QF    + L          +  ID++ F+  F+    +  ++   +   A    +   +T + I  HI E +  R       F S DYA++N +SK DFRE+  +    + D  FE  W+ L  N + N+ Y EF+
Sbjct:   58 EIEGIIYRRVNENEEDVTNAFLTLDTEQNFTVTRGEFYRVLQNFILPLTESQFNELLEKIPVNNNGTIPYLDFLAKF---------LRTSSSATCARSVKRSWSCSQA-------NQVLSLNELE---IRLKNTVSKNLKNVVRSCRLFDYNQNGQIQKQELRRILENCCFKMKTAEFEKLWNRYCIGKKNTLDYRELLRNLGVNVELHNKPTAENVASALNREAVQREQQKEKNCRPPPPLKELSAEDYTIDDIEAALRKKISASYPNLVKAFRAFDGSHSGYVSAEALQSVINNFIFPLPNGTFQKLMNRLAIKCTDRIGWEQFLRRFQGPESMANGQTIPMKPNHRVNPVRGESPVVSSEHILQKLQRHFQDAYPSLKQAFLVLDEGRKGRISRKELRRIVDCMMFRVTDAQFKELMIILDPQ-HTGFISYLQFLDLFEDKESVSGHKWLHNMRTPLKETPVTL-------EWEKMGNI-------------------LCEKIEHNWADFSKAMKS--CDSAGCGMVDKDQFKRILQSFCPPLSDRHYNMLCEQYN--DGANGYISYMDFLRNVGVCTSAAGDLNGVSTEIVHGSQLREELRQDDLSARMKEIESQATQLVKKMPVEEVIGKLKDCVIGQEFSPRESFLAFAKQHKGRISKKDFRKVLREHEIHLDEDQFKRLTEKLGF-TKEELSYLDFVSLFE--DPTGNGPGAALDTGSNHHVNDTKFHY---MSAEDCLAQLRDKLQQGYGDLYSAFYKIDSNRDGLVTMHDFRHLLDSFMFIIKPQEFQRLLGLLGLNLSSTLNYKEFLHLFQKPQSPVYPPWLQSSHSPKQSMGGEDLACEQAHYYLVTKAQGRWHDMAKTFCEIDSEGNGIVQKKDLRNVLFRFYLPIHPKEFEKLWGRDKFRDYYHDFSAAFAKIDRNK--DGQISVHDLRAMLQSLNFHLDDEQFANLLYRLRIKVTDNKLSYPDFLRMIDD-----GRASKYGQRQRPVSAAETPPKLSLQ--------KVLLKLKEAVVSSHDALYKAFSSFDRDGTGTIKASELHQILDSFCFKLSDRQFGYLLSKLPL------GEEQTIDWKAFLHHFSTSHPEPSSSWVERVQHATRPRSTQGLTMKDILNHIREVVTARFYTVAQDFISLDYANINAVSKEDFRELFNKDFMLLTDEQFENLWNTLPLNPYGNLKYHEFL 1189          

HSP 3 Score: 145.591 bits (366), Expect = 3.576e-34
Identity = 216/1175 (18.38%), Postives = 459/1175 (39.06%), Query Frame = 3
Query:  165 ANYKMDPKLQISEINPIVKS----QLLKNH-----KEILKALQTFDIECSGLVTKGELRRVLDSYCLPMTTDQYEQFLSHNSINYSKGSINYKELIDKIYDKTSAVGH-FKKNIKLPQLQRSATTICLQNKHFTLPTTRRSSGKISRSQLFXXXXXXXXXXXXXXXXWNYNAYTIDDIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETINIDTR-----NTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHKWLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVV------------------------------------------------HEFNL----VDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDK--KGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNR-ESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHK---------------WLDSKHR-----------------FNDPSTNAVPDMSA---------EDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSV--DNQAVLGTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGF 3350
             N++++P   +   +P+V S    Q L+ H       + +A    D    G +++ ELRR++D     +T  Q+++ +      ++ G I+Y + +D   DK S  GH +  N++ P L+ +  T+                                         W       + +  IL  +I  N     KA K  D      + + + K+++++FC PL+++ ++ L  +++   NG ++YM+F++ +G+     G +   ++E       R     +   +R+ E       L+    +E+++   +  +  Q    R++FL      +G ++ +   K+L +    +  + F ++ +K  F    ++ +L F+  F+DP + +  G+ +   S+H  N  +      + +D L  L + +   Y     AF +I+    G +   +F  +L+ F F I   +   +L  L  +    ++Y  FL LF++ ++     WL S+H   +      L+ E     +      +W ++                                                 H+F+     +D N+ G ISV DL+ + + L  +L D+    L+  L +K    +++Y +   +++        +G +++  +          +  +   E+  KL        S +++++++K+ +V    ++  LYK +   D+   G I  S+L ++L  F + L++ QF  +  +   P   +  ID+  FL  F+ +  E S+  +  V        H    R    + +  +++ + +R+ +   F  +   F   D +N   + K DF+     + +++ ++QF+ L   L +     L Y++FL++F   D +V  ++                L   H                   N P T+     +A         E +   L   + + + E+           TG I   +   +L +     ++ E+++L  +YD+ N  K  Y DF  N+          ++GP        H   V     Q+T+   S   D    L   + ++       R +R A+    L+F      +  +GF ++ +  ++L +  + ++ D+F  +   +GF
Sbjct:  384 PNHRVNP---VRGESPVVSSEHILQKLQRHFQDAYPSLKQAFLVLDEGRKGRISRKELRRIVDCMMFRVTDAQFKELMIILDPQHT-GFISYLQFLDLFEDKESVSGHKWLHNMRTP-LKETPVTL----------------------------------------EW-------EKMGNILCEKIEHNWADFSKAMKSCDSAGCGMVDKDQFKRILQSFCPPLSDRHYNMLCEQYNDGANGYISYMDFLRNVGVCTSAAGDLNGVSTEIVHGSQLREELRQDDLSARMKEIESQATQLVKKMPVEEVIGKLKDCVIGQEFSPRESFLAFAKQHKGRISKKDFRKVLREHEIHLDEDQFKRLTEKLGFTKE-ELSYLDFVSLFEDP-TGNGPGAALDTGSNHHVNDTKF--HYMSAEDCLAQLRDKLQQGYGDLYSAFYKIDSNRDGLVTMHDFRHLLDSFMFIIKPQEFQRLLGLLGLNLSSTLNYKEFLHLFQKPQSPVYPPWLQSSHSPKQSMGGEDLACEQAHYYLVTKAQGRWHDMAKTFCEIDSEGNGIVQKKDLRNVLFRFYLPIHPKEFEKLWGRDKFRDYYHDFSAAFAKIDRNKDGQISVHDLRAMLQSLNFHLDDEQFANLLYRLRIKVTDNKLSYPDFLRMID--------DGRASKYGQ---------RQRPVSAAETPPKL--------SLQKVLLKLKEAVVS---SHDALYKAFSSFDRDGTGTIKASELHQILDSFCFKLSDRQFGYL--LSKLPLGEEQTIDWKAFLHHFSTSHPEPSSSWVERV-------QHAT--RPRSTQGLTMKDILNHIREVVTARFYTVAQDFISLDYANINAVSKEDFRELFNKDFMLLTDEQFENLWNTLPLNPYGNLKYHEFLSQFGGGDALVSPYEKTAGDQSEFIYKPASALAGNHTPPESQAGIRRPKTAPAILNKPKTDTQRPKTAGASSRLVNCEQIEARLRGSLQKVWQEVLRACRDYDPERTGEITTNDFSGVLKQFNAETNEEELERLTVKYDSRNNGKFSYADFFRNI----------MLGPKPLEKSPLHRMKV-----QKTRVPISTGPDGPCFLNAMMRIQPKVLDCWRPMRRAF----LSF-----DEARTGFISVQEFKQVLRKSGLNLSEDEFFHI---LGF 1436          

HSP 4 Score: 89.3521 bits (220), Expect = 4.426e-17
Identity = 111/552 (20.11%), Postives = 229/552 (41.49%), Query Frame = 3
Query: 2436 EVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVL----GTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNI-DGQEKTVGSIRINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGFNQK---LNNLDIQXXXXXXXXXXXXXTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLKKNEFDNVNYGEFVK 4067
            E+E ++ +++  N  D+  AF   D      + + +F   L   ++ +   QF+ L EK+ V     + Y DFL +F          + +  K  ++    N V  +S  ++ + L   + +    +  +      +  G I+ + L+ +L      M  +E +KLW RY    +N LDY + L NLG+       ++   +    +N  +AL    V +E + +++      L         ++ +   +++ +  +Y +   AF+A     + SG+ +   L  +++     + N  F +L  R+  +   D + +E+F   FQ   ++ +GQ  T+  ++ N  + NP +    E+  ++S  I   + +   D Y  +++ FLV+D    G +S  E R ++      +TD QF +        I+        I Y  F+  F  K     +  + +M          + ++++   + E I+     F  + KS D A    + K  F+ I++ F   + D H+              ++Y +F++
Sbjct:   58 EIEGIIYRRVNENEEDVTNAFLTLDTEQNFTVTRGEFYRVLQNFILPLTESQFNELLEKIPVNNNGTIPYLDFLAKFLRTSSSATCARSV--KRSWSCSQANQV--LSLNELEIRLKNTVSKNLKNVVRSCRLFDYNQNGQIQKQELRRILENCCFKMKTAEFEKLWNRYCIGKKNTLDYRELLRNLGV-------NVELHNKPTAENVASALNREAVQREQQKEKNCRPPPPLKELSAEDYTIDDIEAALRKKISASYPNLVKAFRAFDG--SHSGYVSAEALQSVINNFIFPLPNGTFQKLMNRLAIKC-TDRIGWEQFLRRFQGPESMANGQ--TI-PMKPNHRV-NPVR---GESPVVSSEHILQKLQRHFQDAYPSLKQAFLVLDEGRKGRISRKELRRIVDCMMFRVTDAQFKEL------MIILDPQHTGFISYLQFLDLFEDKESVSGHKWLHNMRTPLKETPVTLEWEKMGNILCEKIEHNWADFSKAMKSCDSAGCGMVDKDQFKRILQSFCPPLSDRHYNMLCEQYNDGANGYISYMDFLR 582          

HSP 5 Score: 80.1073 bits (196), Expect = 3.644e-14
Identity = 197/1015 (19.41%), Postives = 378/1015 (37.24%), Query Frame = 3
Query:  189 LQISEINPIVKSQLLKNHKEILKALQTFDIECSGLVTKGELRRVLDSYCLPMTTDQYEQFLSHNSINYSKGSINYKELIDKIYDKTSAVGHFKKNIKLPQLQRSATTICLQNKHFTLPTTRRSSGKISRSQLFXXXXXXXXXXXXXXXXWNYNAYTIDDIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDN-QGTIQTKNSEETINIDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQS--------------KHLNGSTIAIKSDHK--CNPIQG-----------VNSKPN----IDDLLELL-----------------SNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPH-NEGYISYHHFLQLFEQKENLSAHKWLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVA--PLTLKDKKGRINYLELFNLLNVDTSPSDLEGL--STQIAESNDAQLKERHENHIEKMESIE---------KLGEARLNLMSPEELIVRI-KDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFG-----YTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLM---TDVCFL--PKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSK--HRFNDPSTNAVPDMSAED------VYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFL 2987
            L+  ++  I+  ++  N  +  KA+++ D    G+V K + +R+L S+C P++ D++   L     + + G I+Y + +  +   TSA G          L   +T I                G   R +L     S  +   +S  +       ++++I  L+  +        ++F  F       I +   +KV+      L E QF +L  +   ++   ++Y++F+     P  N  G      S   +N DT+    S                  E  L   R K++  +  L   F  +D N +G VT+     +L+ F F +    F +++       +  + +  FL  FQ PQS              + + G  +A +  H       QG           ++S+ N      DL  +L                  +   + Y  F  AF +I++   G+I   +   +L    F++  +Q + +L  L     +  +SY  FL++ +      A K+      V       +LS + +   + + + +    +   F+  D + TG I   +L +I       L D     L++  PL  +       +L  F+  + + S S +E +  +T+   +    +K+   NHI ++ +            L  A +N +S E+      KD ++     +  L+     N         +  + L+QFG      +   +     SE +  P S+         LA      ES   +    T    L  PK++       G  +R +NC+++E  LR  +   + +++ A   +D    G +  +DF   L         ++ + L  K       K +Y DF     +      G K L+    HR     T  VP  +  D        M +  K+   +  +   F++   + TGFI  +  + +L +  +++S+ E   +   +D + + K+ Y+DFL
Sbjct:  504 LEWEKMGNILCEKIEHNWADFSKAMKSCDSAGCGMVDKDQFKRILQSFCPPLS-DRHYNMLCEQYNDGANGYISYMDFLRNVGVCTSAAG---------DLNGVSTEIV--------------HGSQLREELRQDDLSARMKEIESQATQLVKKMPVEEVIGKLKDCVIGQEFSPRESFLAFAKQHKGRISKKDFRKVLREHEIHLDEDQFKRLTEKLGFTKE-ELSYLDFVSLFEDPTGNGPGAALDTGSNHHVN-DTKFHYMS-----------------AEDCLAQLRDKLQQGYGDLYSAFYKIDSNRDGLVTMHDFRHLLDSFMFIIKPQEFQRLLGLLGLNLSSTLNYKEFLHLFQKPQSPVYPPWLQSSHSPKQSMGGEDLACEQAHYYLVTKAQGRWHDMAKTFCEIDSEGNGIVQKKDLRNVLFRFYLPIHPKEFEKLWGRDKFRDYYHDFSAAFAKIDRNKDGQISVHDLRAMLQSLNFHLDDEQFANLLYRLRIKVTDNKLSYPDFLRMIDDGR---ASKYGQRQRPVSAAETPPKLSLQKVLLKLKEAVVSSHDALYKAFSSFDRDGTGTIKASELHQILDSFCFKLSDRQFGYLLSKLPLGEEQTIDWKAFLHHFSTSHPEPSSSWVERVQHATRPRSTQGLTMKDIL-NHIREVVTARFYTVAQDFISLDYANINAVSKEDFRELFNKDFMLLTDEQFENLWNTLPLNP----YGNLKYHEFLSQFGGGDALVSPYEKTAGDQSEFIYKPASA---------LAGNHTPPESQAGIRRPKTAPAILNKPKTDTQRPKTAGASSRLVNCEQIEARLRGSLQKVWQEVLRACRDYDPERTGEITTNDFSGVLKQFNAETNEEELERLTVKYDSRNNGKFSYADFFRNIML------GPKPLEKSPLHRMKVQKTR-VPISTGPDGPCFLNAMMRIQPKVLDCWRPMRRAFLSFDEARTGFISVQEFKQVLRKSGLNLSEDEFFHILGFFDKDLKAKVSYNDFL 1451          

HSP 6 Score: 77.0258 bits (188), Expect = 2.717e-13
Identity = 48/202 (23.76%), Postives = 93/202 (46.04%), Query Frame = 3
Query: 4182 ESIRKNLERLLNRNWQSIFNKCKAIDQAINECQTAEGSIPIDDFVYILSEYDDSLSAENLAAINL-YKTCKNGRFIKYGDLIRSIVLSSRGSLISNENVTEVQKKFLNVGIKTTNSDNSKDYFPQLFKLRRQILENWKDLRKNFLQSDKKQNGAVSGNIFMTIMKTVCGQLSADLFYHLMKIYDQDGTGNFHYKRFIEDFLK 4784
            E I   L   L + WQ +   C+  D          G I  +DF  +L +++   + E L  + + Y +  NG+F  Y D  R+I+L  +    S  +  +VQK      +  +   +   +   + +++ ++L+ W+ +R+ FL  D+ + G +S   F  +++     LS D F+H++  +D+D      Y  F+  FL+
Sbjct: 1266 EQIEARLRGSLQKVWQEVLRACRDYDPE------RTGEITTNDFSGVLKQFNAETNEEELERLTVKYDSRNNGKF-SYADFFRNIMLGPKPLEKSPLHRMKVQK----TRVPISTGPDGPCFLNAMMRIQPKVLDCWRPMRRAFLSFDEARTGFISVQEFKQVLRKSGLNLSEDEFFHILGFFDKDLKAKVSYNDFLRAFLR 1456          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Mouse
Match: Efcab6 (EF-hand calcium binding domain 6 [Source:MGI Symbol;Acc:MGI:1924877])

HSP 1 Score: 193.741 bits (491), Expect = 5.099e-49
Identity = 222/1143 (19.42%), Postives = 480/1143 (41.99%), Query Frame = 3
Query:  678 LQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETINIDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHKWLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQN----RLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQ---NFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVD--GHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTHLHVEHLFEMVKRH-LRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQEKTVGSIRINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGF----NQKLNNLDIQXXXXXXXXXXXXXTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLKKNEFDNVNYGEFV 4064
            L  +I RN   I K F++ D N+   +Q   L++V+E FC  + +  ++K + +++  +   V+Y  F+K + +  D        N+ E      +   G R+ +    E+ +  +  L+ L   F ++    +  + K     DP+  G+++L  L  +L+ F + +   +F Q++ +   K + KI W  FL    + Q   ++  T+ +K            ++   +++++ L  +  + Y++ +   L I+ T  G I   E   ILN     ++  + S + +  DP   G +  +  L + +  ++    K   S     + +  L ++ ++++  + D+I              DL  TG I   + +K+ +    YL ++ + R  +    +   GRI Y +    + V   P      S ++  S+  Q++E  +       S EK  E  +N M+ EE+I  +K RI Q     R  +  + K+ +       IN+ + RK+L + G  + + Q++ ++  L F   ++  + +  F   F D       +++ +  +P  +   +    D++  ++ +E   +  +K+  +F D+  AF + D    G +   DF     +L  N++ +E ++F  L   LG+     L + +F N  + R    D    + +  K +  D       +++ E  +  L  K    + ++S  FI     G G +R R++++ L    I ++  E +KLW+ YDT  R  + Y +FL+ LG+             +  +   +     + +   TK +Q             ++ L ++ +R  L   Y + + AF A+   K ++    +  + K+L +    +  ++ + L   +     ++ +   +F    + S     + K        ++  +P  I       +   ++   + + +      + + F  +D E++G+V   EF ++L   C  LTD Q++ +   L  ++  +      I ++YF++ F    ++  ++       A P  +     ++ I   + +++       +  F++ D    N +S+ +FR I  R +  + D  F++ WS L  N    + Y +F+
Sbjct:  191 LTEKIFRNMRSIRKVFQVMDVNNTGLVQPQELRRVLETFCLRMQDGDYEKFLEQYNIDKTTAVDYNAFLKNLSVKNDASFKYLLSNAAELSRETQQGKNGKRLLDTGSSED-VWKNYSLDDLEKTFCQEFSKSYEKIEKALSAGDPSKGGYISLNYLKVVLDTFIYRLPRRIFIQLIRRFGLKTSTKINWKQFLTAIYERQKLEVS-KTLPLKKRSSTE----ARNRSRKENIIKKLFKYSEDRYTALKKTLLIISSTPSGHITWEELRHILNCMVAKLNDSEFSELKQTFDPEGTGAVRVNSLLDVLD--DSTKVRKMSPS----TDTKTPLPVAWDSVEELVLDSITRNLQAFYSMLQSYDLRDTGTIGKNNFRKVMRVFCPYLSNEHLVRFSSKFQ-EAGSGRILYKKFLLSIGVGIPPPTPPLSSPKVQLSDQFQIEEPGQQDERTQPSGEKTSE--INNMTKEEVIDGLKHRIQQKDPVFRKQFLSISKEPDVK-----INQEEFRKVLERSGMPMNDCQYAMLASKLGF--KNEEGMSYQDFTMGFEDC------MLSGLETVPLQSRTASRTNMDEH-FISAEECLRIFPKKLKESFRDVYSAFFRIDLDRDGIISMHDFHRLLQYLQLNMVDLEFERFLSL---LGLRLSVTLNFREFQNLCEKRPWKSDEAPQRLIRCKQKVADS------ELACEQAHQYLIMKAKTRWADLSKNFIETDNEGNGILRRRDIKNSLYGFDIPLTPREFEKLWQNYDTEGRGYITYQEFLHRLGIR-----------YSPKVHRPYKEDYFNFLGHFTKPKQ---------VQEEIQELQQISEREKLMNHYEEISKAFNAMEKSKPVA----LCRVQKVLQECGCPLKEEELISLLKSLDVSVHNNHIDPVEFLRALEISWASKARPK-------EKEESSPPPISF---SKVTPDEVIKTMQEVVESSQPALVEAFSALDKEDTGFVKAMEFGDVLRSVCQKLTDNQYHYFLRRLRLHLTPN------IHWKYFLENFSTFQDETADDWAENMPKAPPPMSPKETAHRDIVARVQKAVASHYHTIVQEFENFDTLKSNTVSRDEFRSICTRHIQILTDEQFDRLWSELPVNAKGRLKYQDFL 1255          

HSP 2 Score: 115.161 bits (287), Expect = 5.069e-25
Identity = 166/788 (21.07%), Postives = 302/788 (38.32%), Query Frame = 3
Query:  663 DIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPID-NQGTIQTKNSEETINIDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQ---DPQSKHLNGSTIAIKSDHKCNPIQGVNSKP--------------NIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHKWLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKME-SIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNR------------NMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKL 2933
            DI  IL  +IS   + I K F++ D N +  + +  LK+V+  F  PLT+ QF  L+A+   S  GNV Y+EF+   G  ID N   I+  N  E   +D R T    + E  L E              IFR         +RK F VMD N  G V  + L ++L  F   M    + + +++     T  + + +FL+      D   K+L  +   +  + +    QG N K               ++DDL +      S +Y     A    + +  G I  +    +L+ F + +       +++         I++  FL    +++ L   K L    +     ++       IK     +  ++++ +     ++    +G+I+ E+L+ I   +   L D +   L       +  G +    L ++L+  T                           + KM  S +      +   S EEL++   D I +N   ++ + + Y+  D  G I K+  RK++  F   L+NE   + S    F  +   RI +  FL             ++           + +    D R            NM  +EV D L+ +I    P     F    +     + + +F+  L  + + + + Q+ +L  KLG   +  ++Y DF   F+  D M+ G + +  + R    +      +SAE+   + P+K+ + F ++   F  +     G I   +   LL  LQ++M   E ++ 
Sbjct:   85 DIERILAQKISSRRDDIKKVFQILDRNHNQMVTKGDLKRVITAFLIPLTKDQFQDLLAQIPISSLGNVPYLEFLSRFGGGIDININGIKRVNENE---VDNRRT----VKEVQLTEK-------------IFR-----NMRSIRKVFQVMDVNNTGLVQPQELRRVLETFCLRMQDGDYEKFLEQYNIDKTTAVDYNAFLKNLSVKNDASFKYLLSNAAELSRETQ----QGKNGKRLLDTGSSEDVWKNYSLDDLEKTFCQEFSKSYEKIEKALSAGDPSKGGYISLNYLKVVLDTFIYRLPRRIFIQLIRRFGLKTSTKINWKQFLTAIYERQKLEVSKTLPLKKRSSTEARNRSRKENIIKKLFKYS-EDRYTALKKTLLIISSTPSGHITWEELRHILNCMVAKLNDSEFSELKQTFD-PEGTGAVRVNSLLDVLDDSTK--------------------------VRKMSPSTDTKTPLPVAWDSVEELVL---DSITRNLQAFYSMLQSYDLRD-TGTIGKNNFRKVMRVFCPYLSNEHLVRFSS--KFQEAGSGRILYKKFLLSIGVGIPPPTPPLSSPKVQLSDQFQIEEPGQQDERTQPSGEKTSEINNMTKEEVIDGLKHRIQQKDPVFRKQFLSISKEPDVKINQEEFRKVLERSGMPMNDCQYAMLASKLGFKNEEGMSYQDFTMGFE--DCMLSGLETVPLQSRTASRTNMDEHFISAEECLRIFPKKLKESFRDVYSAFFRIDLDRDGIISMHDFHRLLQYLQLNMVDLEFERF 807          

HSP 3 Score: 90.1225 bits (222), Expect = 2.467e-17
Identity = 188/1081 (17.39%), Postives = 410/1081 (37.93%), Query Frame = 3
Query:  690 ISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNS---EETINIDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQ---KENLSAHKWLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLK---------DKKGR--INYLELFNLLNVDTSP-------SDLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFL-------AIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQ-IRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLE----KFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTHLH------------VEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQEKTVGSIRINQDLENPSKIGIEEAGNLNSTQIASI--IGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQF----NKYRNSLSTYIVKSANTDDKIDYRYFMKGFNQ 3770
            I+RN        + +D      I ++  +KVM  FC  L+ +   +  ++F ++ +G + Y +F+  +G+ I       +       +   I+    +  R  + +  +   + +   E+++   + +I+ +  V RK FL +    +  +  E   K+L +   PM+   +  +  K  FK    + +  F   F+D     L    +  ++  + N  +   S    ++ L +    +  ++     AF +I+    G I   +F ++L   Q  +   +    L  L       +++  F  L E+   K + +  + +    KV     D +L+ E     +      +W+++   F   D    G +   D+K     L+G+    DI     PLT +         D +GR  I Y E  + L +  SP        D         +    Q         E+++ ++++ E R  LM+                 +Y E+ K +   +K   +   +++K+L + G  L  E+   + + L+    + + ID   FL       A  A  +E        + F                  +   EV   +++ + ++ P L+ AF   D+ + G++   +F + L      + ++Q+     +L +     + +  FL  F   +D+  D   W ++  +   P   +  + +  D+   + + +  ++H I   F    T  +  +     + + +R    ++  +  +LW     N + +L Y DFL  L +          GD     + + Q   +A       +   +    D++  L +  H             E +   +++ ++  + +     K     K   G  +  +   L+ +  + ++ ++  QL  +   +  +   +Y    C F  S  +  + K    +R    ++N  K  ++EAG    +  +++  I  +IV  +  + ++F   D   +G +S+ +FR +L  + ++L++++F      Y  SLS+          KI Y  F++ F Q
Sbjct:  526 ITRNLQAFYSMLQSYDLRDTGTIGKNNFRKVMRVFCPYLSNEHLVRFSSKFQEAGSGRILYKKFLLSIGVGIPPPTPPLSSPKVQLSDQFQIEEPGQQDERT-QPSGEKTSEINNMTKEEVIDGLKHRIQQKDPVFRKQFLSISKEPDVKINQEEFRKVLERSGMPMNDCQYAMLASKLGFKNEEGMSYQDFTMGFEDCMLSGLETVPLQSRTASRTNMDEHFIS---AEECLRIFPKKLKESFRDVYSAFFRIDLDRDGIISMHDFHRLLQYLQLNMVDLEFERFLSLLGLRLSVTLNFREFQNLCEKRPWKSDEAPQRLIRCKQKVA----DSELACEQAHQYLIMKAKTRWADLSKNFIETDNEGNGILRRRDIK---NSLYGF----DI-----PLTPREFEKLWQNYDTEGRGYITYQEFLHRLGIRYSPKVHRPYKEDYFNFLGHFTKPKQVQ---------EEIQELQQISE-REKLMN-----------------HYEEISKAFNAMEKSKPVALCRVQKVLQECGCPLKEEELISLLKSLDVSVHN-NHIDPVEFLRALEISWASKARPKEKEESSPPPISF----------------SKVTPDEVIKTMQEVVESSQPALVEAFSALDKEDTGFVKAMEFGDVLRSVCQKLTDNQYHYFLRRLRLHLTPNIHWKYFLENFSTFQDETADD--WAENMPK--APPPMSPKETAHRDIVARVQKAVASHYHTIVQEFENFDTLKSNTVSRDEFRSICTRHIQILTDEQFDRLWSELPVNAKGRLKYQDFLSKLSIERVPSPPMAAGD--SGESTMAQRGSSAPEFSQGTRSNLYSPPRDSRVGLKSRSHPCTPVGTPPLQNCEPIESRLRKQIQGCWRELLRECKEKDTDK--QGTISAAEFLALVEKFKLDISREESQQLIVKYDLKN-NGKFAY----CDFIQSCVLLLKAKETSLMR-RMRIQNADK--MKEAGMETPSFYSALLRIQPKIVHCWRPMRRSFKTYDKNGTGLLSVADFRKVLRQYSINLSEEEFFHVLEYYDKSLSS----------KISYNDFLRAFLQ 1516          

HSP 4 Score: 85.8853 bits (211), Expect = 4.035e-16
Identity = 106/554 (19.13%), Postives = 231/554 (41.70%), Query Frame = 3
Query: 2436 EVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDM-VDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNA-----LVDHLVNQETKHQQSVDNQAVLGTHLHVEHLF--EMVKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQEKTVGSIRINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSL---STYIVKSANTDDKIDYRYFMKGFNQKLNNLDIQXXXXXXXXXXXXXTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLKKNEFDNVNYGEFV 4064
            ++E +L QKI +   D+   F   DR++   + K D +  +   LI +  DQF  L  ++ +     + Y +FL+RF    D+ ++G K ++     N  +   V           L EKI++    I   F  +  + TG ++ + L+ +L    + M   + +K  ++Y+ +    +DY+ FL NL +        L+  +A + + +        L+D   +++     S+D+         +E  F  E  K + ++   + AL+    A   +  G+ ++N L  +L      +    F+QL  R G +     +++++F     +   ++          +++ L    +   E         I   + K   D+Y+ ++KT L++    SG+++  E R++L      L D +F++ + +     T  V+  +  D +D    ++  +   +                 + +  ++E + +SI    + F +  +S D      I K++FR+++  F   + + H  +F S  ++     + Y +F+
Sbjct:   85 DIERILAQKISSRRDDIKKVFQILDRNHNQMVTKGDLKRVITAFLIPLTKDQFQDLLAQIPISSLGNVPYLEFLSRFGGGIDININGIKRVNENEVDNRRTVKEVQ----------LTEKIFRNMRSIRKVFQVMDVNNTGLVQPQELRRVLETFCLRMQDGDYEKFLEQYNIDKTTAVDYNAFLKNLSVKNDASFKYLLSNAAELSRETQQGKNGKRLLDTGSSEDVWKNYSLDD---------LEKTFCQEFSKSYEKI---EKALS----AGDPSKGGYISLNYLKVVLDTFIYRLPRRIFIQLIRRFGLKT-STKINWKQFLTAIYERQKLE----------VSKTLPLKKRSSTEARNRSRKENIIKKLFKYSEDRYTALKKTLLIISSTPSGHITWEELRHILNCMVAKLNDSEFSELKQTFDPEGTGAVRVNSLLDVLDDSTKVRKMSPSTDT-----------KTPLPVAWDSVEELVLDSITRNLQAFYSMLQSYDLRDTGTIGKNNFRKVMRVFCPYLSNEHLVRFSSKFQEAGSGRILYKKFL 590          

HSP 5 Score: 83.5741 bits (205), Expect = 1.956e-15
Identity = 110/460 (23.91%), Postives = 192/460 (41.74%), Query Frame = 3
Query:  225 QLLKNHKEILKALQTFDIECSGLVTKGELRRVLDSYCLPMTTDQYEQFLSHNSINYSKGSINYKELIDKIYDKTSAVGH--FKKNIKLPQLQRSATTICLQNKHFTLPTTRRSSGKISRSQLFXXXXXXXXXXXXXXXXWNYNAYTIDDIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETINIDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDP-QSKHLNGSTIAIKSDHKCN-PIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFL 1592
            ++ +N + I K  Q  D+  +GLV   ELRRVL+++CL M    YE+FL   +I                 DKT+AV +  F KN+ +     ++    L N           + ++SR     +   R L++  S   W    Y++DD+      + S++   I KA    D +    I  + LK V++ F   L  + F +L+ RF    +  +N+ +F+  +          Q     +T+ +  R++  +R        N     N +++L     K  ED+++ L+KT L++     G +T E L  ILN     ++ + F+++      + TG +   S L    D  + + ++ ST     D K   P+         D + EL+ + I+ N  +F       +    G I K+ F K++  F  Y+S + L            G I Y  FL
Sbjct:  194 KIFRNMRSIRKVFQVMDVNNTGLVQPQELRRVLETFCLRMQDGDYEKFLEQYNI-----------------DKTTAVDYNAFLKNLSVK--NDASFKYLLSN-----------AAELSRETQQGKNGKRLLDTGSSEDVW--KNYSLDDLEKTFCQEFSKSYEKIEKALSAGDPSKGGYISLNYLKVVLDTFIYRLPRRIFIQLIRRFGLKTSTKINWKQFLTAI-------YERQKLEVSKTLPLKKRSSTEAR--------NRSRKENIIKKLF----KYSEDRYTALKKTLLIISSTPSGHITWEELRHILNCMVAKLNDSEFSELKQTFDPEGTGAVRVNSLLDVLDDSTKVRKMSPST-----DTKTPLPVAW-------DSVEELVLDSITRNLQAFYSMLQSYDLRDTGTIGKNNFRKVMRVFCPYLSNEHLVRFSSKFQEAGSGRILYKKFL 590          

HSP 6 Score: 75.485 bits (184), Expect = 5.976e-13
Identity = 180/1085 (16.59%), Postives = 412/1085 (37.97%), Query Frame = 3
Query:  204 INPIVKSQLLKNHKEILKALQTFDIECSGLVTKGELRRVLDSYCLPMTTDQYEQFLSHNSINYSKGSINYKELIDKIYDKTSAVGHFKKNIKLPQLQRSATTICLQNKHFTLPTTRRSSGKISRSQLFXXXXXXXXXXXXXXXXWNYNAYTIDDIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETINIDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHK-----WLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFAD-NRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQI--------------------------------RDDMV----DGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQL 3332
            +  +V   + +N +     LQ++D+  +G + K   R+V+  +C P  ++++    S        G I YK+ +  I            + K+    +       Q    T P+  ++S                            N  T +++I  L+ +I +      K F       D  I +   +KV+E    P+ + Q+  L ++        ++Y +F  G    +         +  ET+ + +R    + + E  +           E+ L IF KK+++ F  +   F  +D + +G +++   +++L      M    F + +     + +   + L+F ++FQ+   K    S  A +   +C   +  +S+   +   + L       ++     F++ +    G + + +    L  F   ++  +   + +  D    GYI+Y  FL     + +   H+     + N      +P++  +   E  + +  + + N +  +   FN ++  ++  +++  ++K+ ++    LK++++  L+  L +      I+ +E    L              +I+ ++ A+ KE+ E+    +           + ++P+E+I  +++ +  ++    E +   +  D  G +   +   +L      LT+ Q+      L    +    I +  FL  F+    E+++D   +   +PK+   ++       +    +++   +++ + +++  ++  F  FD      + + +F++    ++ ++ ++QFD L  +L V  K +L Y DFL++  I                                R ++     D    L S+     P     P  + E +   L ++I   + E+        T   G I       L+ + ++ +S+ E ++L  +YD  N  K  Y DF+ +  LL K     LM      IQN+          +E   +      A+L     + H +  ++R           +FK     K  +G  ++ D  K+L Q  + ++ ++F  +
Sbjct:  518 VEELVLDSITRNLQAFYSMLQSYDLRDTGTIGKNNFRKVMRVFC-PYLSNEHLVRFSSKFQEAGSGRILYKKFLLSIGVGIPPPTPPLSSPKVQLSDQFQIEEPGQQDERTQPSGEKTS--------------------------EINNMTKEEVIDGLKHRIQQKDPVFRKQFLSISKEPDVKINQEEFRKVLERSGMPMNDCQYAMLASKLGFKNEEGMSYQDFTMGFEDCM--------LSGLETVPLQSRTASRTNMDEHFI---------SAEECLRIFPKKLKESFRDVYSAFFRIDLDRDGIISMHDFHRLLQYLQLNMVDLEFERFLSLLGLRLS---VTLNF-REFQNLCEKRPWKSDEAPQRLIRCKQ-KVADSELACEQAHQYLIMKAKTRWADLSKNFIETDNEGNGILRRRDIKNSLYGFDIPLTPREFEKLWQNYDTEGRGYITYQEFLHRLGIRYSPKVHRPYKEDYFNFLGHFTKPKQVQEEIQELQQISEREKLMNHYEEISKAFNAME--KSKPVALCRVQKVLQECGCPLKEEELISLLKSLDVSVHNNHIDPVEFLRAL--------------EISWASKARPKEKEESSPPPIS---------FSKVTPDEVIKTMQEVVESSQPALVEAFSALDKEDT-GFVKAMEFGDVLRSVCQKLTDNQYHYFLRRLRLHLTPN--IHWKYFLENFSTFQDETADDWAEN---MPKAPPPMSP------KETAHRDIVARVQKAVASHYHTIVQEFENFDTLKSNTVSRDEFRSICTRHIQILTDEQFDRLWSELPVNAKGRLKYQDFLSKLSIERVPSPPMAAGDSGESTMAQRGSSAPEFSQGTRSNLYSPPRDSRVGLKSRSHPCTP-VGTPPLQNCEPIESRLRKQIQGCWRELLRECKEKDTDKQGTISAAEFLALVEKFKLDISREESQQLIVKYDLKNNGKFAYCDFIQSCVLLLKAKETSLM--RRMRIQNADKM-------KEAGMETPSFYSALLRIQPKIVHCWRPMRR-----------SFKTY--DKNGTGLLSVADFRKVLRQYSINLSEEEFFHV 1493          

HSP 7 Score: 65.855 bits (159), Expect = 6.087e-10
Identity = 49/213 (23.00%), Postives = 97/213 (45.54%), Query Frame = 3
Query: 4155 IETDEMDTDESIRKNLERLLNRNWQSIFNKCKAIDQAINECQTAEGSIPIDDFVYILSEYDDSLS-AENLAAINLYKTCKNGRFIKYGDLIRSIVLSSRGSLISNENVTEVQK--KFLNVGIKTTNSDNSKDYFPQLFKLRRQILENWKDLRKNFLQSDKKQNGAVSGNIFMTIMKTVCGQLSADLFYHLMKIYDQDGTGNFHYKRFIEDFLK 4784
            + T  +   E I   L + +   W+ +  +CK  D         +G+I   +F+ ++ ++   +S  E+   I  Y    NG+F  Y D I+S VL  +    S      +Q   K    G++T +      ++  L +++ +I+  W+ +R++F   DK   G +S   F  +++     LS + F+H+++ YD+  +    Y  F+  FL+
Sbjct: 1317 VGTPPLQNCEPIESRLRKQIQGCWRELLRECKEKDT------DKQGTISAAEFLALVEKFKLDISREESQQLIVKYDLKNNGKFA-YCDFIQSCVLLLKAKETSLMRRMRIQNADKMKEAGMETPS------FYSALLRIQPKIVHCWRPMRRSFKTYDKNGTGLLSVADFRKVLRQYSINLSEEEFFHVLEYYDKSLSSKISYNDFLRAFLQ 1516          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. UniProt/SwissProt
Match: sp|Q5THR3|EFCB6_HUMAN (EF-hand calcium-binding domain-containing protein 6 OS=Homo sapiens OX=9606 GN=EFCAB6 PE=1 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 4.324e-56
Identity = 255/1152 (22.14%), Postives = 481/1152 (41.75%), Query Frame = 3
Query:  687 QISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETI-NIDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSK--PNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHKWLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKD-KKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMS----------PEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFN-GFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTN-AVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVN---QETKHQQSVDNQAVL--GTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQEK-TVGSIRINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGFN----QKLNNLDIQXXXXXXXXXXXXXTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLKKNEFDNVNYGEFV 4064
            ++ +N   +MKAF+L D N    ++   L++V+E FC  L +++++K    ++  ++  V+Y  F+K + I  D        N E ++ N   +N+K  R+  +A  E+ +  +  L+++   F  ++   +  + K     DP   G+V+   L  +L+ F + +   +F Q+M +   KAT KI W  FL  F +PQ   ++      K +        +NS+   + ++++  L  H  ++ +S + A L IN    G I + EF  ILN     +S  +   +++ LDP + G ++   F+ L E  EN    K         + +    L+ ++++  + D I        +     DL  TG I   + KKI      +L +    +L +   ++D   GRI Y +L   + +D  P+      + +    D  L E    H++K E  +     R  L             EE+I + K  I Q    + + +  +   +  G IN    +K+L   G  + ++Q++ ++  + F     S +DF  GF     ++        T       S  +VN      +  +  +E   L  +++  +F D   AF K D    G +   D    LL  L+ +++D+F+     LG+     L + +F N  + R    D     ++  R   P    A  +++ E  +  L  K    + ++S  F+     G G +R R++++ L    I ++  E +KLW RYDT  +  + Y +FL  LG+            S A+    H    +   N     TK QQ  +    L   T   V    +++ RH      D + AF      KT   + +I  + ++L +    +T  +   L    G    D++++Y  F    ++S +   Q K    S+ IN    NP +   +    + S+Q+A             +   F  +D E++G+V   EF  +L  FC  LTD Q++ +   L  ++         I+++YF++ F+    +  +    +     P  +      + I   +++++          F++ D    N IS+ +FR I  R +  + D  F++ W+ +  N    + Y +F+
Sbjct:  169 KVFKNIKTVMKAFELIDVNKTGLVRPQELRRVLETFCMKLRDEEYEKFSKHYNIHKDTAVDYNVFLKNLSINNDLNLRYCMGNQEVSLENQQAKNSKKERLLGSASSED-IWRNYSLDEIERNFCLQLSKSYEKVEKALSAGDPCKGGYVSFNYLKIVLDTFVYQIPRRIFIQLMKRFGLKATTKINWKQFLTSFHEPQGLQVSSKGPLTKRN-------SINSRNESHKENIITKLFRHTEDHSASLKKALLIINTKPDGPITREEFRYILNCMAVKLSDSEFKELMQMLDPGDTGVVNTSMFIDLIE--ENCRMRK----TSPCTDAKTPFLLAWDSVEEIVHDTITRNLQAFYNMLRSYDLGDTGRIGRNNFKKIMHVFCPFLTNAHFIKLCS--KIQDIGSGRILYKKLLACIGIDGPPT-----VSPVLVPKDQLLSE----HLQKDEQQQPDLSERTKLTEDKTTLTKKMTTEEVIEKFKKCIQQQDPAFKKRFLDFS-KEPNGKINVHDFKKVLEDTGMPMDDDQYALLTTKIGFEKEGMSYLDFAAGF-----EDPPMRGPETTPPQPPTPSKSYVN------SHFITAEECLKLFPRRLKESFRDPYSAFFKTDADRDGIINMHDLHRLLLHLLLNLKDDEFERFLGLLGLRLSVTLNFREFQNLCEKRPWRTD-----EAPQRLIRPKQKVADSELACEQAHQYLVTKAKNRWSDLSKNFLETDNEGNGILRRRDIKNALYGFDIPLTPREFEKLWARYDTEGKGHITYQEFLQKLGI----------NYSPAV----HRPCAEDYFNFMGHFTKPQQLQEEMKELQQSTEKAVAARDKLMDRH-----QDISKAFTKTDQSKT--NYISICKMQEVLEECGCSLTEGELTHLLNSWGVSRHDNAINYLDFLRAVENSKSTGAQPKEKEESMPINFATLNPQEAVRKIQEVVESSQLA-------------LSTAFSALDKEDTGFVKATEFGQVLKDFCYKLTDNQYHYFLRKLRIHLTPY------INWKYFLQNFSCFLEETADEWAEKMPKGPPPTSPKATADRDILARLHKAVTSHYHAITQEFENFDTMKTNTISREEFRAICNRRVQILTDEQFDRLWNEMPVNAKGRLKYPDFL 1238          

HSP 2 Score: 83.9593 bits (206), Expect = 1.233e-14
Identity = 126/678 (18.58%), Postives = 265/678 (39.09%), Query Frame = 3
Query: 1380 ELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHKWLNSNH-----------KVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIR--------------------DDMVDGHKWLDS-------------KHRFNDPSTNAVPDMS----AEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTIN 3269
            + L     N +S     FL+ +    G + + +    L  F   ++  +   +    D   +G+I+Y  FLQ      + + H+    ++           ++ E  K+LQ S+E   +   D + ++  ++   F   D ++T YIS+  ++++ ++    L + ++  L+    +      INYL+                 + + ++S  AQ KE+ E+          +  A LN   P+E + +I++ +  ++L     +   +  D  G +  ++  ++L  F Y LT+ Q+      L    +    I++  FL  F+   E + D   +   +PK     +     D      +++   L + + +++  +   F  FD      + + +F+      + ++ ++QFD L  ++ V  K +L Y DFL+RF                        D+ +G +   S              H     ST  +P        + +   L ++I   + ++         +  G I   +   L+ +  + +SK E ++L  +YD  +  K  Y DF+ +  LL K     LM      IQN+H         +E   +      A+L     + H +  ++R  + +Y ++     +VA+ +T+   ++IN
Sbjct:  839 QYLVTKAKNRWSDLSKNFLETDNEGNGILRRRDIKNALYGFDIPLTPREFEKLWARYDTEGKGHITYQEFLQKLGINYSPAVHRPCAEDYFNFMGHFTKPQQLQEEMKELQQSTEKAVAA-RDKLMDRHQDISKAFTKTDQSKTNYISICKMQEVLEECGCSLTEGELTHLLNSWGVSRHDNAINYLDFLR--------------AVENSKSTGAQPKEKEESM--------PINFATLN---PQEAVRKIQEVVESSQLALSTAFSALDKEDT-GFVKATEFGQVLKDFCYKLTDNQYHYFLRKLRIHLTP--YINWKYFLQNFSCFLEETADEWAEK--MPKGPPPTSPKATAD------RDILARLHKAVTSHYHAITQEFENFDTMKTNTISREEFRAICNRRVQILTDEQFDRLWNEMPVNAKGRLKYPDFLSRFSSETAATPMATGDSAVAQRGSSVPDVSEGTRSALSLPTQELRPGSKSQSHPCTPASTTVIPGTPPLQNCDPIESRLRKRIQGCWRQLLKECKEKDVARQGDINASDFLALVEKFNLDISKEECQQLIIKYDLKSNGKFAYCDFIQSCVLLLKAKESSLM--HRMKIQNAHKM-------KEAGAETPSFYSALLRIQPKIVHCWRPMRRTFK-SYDEAGTGLLSVADFRTVLRQYSIN 1469          

HSP 3 Score: 76.2554 bits (186), Expect = 2.599e-12
Identity = 99/475 (20.84%), Postives = 196/475 (41.26%), Query Frame = 3
Query:  195 ISEINPIVKSQLLKNHKEILKALQTFDIECSGLVTKGELRRVLDSYCLPMTTDQYEQFLSHNSINYSKGSINYKELIDKIYDKTSAVGH--FKKNIKLPQLQRSATTICLQNKHFTLPTTRRSSGKISRSQLFXXXXXXXXXXXXXXXXWNYNAYTIDDIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGM----GIPIDNQGTIQTKNSEETINIDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNI---DDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFL 1592
            + E+   V  ++ KN K ++KA +  D+  +GLV   ELRRVL+++C+ +  ++YE+F  H +I+                 K +AV +  F KN+ +          C+ N+  +L   +  + K  R           L S  S   W    Y++D+I     +Q+S++   + KA    D      +  + LK V++ F   +  + F +L+ RF       +N+ +F+       G+ + ++G +  +NS     I++RN                   +  E ++    +  ED  + L+K  L+++   +G +T E    ILN  A  +S + F ++M       TG +    F+   ++            ++    C   +     P +   D + E++ + I+ N  +F +     +    G+I ++ F KI++ F  +++      +   +     G I Y   L
Sbjct:  159 LRELEIQVGEKVFKNIKTVMKAFELIDVNKTGLVRPQELRRVLETFCMKLRDEEYEKFSKHYNIH-----------------KDTAVDYNVFLKNLSIN--NDLNLRYCMGNQEVSLENQQAKNSKKER----------LLGSASSEDIW--RNYSLDEIERNFCLQLSKSYEKVEKALSAGDPCKGGYVSFNYLKIVLDTFVYQIPRRIFIQLMKRFGLKATTKINWKQFLTSFHEPQGLQVSSKGPLTKRNS-----INSRN------------------ESHKENIITKLFRHTEDHSASLKKALLIINTKPDGPITREEFRYILNCMAVKLSDSEFKELMQMLDPGDTGVVNTSMFIDLIEE---------NCRMRKTSPCTDAK----TPFLLAWDSVEEIVHDTITRNLQAFYNMLRSYDLGDTGRIGRNNFKKIMHVFCPFLTNAHFIKLCSKIQDIGSGRILYKKLL 566          

HSP 4 Score: 73.9442 bits (180), Expect = 1.313e-11
Identity = 103/552 (18.66%), Postives = 228/552 (41.30%), Query Frame = 3
Query: 2415 NRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTH----LHVEHLFEMVKRH--LRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQEKTVGSIRINQDLENPSKIGIEEAGNLNS------TQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSL---STYIVKSANTDDKIDYRYFMKGFNQKLNNLDIQXXXXXXXXXXXXXTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLK 4025
            N  ++  +V+ +L QKI +   +L  AF   D      + KS+ +  +   L+ +  +QF  +  ++ +     + Y  FL+RF   D  ++G K      R      N     +  ++ + + EK+++    +   F  +  + TG +R + L+ +L    + +   E +K  K Y+ +    +DY+ FL NL +         MG              +  V+ E +  ++   + +LG+     +   +  + ++R+  L+++ S   +     A      G+ + N L  +L      +    F+QL  R G +     +++++F   F +                 Q L+  SK  + +  ++NS        I + + +   D  + ++K  L+++ +  G ++  EFR +L    + L+D +F +    L    T +V ++   D I+    M+           ++     A     + +  ++E ++++I    + F N  +S D      I +++F++I+  F   + ++HF K  S ++
Sbjct:   52 NPTLSSLDVKRILFQKITDRGDELQKAFQLLDTGQNLTVSKSELRRIITDFLMPLTREQFQDVLAQIPLSTSGTVPYLAFLSRFGGIDLYINGIK------RGGGNEMNCC--RTLRELEIQVGEKVFKNIKTVMKAFELIDVNKTGLVRPQELRRVLETFCMKLRDEEYEKFSKHYNIHKDTAVDYNVFLKNLSINNDLNLRYCMG--------------NQEVSLENQQAKNSKKERLLGSASSEDIWRNYSLDEIERNFCLQLSKSYEKVEKALSAGDPCKGGYVSFNYLKIVLDTFVYQIPRRIFIQLMKRFGLKA-TTKINWKQFLTSFHEP----------------QGLQVSSKGPLTKRNSINSRNESHKENIITKLFRHTEDHSASLKKALLIINTKPDGPITREEFRYILNCMAVKLSDSEFKELMQMLDPGDTGVVNTSMFIDLIEENCRMR-----------KTSPCTDAKTPFLLAWDSVEEIVHDTITRNLQAFYNMLRSYDLGDTGRIGRNNFKKIMHVFCPFLTNAHFIKLCSKIQ 553          

HSP 5 Score: 68.1662 bits (165), Expect = 8.201e-10
Identity = 49/212 (23.11%), Postives = 97/212 (45.75%), Query Frame = 3
Query: 4161 TDEMDTDESIRKNLERLLNRNWQSIFNKCKAIDQAINECQTAEGSIPIDDFVYILSEYDDSLSAENLAAINL-YKTCKNGRFIKYGDLIRSIVL---SSRGSLISNENVTEVQKKFLNVGIKTTNSDNSKDYFPQLFKLRRQILENWKDLRKNFLQSDKKQNGAVSGNIFMTIMKTVCGQLSADLFYHLMKIYDQDGTGNFHYKRFIEDFLK 4784
            T  +   + I   L + +   W+ +  +CK  D A       +G I   DF+ ++ +++  +S E    + + Y    NG+F  Y D I+S VL   +   SL+    +    K     G +T +      ++  L +++ +I+  W+ +R+ F   D+   G +S   F T+++     LS + F+H+++ YD+  +    Y  F+  FL+
Sbjct: 1304 TPPLQNCDPIESRLRKRIQGCWRQLLKECKEKDVA------RQGDINASDFLALVEKFNLDISKEECQQLIIKYDLKSNGKFA-YCDFIQSCVLLLKAKESSLMHRMKIQNAHK-MKEAGAETPS------FYSALLRIQPKIVHCWRPMRRTFKSYDEAGTGLLSVADFRTVLRQYSINLSEEEFFHILEYYDKTLSSKISYNDFLRAFLQ 1501          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. UniProt/SwissProt
Match: sp|Q5RE62|EFCB6_PONAB (EF-hand calcium-binding domain-containing protein 6 OS=Pongo abelii OX=9601 GN=EFCAB6 PE=3 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 2.872e-49
Identity = 230/1042 (22.07%), Postives = 432/1042 (41.46%), Query Frame = 3
Query:  687 QISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETI-NIDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHKWLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKD-KKGRINYLELFNLLNVDTSPSDLEGL--STQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTN-AVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQN--SHNALVDHLVNQETKHQQSVDNQAVLGTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQEKTVGSIRINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGFNQKLNNLDI 3791
            ++ +N   +MKAFKL D N    ++   L++V+E FC  L +++++K    ++   +  V+Y  F+K + I  D        N E ++ N   RN+K  R+  +A  E+ +  +  L+ +   F  ++   +  + K     DP   G+V+   L  +L+ F + +   +F Q+M +   KAT KI W  FL  F +PQ   ++      K     N I    S+   ++++  L     +  +S + A L IN    G I + EF  ILN     +S  +   +++ LDP + G ++   F+ L E  EN    K         + +    L+ ++++  + D I        +     DL  TG I   + KKI      +L +    +L +   ++D   GRI Y +L   + +D  P+    L    Q+   +  + +++  +  E+ +  E        + + EE+I + +  I Q    + + +  +   +  G IN    RK+L   G  + ++Q++ ++  + F     S +DF    A F D      +          S  +VN      +  +  +E   L  +++  +F D   AF K D    G +   D    LL  L+ +++D+F+     LG+     L + +F N  + R    D     ++  R   P    A  +++ E  +  L  K    + ++S  F+     G G +R R++++ L    I ++  E +KLW RY+T  +  + Y +FL  LG+        +  P A    N   H      L  +  + QQS +                  +  L   + D + AF  +   KT   + +I  + K+L +    +T  +   L    G    +++++Y  F    ++S +   Q K           E    + I  A  LN  ++   I + +      +   F  +D E++G+V   EF  +L  FC  L D Q++ +   L  ++         I+++YF++ F+  L  + I
Sbjct:   17 KVFKNIKTVMKAFKLIDVNKTGLVRPQELRRVLETFCLKLRDEEYEKFSKHYNIHNDTAVDYNVFLKNLSINNDLNLRYCMGNQEVSLENQQARNSKKERLLGSASSED-IWRNYSLDDIERNFCLELSKSYEKIEKALSAGDPCKGGYVSFNYLKIVLDTFIYQIPRRIFIQLMKRFGLKATTKINWKQFLTSFHEPQGLQVSNKGPLTKR----NSINS-RSESRKENIITKLFRCTEDRSASLKKALLIINTKPDGPITREEFRYILNCVAIKLSDSEFKELMQILDPGDTGVVNTSMFIDLIE--ENCRMRK----TSPCTDAKTPFLLAWDSVEEIVHDTIARNLQAFYNMLRSYDLGDTGLIGRNNFKKIMHVFCPFLTNAHFIKLCS--KIQDIGSGRILYKKLLACIGIDGPPTVSPVLVPKDQLLSEHLQKDEQQQPDLSERTKPTEDKTTLTKKMTT-EEVIEKFRKYIQQQDPAFKKRFLDFS-KEPNGKINVHDFRKILEDTGMPMDDDQYALLTTKIGFEKEGMSYLDF---AAGFEDPPMRGLETTPPQ-PPTPSKSYVN------SHLITAEECLKLFPRRLKESFRDPYSAFFKTDVDRDGIINMHDLHRLLLHLLLNLKDDEFERFLGLLGLRLSVTLNFREFQNLCEKRPWRTD-----EAPQRLIRPKQKVADSELACEQAHQYLVTKAKNRWSDLSKNFLETDNEGNGILRRRDIKNALYGFDIPLTPREFEKLWARYNTEGKGHITYQEFLQKLGINYSPA---VHQPCAEDYFNFMGHFTKPQQLQEEMKELQQSTEKAMA-------------ARDKLMDLHQDISKAFTKIDKSKT--NYISICKMQKVLEECGCSLTEGELTHLLNSWGVSRHENAINYLDFLRAVENSKSTGAQPK-----------EKEESMPISFA-TLNPQEVVRKIQEVVESSQLALSTAFSALDKEDTGFVKATEFGQVLKDFCYKLMDNQYHYFLRKLRIHLTPY------INWKYFLQNFSCFLEEVRI 991          

HSP 2 Score: 78.9518 bits (193), Expect = 3.216e-13
Identity = 142/691 (20.55%), Postives = 271/691 (39.22%), Query Frame = 3
Query:  660 DDIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGI--PIDNQGTIQTKN---SEETINIDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSK-PNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHKWLN--SNHKVVEPRK---DLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGY---LKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEGLSTQIAE------SNDAQLKERHENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSK--SRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRF 2666
            D +  I+   I+RN        + +D      I R+  KK+M  FC  LT   F KL ++     +G + Y + +  +GI  P      +  K+   SE     + +    S   +    +  L      E+++  FRK I+ Q    +K FL       G + +    KIL     PM  + +  +  K  F+  G + +L F   F+DP  + L  +     +  K      VNS     ++ L+L    +  ++     AF + +    G I   +  ++L      +  D+    L  L       +++  F  L E++       W    +  +++ P++   D +L+ E     +     N+WS++   F   D    G +   D+K     L+G+   L   + ++L A     + KG I Y E    L ++ SP+    +    AE       +  + ++  E   E  +S EK   AR  LM   + I +   +I +++ NY               I+  +++K+L + G +LT     +++ +LN    S+  + I++  FL    +++ +           PK       I       +N QEV   +++ + ++   L  AF   D+ + G++  ++F   L      + ++Q+     KL +     + +  FL  F
Sbjct:  340 DSVEEIVHDTIARNLQAFYNMLRSYDLGDTGLIGRNNFKKIMHVFCPFLTNAHFIKLCSKIQDIGSGRILYKKLLACIGIDGPPTVSPVLVPKDQLLSEHLQKDEQQQPDLSERTKPTEDKTTLTKKMTTEEVIEKFRKYIQQQDPAFKKRFLDFSKEPNGKINVHDFRKILEDTGMPMDDDQYALLTTKIGFEKEG-MSYLDFAAGFEDPPMRGLETTPPQPPTPSK----SYVNSHLITAEECLKLFPRRLKESFRDPYSAFFKTDVDRDGIINMHDLHRLLLHLLLNLKDDEFERFLGLLGLRLSVTLNFREFQNLCEKR------PWRTDEAPQRLIRPKQKVADSELACEQAHQYLVTKAKNRWSDLSKNFLETDNEGNGILRRRDIK---NALYGFDIPLTPREFEKLWARYN-TEGKGHITYQEFLQKLGINYSPA----VHQPCAEDYFNFMGHFTKPQQLQEEMKELQQSTEKAMAARDKLMDLHQDISKAFTKIDKSKTNY---------------ISICKMQKVLEECGCSLTE---GELTHLLNSWGVSRHENAINYLDFLRAVENSKSTGAQ--------PKEKEESMPI---SFATLNPQEVVRKIQEVVESSQLALSTAFSALDKEDTGFVKATEFGQVLKDFCYKLMDNQYHYFLRKLRIHLTPYINWKYFLQNF 982          

HSP 3 Score: 76.2554 bits (186), Expect = 2.336e-12
Identity = 79/342 (23.10%), Postives = 154/342 (45.03%), Query Frame = 3
Query:  195 ISEINPIVKSQLLKNHKEILKALQTFDIECSGLVTKGELRRVLDSYCLPMTTDQYEQFLSHNSINYSKGSINYKELIDKIYDKTSAVGHFKKNIKLPQLQRSATTICLQNKHFTLPTTRRSSGKISRSQLFXXXXXXXXXXXXXXXXWNYNAYTIDDIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGM----GIPIDNQGTIQTKNSEETINIDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIM 1208
            + E+   V  ++ KN K ++KA +  D+  +GLV   ELRRVL+++CL +  ++YE+F  H +I ++  +++Y      ++ K  ++ +   N++           C+ N+  +L   +  + K  R           L S  S   W    Y++DDI     +++S++   I KA    D      +  + LK V++ F   +  + F +L+ RF       +N+ +F+       G+ + N+G +  +NS   IN  + + K                    E ++    +  ED+ + L+K  L+++   +G +T E    ILN  A  +S + F ++M
Sbjct:    7 LRELEIQVGEKVFKNIKTVMKAFKLIDVNKTGLVRPQELRRVLETFCLKLRDEEYEKFSKHYNI-HNDTAVDY-----NVFLKNLSINN-DLNLRY----------CMGNQEVSLENQQARNSKKER----------LLGSASSEDIW--RNYSLDDIERNFCLELSKSYEKIEKALSAGDPCKGGYVSFNYLKIVLDTFIYQIPRRIFIQLMKRFGLKATTKINWKQFLTSFHEPQGLQVSNKGPLTKRNS---INSRSESRK--------------------ENIITKLFRCTEDRSASLKKALLIINTKPDGPITREEFRYILNCVAIKLSDSEFKELM 296          

HSP 4 Score: 60.077 bits (144), Expect = 1.897e-7
Identity = 79/428 (18.46%), Postives = 176/428 (41.12%), Query Frame = 3
Query: 2787 EKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSH------NALVDHLVNQETKHQQSVDNQAVLGTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQEKTVGSIRINQDLENPSKIGIEEAGNLNSTQ------IASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSL---STYIVKSANTDDKIDYRYFMKGFNQKLNNLDIQXXXXXXXXXXXXXTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLK 4025
            EK+++    +   F  +  + TG +R + L+ +L    + +   E +K  K Y+ +N   +DY+ FL NL +         MG     ++N          L+    +++     S+D+       +      E+ K + ++   + AL+    A      G+ + N L  +L      +    F+QL  R G +     +++++F   F +                 Q L+  +K  + +  ++NS        I + + +   D+ + ++K  L+++ +  G ++  EFR +L    + L+D +F +    L    T +V ++   D I+    M+           ++     A     + +  ++E ++++I    + F N  +S D      I +++F++I+  F   + ++HF K  S ++
Sbjct:   16 EKVFKNIKTVMKAFKLIDVNKTGLVRPQELRRVLETFCLKLRDEEYEKFSKHYNIHNDTAVDYNVFLKNLSINNDLNLRYCMGNQEVSLENQQARNSKKERLLGSASSEDIWRNYSLDD-------IERNFCLELSKSYEKI---EKALS----AGDPCKGGYVSFNYLKIVLDTFIYQIPRRIFIQLMKRFGLKA-TTKINWKQFLTSFHEP----------------QGLQVSNKGPLTKRNSINSRSESRKENIITKLFRCTEDRSASLKKALLIINTKPDGPITREEFRYILNCVAIKLSDSEFKELMQILDPGDTGVVNTSMFIDLIEENCRMR-----------KTSPCTDAKTPFLLAWDSVEEIVHDTIARNLQAFYNMLRSYDLGDTGLIGRNNFKKIMHVFCPFLTNAHFIKLCSKIQ 401          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. UniProt/SwissProt
Match: sp|Q6P1E8|EFCB6_MOUSE (EF-hand calcium-binding domain-containing protein 6 OS=Mus musculus OX=10090 GN=Efcab6 PE=1 SV=2)

HSP 1 Score: 193.356 bits (490), Expect = 4.450e-48
Identity = 222/1143 (19.42%), Postives = 480/1143 (41.99%), Query Frame = 3
Query:  678 LQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETINIDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHKWLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQN----RLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQ---NFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVD--GHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTHLHVEHLFEMVKRH-LRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQEKTVGSIRINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGF----NQKLNNLDIQXXXXXXXXXXXXXTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLKKNEFDNVNYGEFV 4064
            L  +I RN   I K F++ D N+   +Q   L++V+E FC  + +  ++K + +++  +   V+Y  F+K + +  D        N+ E      +   G R+ +    E+ +  +  L+ L   F ++    +  + K     DP+  G+++L  L  +L+ F + +   +F Q++ +   K + KI W  FL    + Q   ++  T+ +K            ++   +++++ L  +  + Y++ +   L I+ T  G I   E   ILN     ++  + S + +  DP   G +  +  L + +  ++    K   S     + +  L ++ ++++  + D+I              DL  TG I   + +K+ +    YL ++ + R  +    +   GRI Y +    + V   P      S ++  S+  Q++E  +       S EK  E  +N M+ EE+I  +K RI Q     R  +  + K+ +       IN+ + RK+L + G  + + Q++ ++  L F   ++  + +  F   F D       +++ +  +P  +   +    D++  ++ +E   +  +K+  +F D+  AF + D    G +   DF     +L  N++ +E ++F  L   LG+     L + +F N  + R    D    + +  K +  D       +++ E  +  L  K    + ++S  FI     G G +R R++++ L    I ++  E +KLW+ YDT  R  + Y +FL+ LG+             +  +   +     + +   TK +Q             ++ L ++ +R  L   Y + + AF A+   K ++    +  + K+L +    +  ++ + L   +     ++ +   +F    + S     + K        ++  +P  I       +   ++   + + +      + + F  +D E++G+V   EF ++L   C  LTD Q++ +   L  ++  +      I ++YF++ F    ++  ++       A P  +     ++ I   + +++       +  F++ D    N +S+ +FR I  R +  + D  F++ WS L  N    + Y +F+
Sbjct:  191 LTEKIFRNMRSIRKVFQVMDVNNTGLVQPQELRRVLETFCLRMQDGDYEKFLEQYNIDKTTAVDYNAFLKNLSVKNDASFKYLLSNAAELSRETQQGKNGKRLLDTGSSED-VWKNYSLDDLEKTFCQEFSKSYEKIEKALSAGDPSKGGYISLNYLKVVLDTFIYRLPRRIFIQLIRRFGLKTSTKINWKQFLTAIYERQKLEVS-KTLPLKKRSSTE----ARNRSRKENIIKKLFKYSEDRYTALKKTLLIISSTPSGHITWEELRHILNCMVAKLNDSEFSELKQTFDPEGTGAVRVNSLLDVLD--DSTKVRKMSPS----TDTKTPLPVAWDSVEELVLDSITRNLQAFYSMLQSYDLRDTGTIGKNNFRKVMRVFCPYLSNEHLVRFSSKFQ-EAGSGRILYKKFLLSIGVGIPPPTPPLSSPKVQLSDQFQIEEPGQQDERTQPSGEKTSE--INNMTKEEVIDGLKHRIQQKDPVFRKQFLSISKEPDVK-----INQEEFRKVLERSGMPMNDCQYAMLASKLGF--KNEEGMSYQDFTMGFEDC------MLSGLETVPLQSRTASRTNMDEH-FISAEECLRIFPKKLKESFRDVYSAFFRIDLDRDGIISMHDFHRLLQYLQLNMVDLEFERFLSL---LGLRLSVTLNFREFQNLCEKRPWKSDEAPQRLIRCKQKVADS------ELACEQAHQYLIMKAKTRWADLSKNFIETDNEGNGILRRRDIKNSLYGFDIPLTPREFEKLWQNYDTEGRGYITYQEFLHRLGIR-----------YSPKVHRPYKEDYFNFLGHFTKPKQ---------VQEEIQELQQISEREKLMNHYEEISKAFNAMEKSKPVA----LCRVQKVLQECGCPLKEEELISLLKSLDVSVHNNHIDPVEFLRALEISWASKARPK-------EKEESSPPPISF---SKVTPDEVIKTMQEVVESSQPALVEAFSALDKEDTGFVKAMEFGDVLRSVCQKLTDNQYHYFLRRLRLHLTPN------IHWKYFLENFSTFQDETADDWAENMPKAPPPMSPKETAHRDIVARVQKAVASHYHTIVQEFENFDTLKSNTVSRDEFRSICTRHIQILTDEQFDRLWSELPVNAKGRLKYQDFL 1255          

HSP 2 Score: 114.775 bits (286), Expect = 4.889e-24
Identity = 166/788 (21.07%), Postives = 302/788 (38.32%), Query Frame = 3
Query:  663 DIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPID-NQGTIQTKNSEETINIDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQ---DPQSKHLNGSTIAIKSDHKCNPIQGVNSKP--------------NIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHKWLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKME-SIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNR------------NMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKL 2933
            DI  IL  +IS   + I K F++ D N +  + +  LK+V+  F  PLT+ QF  L+A+   S  GNV Y+EF+   G  ID N   I+  N  E   +D R T    + E  L E              IFR         +RK F VMD N  G V  + L ++L  F   M    + + +++     T  + + +FL+      D   K+L  +   +  + +    QG N K               ++DDL +      S +Y     A    + +  G I  +    +L+ F + +       +++         I++  FL    +++ L   K L    +     ++       IK     +  ++++ +     ++    +G+I+ E+L+ I   +   L D +   L       +  G +    L ++L+  T                           + KM  S +      +   S EEL++   D I +N   ++ + + Y+  D  G I K+  RK++  F   L+NE   + S    F  +   RI +  FL             ++           + +    D R            NM  +EV D L+ +I    P     F    +     + + +F+  L  + + + + Q+ +L  KLG   +  ++Y DF   F+  D M+ G + +  + R    +      +SAE+   + P+K+ + F ++   F  +     G I   +   LL  LQ++M   E ++ 
Sbjct:   85 DIERILAQKISSRRDDIKKVFQILDRNHNQMVTKGDLKRVITAFLIPLTKDQFQDLLAQIPISSLGNVPYLEFLSRFGGGIDININGIKRVNENE---VDNRRT----VKEVQLTEK-------------IFR-----NMRSIRKVFQVMDVNNTGLVQPQELRRVLETFCLRMQDGDYEKFLEQYNIDKTTAVDYNAFLKNLSVKNDASFKYLLSNAAELSRETQ----QGKNGKRLLDTGSSEDVWKNYSLDDLEKTFCQEFSKSYEKIEKALSAGDPSKGGYISLNYLKVVLDTFIYRLPRRIFIQLIRRFGLKTSTKINWKQFLTAIYERQKLEVSKTLPLKKRSSTEARNRSRKENIIKKLFKYS-EDRYTALKKTLLIISSTPSGHITWEELRHILNCMVAKLNDSEFSELKQTFD-PEGTGAVRVNSLLDVLDDSTK--------------------------VRKMSPSTDTKTPLPVAWDSVEELVL---DSITRNLQAFYSMLQSYDLRD-TGTIGKNNFRKVMRVFCPYLSNEHLVRFSS--KFQEAGSGRILYKKFLLSIGVGIPPPTPPLSSPKVQLSDQFQIEEPGQQDERTQPSGEKTSEINNMTKEEVIDGLKHRIQQKDPVFRKQFLSISKEPDVKINQEEFRKVLERSGMPMNDCQYAMLASKLGFKNEEGMSYQDFTMGFE--DCMLSGLETVPLQSRTASRTNMDEHFISAEECLRIFPKKLKESFRDVYSAFFRIDLDRDGIISMHDFHRLLQYLQLNMVDLEFERF 807          

HSP 3 Score: 90.1225 bits (222), Expect = 1.654e-16
Identity = 188/1081 (17.39%), Postives = 410/1081 (37.93%), Query Frame = 3
Query:  690 ISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNS---EETINIDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQ---KENLSAHKWLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLK---------DKKGR--INYLELFNLLNVDTSP-------SDLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFL-------AIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQ-IRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLE----KFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTHLH------------VEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQEKTVGSIRINQDLENPSKIGIEEAGNLNSTQIASI--IGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQF----NKYRNSLSTYIVKSANTDDKIDYRYFMKGFNQ 3770
            I+RN        + +D      I ++  +KVM  FC  L+ +   +  ++F ++ +G + Y +F+  +G+ I       +       +   I+    +  R  + +  +   + +   E+++   + +I+ +  V RK FL +    +  +  E   K+L +   PM+   +  +  K  FK    + +  F   F+D     L    +  ++  + N  +   S    ++ L +    +  ++     AF +I+    G I   +F ++L   Q  +   +    L  L       +++  F  L E+   K + +  + +    KV     D +L+ E     +      +W+++   F   D    G +   D+K     L+G+    DI     PLT +         D +GR  I Y E  + L +  SP        D         +    Q         E+++ ++++ E R  LM+                 +Y E+ K +   +K   +   +++K+L + G  L  E+   + + L+    + + ID   FL       A  A  +E        + F                  +   EV   +++ + ++ P L+ AF   D+ + G++   +F + L      + ++Q+     +L +     + +  FL  F   +D+  D   W ++  +   P   +  + +  D+   + + +  ++H I   F    T  +  +     + + +R    ++  +  +LW     N + +L Y DFL  L +          GD     + + Q   +A       +   +    D++  L +  H             E +   +++ ++  + +     K     K   G  +  +   L+ +  + ++ ++  QL  +   +  +   +Y    C F  S  +  + K    +R    ++N  K  ++EAG    +  +++  I  +IV  +  + ++F   D   +G +S+ +FR +L  + ++L++++F      Y  SLS+          KI Y  F++ F Q
Sbjct:  526 ITRNLQAFYSMLQSYDLRDTGTIGKNNFRKVMRVFCPYLSNEHLVRFSSKFQEAGSGRILYKKFLLSIGVGIPPPTPPLSSPKVQLSDQFQIEEPGQQDERT-QPSGEKTSEINNMTKEEVIDGLKHRIQQKDPVFRKQFLSISKEPDVKINQEEFRKVLERSGMPMNDCQYAMLASKLGFKNEEGMSYQDFTMGFEDCMLSGLETVPLQSRTASRTNMDEHFIS---AEECLRIFPKKLKESFRDVYSAFFRIDLDRDGIISMHDFHRLLQYLQLNMVDLEFERFLSLLGLRLSVTLNFREFQNLCEKRPWKSDEAPQRLIRCKQKVA----DSELACEQAHQYLIMKAKTRWADLSKNFIETDNEGNGILRRRDIK---NSLYGF----DI-----PLTPREFEKLWQNYDTEGRGYITYQEFLHRLGIRYSPKVHRPYKEDYFNFLGHFTKPKQVQ---------EEIQELQQISE-REKLMN-----------------HYEEISKAFNAMEKSKPVALCRVQKVLQECGCPLKEEELISLLKSLDVSVHN-NHIDPVEFLRALEISWASKARPKEKEESSPPPISF----------------SKVTPDEVIKTMQEVVESSQPALVEAFSALDKEDTGFVKAMEFGDVLRSVCQKLTDNQYHYFLRRLRLHLTPNIHWKYFLENFSTFQDETADD--WAENMPK--APPPMSPKETAHRDIVARVQKAVASHYHTIVQEFENFDTLKSNTVSRDEFRSICTRHIQILTDEQFDRLWSELPVNAKGRLKYQDFLSKLSIERVPSPPMAAGD--SGESTMAQRGSSAPEFSQGTRSNLYSPPRDSRVGLKSRSHPCTPVGTPPLQNCEPIESRLRKQIQGCWRELLRECKEKDTDK--QGTISAAEFLALVEKFKLDISREESQQLIVKYDLKN-NGKFAY----CDFIQSCVLLLKAKETSLMR-RMRIQNADK--MKEAGMETPSFYSALLRIQPKIVHCWRPMRRSFKTYDKNGTGLLSVADFRKVLRQYSINLSEEEFFHVLEYYDKSLSS----------KISYNDFLRAFLQ 1516          

HSP 4 Score: 85.5001 bits (210), Expect = 3.760e-15
Identity = 106/554 (19.13%), Postives = 231/554 (41.70%), Query Frame = 3
Query: 2436 EVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDM-VDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNA-----LVDHLVNQETKHQQSVDNQAVLGTHLHVEHLF--EMVKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQEKTVGSIRINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSL---STYIVKSANTDDKIDYRYFMKGFNQKLNNLDIQXXXXXXXXXXXXXTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLKKNEFDNVNYGEFV 4064
            ++E +L QKI +   D+   F   DR++   + K D +  +   LI +  DQF  L  ++ +     + Y +FL+RF    D+ ++G K ++     N  +   V           L EKI++    I   F  +  + TG ++ + L+ +L    + M   + +K  ++Y+ +    +DY+ FL NL +        L+  +A + + +        L+D   +++     S+D+         +E  F  E  K + ++   + AL+    A   +  G+ ++N L  +L      +    F+QL  R G +     +++++F     +   ++          +++ L    +   E         I   + K   D+Y+ ++KT L++    SG+++  E R++L      L D +F++ + +     T  V+  +  D +D    ++  +   +                 + +  ++E + +SI    + F +  +S D      I K++FR+++  F   + + H  +F S  ++     + Y +F+
Sbjct:   85 DIERILAQKISSRRDDIKKVFQILDRNHNQMVTKGDLKRVITAFLIPLTKDQFQDLLAQIPISSLGNVPYLEFLSRFGGGIDININGIKRVNENEVDNRRTVKEVQ----------LTEKIFRNMRSIRKVFQVMDVNNTGLVQPQELRRVLETFCLRMQDGDYEKFLEQYNIDKTTAVDYNAFLKNLSVKNDASFKYLLSNAAELSRETQQGKNGKRLLDTGSSEDVWKNYSLDD---------LEKTFCQEFSKSYEKI---EKALS----AGDPSKGGYISLNYLKVVLDTFIYRLPRRIFIQLIRRFGLKT-STKINWKQFLTAIYERQKLE----------VSKTLPLKKRSSTEARNRSRKENIIKKLFKYSEDRYTALKKTLLIISSTPSGHITWEELRHILNCMVAKLNDSEFSELKQTFDPEGTGAVRVNSLLDVLDDSTKVRKMSPSTDT-----------KTPLPVAWDSVEELVLDSITRNLQAFYSMLQSYDLRDTGTIGKNNFRKVMRVFCPYLSNEHLVRFSSKFQEAGSGRILYKKFL 590          

HSP 5 Score: 75.485 bits (184), Expect = 4.251e-12
Identity = 180/1085 (16.59%), Postives = 412/1085 (37.97%), Query Frame = 3
Query:  204 INPIVKSQLLKNHKEILKALQTFDIECSGLVTKGELRRVLDSYCLPMTTDQYEQFLSHNSINYSKGSINYKELIDKIYDKTSAVGHFKKNIKLPQLQRSATTICLQNKHFTLPTTRRSSGKISRSQLFXXXXXXXXXXXXXXXXWNYNAYTIDDIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETINIDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHK-----WLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFAD-NRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQI--------------------------------RDDMV----DGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQL 3332
            +  +V   + +N +     LQ++D+  +G + K   R+V+  +C P  ++++    S        G I YK+ +  I            + K+    +       Q    T P+  ++S                            N  T +++I  L+ +I +      K F       D  I +   +KV+E    P+ + Q+  L ++        ++Y +F  G    +         +  ET+ + +R    + + E  +           E+ L IF KK+++ F  +   F  +D + +G +++   +++L      M    F + +     + +   + L+F ++FQ+   K    S  A +   +C   +  +S+   +   + L       ++     F++ +    G + + +    L  F   ++  +   + +  D    GYI+Y  FL     + +   H+     + N      +P++  +   E  + +  + + N +  +   FN ++  ++  +++  ++K+ ++    LK++++  L+  L +      I+ +E    L              +I+ ++ A+ KE+ E+    +           + ++P+E+I  +++ +  ++    E +   +  D  G +   +   +L      LT+ Q+      L    +    I +  FL  F+    E+++D   +   +PK+   ++       +    +++   +++ + +++  ++  F  FD      + + +F++    ++ ++ ++QFD L  +L V  K +L Y DFL++  I                                R ++     D    L S+     P     P  + E +   L ++I   + E+        T   G I       L+ + ++ +S+ E ++L  +YD  N  K  Y DF+ +  LL K     LM      IQN+          +E   +      A+L     + H +  ++R           +FK     K  +G  ++ D  K+L Q  + ++ ++F  +
Sbjct:  518 VEELVLDSITRNLQAFYSMLQSYDLRDTGTIGKNNFRKVMRVFC-PYLSNEHLVRFSSKFQEAGSGRILYKKFLLSIGVGIPPPTPPLSSPKVQLSDQFQIEEPGQQDERTQPSGEKTS--------------------------EINNMTKEEVIDGLKHRIQQKDPVFRKQFLSISKEPDVKINQEEFRKVLERSGMPMNDCQYAMLASKLGFKNEEGMSYQDFTMGFEDCM--------LSGLETVPLQSRTASRTNMDEHFI---------SAEECLRIFPKKLKESFRDVYSAFFRIDLDRDGIISMHDFHRLLQYLQLNMVDLEFERFLSLLGLRLS---VTLNF-REFQNLCEKRPWKSDEAPQRLIRCKQ-KVADSELACEQAHQYLIMKAKTRWADLSKNFIETDNEGNGILRRRDIKNSLYGFDIPLTPREFEKLWQNYDTEGRGYITYQEFLHRLGIRYSPKVHRPYKEDYFNFLGHFTKPKQVQEEIQELQQISEREKLMNHYEEISKAFNAME--KSKPVALCRVQKVLQECGCPLKEEELISLLKSLDVSVHNNHIDPVEFLRAL--------------EISWASKARPKEKEESSPPPIS---------FSKVTPDEVIKTMQEVVESSQPALVEAFSALDKEDT-GFVKAMEFGDVLRSVCQKLTDNQYHYFLRRLRLHLTPN--IHWKYFLENFSTFQDETADDWAEN---MPKAPPPMSP------KETAHRDIVARVQKAVASHYHTIVQEFENFDTLKSNTVSRDEFRSICTRHIQILTDEQFDRLWSELPVNAKGRLKYQDFLSKLSIERVPSPPMAAGDSGESTMAQRGSSAPEFSQGTRSNLYSPPRDSRVGLKSRSHPCTP-VGTPPLQNCEPIESRLRKQIQGCWRELLRECKEKDTDKQGTISAAEFLALVEKFKLDISREESQQLIVKYDLKNNGKFAYCDFIQSCVLLLKAKETSLM--RRMRIQNADKM-------KEAGMETPSFYSALLRIQPKIVHCWRPMRR-----------SFKTY--DKNGTGLLSVADFRKVLRQYSINLSEEEFFHV 1493          

HSP 6 Score: 65.4698 bits (158), Expect = 4.294e-9
Identity = 49/213 (23.00%), Postives = 97/213 (45.54%), Query Frame = 3
Query: 4155 IETDEMDTDESIRKNLERLLNRNWQSIFNKCKAIDQAINECQTAEGSIPIDDFVYILSEYDDSLS-AENLAAINLYKTCKNGRFIKYGDLIRSIVLSSRGSLISNENVTEVQK--KFLNVGIKTTNSDNSKDYFPQLFKLRRQILENWKDLRKNFLQSDKKQNGAVSGNIFMTIMKTVCGQLSADLFYHLMKIYDQDGTGNFHYKRFIEDFLK 4784
            + T  +   E I   L + +   W+ +  +CK  D         +G+I   +F+ ++ ++   +S  E+   I  Y    NG+F  Y D I+S VL  +    S      +Q   K    G++T +      ++  L +++ +I+  W+ +R++F   DK   G +S   F  +++     LS + F+H+++ YD+  +    Y  F+  FL+
Sbjct: 1317 VGTPPLQNCEPIESRLRKQIQGCWRELLRECKEKDT------DKQGTISAAEFLALVEKFKLDISREESQQLIVKYDLKNNGKFA-YCDFIQSCVLLLKAKETSLMRRMRIQNADKMKEAGMETPS------FYSALLRIQPKIVHCWRPMRRSFKTYDKNGTGLLSVADFRKVLRQYSINLSEEEFFHVLEYYDKSLSSKISYNDFLRAFLQ 1516          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. UniProt/SwissProt
Match: sp|Q4R8T1|EFCB6_MACFA (EF-hand calcium-binding domain-containing protein 6 (Fragment) OS=Macaca fascicularis OX=9541 GN=EFCAB6 PE=2 SV=2)

HSP 1 Score: 105.145 bits (261), Expect = 1.571e-21
Identity = 135/670 (20.15%), Postives = 283/670 (42.24%), Query Frame = 3
Query:  756 IQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETINIDTRNTKGSRIFEAALIENGLLGSNELEQL---LVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAF-KATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHKWLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTS------------------PSDLEGLSTQIAESN-DAQLKERHENHIEKMESIEKL-GEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDK----KGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFL---AIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLR--QKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRF 2666
            ++R  +K  +  F  PLT ++F+KL A +     G++ Y EF++ +G+  +    +    +E+  N     TK  ++ E            EL+Q     V  R K+ D +  + K F  +D +   ++++  + K+L +    ++      +++     +    I +L FL+  ++ +S     +    K   +  PI      P   +++  +   + ++  +   AF  +++   G +  +EF ++L  F   ++ +Q    L+ L  H   YI++ +FLQ F      +A +W     K   P     ++S  I + +   + + +  +  EF   D  +T  IS E+ + +  +    L D+  DRL   + + + KGR+ Y +  +  + + +                  P   EG+ + ++  N + +   + ++H     S   + G   L    P E   R++ RI   +  + +L K  EC +K    +G I+ S+   ++ +F   ++ E+  ++  I+ +   +  +  +  F+    +    +ESS  LM  +    ++ H + D   + +   +      LLR   KIV+ +  +   F  +D +  G L  +DF+  L    I +  ++F  + E       S ++YNDFL  F
Sbjct:   12 LRRRDIKNALYGFDIPLTPREFEKLWASYDTEGKGHITYQEFLQKLGV--NYSPAVHRPCAEDYFNFMGHFTKPQQLQEEM---------KELQQSTEKAVAARDKLVDCYQDISKAFTKIDKSKTNYISICKMQKVLEECGCSLTEGELTNLLNSWGVSRHDNSINYLDFLRAVENSKS-----TGAQPKEKEESMPINFATLNPQ--EVVRKIQEVVESSQLALSTAFSALDKEDTGFVKSTEFGQVLKDFCHKLTDNQYHYFLRKLRIHLTPYINWKYFLQNFSCFLEETAEEWAEKMPKGPPPTSPKAMASRDILARLHKAVTSHYHAITQEFENFDTMKTNTISREEFRAVCNRNVQILTDEQFDRLWNEMPV-NAKGRLKYPDFLSRFSSERAATPTATGDSAAAQRGSSVPDVSEGIRSALSLPNQELRPGSKPQSHPCTAASTTAIPGTPPLQNCDPIE--SRLRKRI---QGCWRQLLK--ECKEKDVARQGDISASEFLALVEKFNLDISKEECQQL--IIKYDLKNNGKFAYCDFIQSCVLLLKAKESS--LMQRMKI--QNAHKMKDSGAETSSFYSA-----LLRIQPKIVHCWRPMRRTFKSYDEAGTGLLSVADFRTVLRQYSINLSEEEFFHILEYYDKTLSSNISYNDFLRAF 644          

HSP 2 Score: 92.4337 bits (228), Expect = 1.418e-17
Identity = 91/420 (21.67%), Postives = 171/420 (40.71%), Query Frame = 3
Query: 2826 FIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQN--SHNALVDHLVNQETKHQQSVDNQAVLGTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQEK-TVGSIRINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGFN----QKLNNLDIQXXXXXXXXXXXXXTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLKKNEFDNVNYGEFV 4064
            F+     G G +R R++++ L    I ++  E +KLW  YDT  +  + Y +FL  LG+        +  P A    N   H      L  +  + QQS +                  +  L   Y D + AF  +   KT   + +I  + K+L +    +T  +   L    G    D+S++Y  F    ++S +   Q K    S+ IN    NP ++  +    + S+Q+A             +   F  +D E++G+V   EF  +L  FC  LTD Q++ +   L  ++         I+++YF++ F+    +       +     P  +   M  + I   +++++          F++ D    N IS+ +FR +  R +  + D  F++ W+ +  N    + Y +F+
Sbjct:    1 FLETDNEGNGILRRRDIKNALYGFDIPLTPREFEKLWASYDTEGKGHITYQEFLQKLGVNYSPA---VHRPCAEDYFNFMGHFTKPQQLQEEMKELQQSTEKAVA-------------ARDKLVDCYQDISKAFTKIDKSKT--NYISICKMQKVLEECGCSLTEGELTNLLNSWGVSRHDNSINYLDFLRAVENSKSTGAQPKEKEESMPINFATLNPQEVVRKIQEVVESSQLA-------------LSTAFSALDKEDTGFVKSTEFGQVLKDFCHKLTDNQYHYFLRKLRIHLTPY------INWKYFLQNFSCFLEETAEEWAEKMPKGPPPTSPKAMASRDILARLHKAVTSHYHAITQEFENFDTMKTNTISREEFRAVCNRNVQILTDEQFDRLWNEMPVNAKGRLKYPDFL 383          

HSP 3 Score: 87.8113 bits (216), Expect = 4.338e-16
Identity = 125/661 (18.91%), Postives = 266/661 (40.24%), Query Frame = 3
Query: 1431 FLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHKWLNSNH-----------KVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIR--------------------DDMVDGHKWLDS-------------KHRFNDPSTNAVPDMS----AEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTIN 3269
            FL+ +    G + + +    L  F   ++  +   +    D   +G+I+Y  FLQ      + + H+    ++           ++ E  K+LQ S+E   +   D + + + ++   F  +D ++T YIS+  ++K+ ++    L + ++  L+    +      INYL+                 + + ++S  AQ KE+ E+          +  A LN   P+E++ +I++ +  ++L     +   +  D  G +  ++  ++L  F + LT+ Q+      L    +    I++  FL  F+   E + +   +   +PK     +       + M  +++   L + + +++  +   F  FD      + + +F+     N+ ++ ++QFD L  ++ V  K +L Y DFL+RF                        D+ +G +   S              H     ST A+P        + +   L ++I   + ++         +  G I       L+ +  + +SK E ++L  +YD  N  K  Y DF+ +  LL K     LM      IQN+H         +++  + S    A+L     + H +  ++R  + +Y ++     +VA+ +T+   ++IN
Sbjct:    1 FLETDNEGNGILRRRDIKNALYGFDIPLTPREFEKLWASYDTEGKGHITYQEFLQKLGVNYSPAVHRPCAEDYFNFMGHFTKPQQLQEEMKELQQSTEKAVAA-RDKLVDCYQDISKAFTKIDKSKTNYISICKMQKVLEECGCSLTEGELTNLLNSWGVSRHDNSINYLDFLR--------------AVENSKSTGAQPKEKEESM--------PINFATLN---PQEVVRKIQEVVESSQLALSTAFSALDKEDT-GFVKSTEFGQVLKDFCHKLTDNQYHYFLRKLRIHLTP--YINWKYFLQNFSCFLEETAEEWAEK--MPKGPPPTSP------KAMASRDILARLHKAVTSHYHAITQEFENFDTMKTNTISREEFRAVCNRNVQILTDEQFDRLWNEMPVNAKGRLKYPDFLSRFSSERAATPTATGDSAAAQRGSSVPDVSEGIRSALSLPNQELRPGSKPQSHPCTAASTTAIPGTPPLQNCDPIESRLRKRIQGCWRQLLKECKEKDVARQGDISASEFLALVEKFNLDISKEECQQLIIKYDLKNNGKFAYCDFIQSCVLLLKAKESSLM--QRMKIQNAHKM-------KDSGAETSSFYSALLRIQPKIVHCWRPMRRTFK-SYDEAGTGLLSVADFRTVLRQYSIN 614          

HSP 4 Score: 70.4774 bits (171), Expect = 9.785e-11
Identity = 49/212 (23.11%), Postives = 100/212 (47.17%), Query Frame = 3
Query: 4161 TDEMDTDESIRKNLERLLNRNWQSIFNKCKAIDQAINECQTAEGSIPIDDFVYILSEYDDSLSAENLAAINL-YKTCKNGRFIKYGDLIRSIVL---SSRGSLISNENVTEVQKKFLNVGIKTTNSDNSKDYFPQLFKLRRQILENWKDLRKNFLQSDKKQNGAVSGNIFMTIMKTVCGQLSADLFYHLMKIYDQDGTGNFHYKRFIEDFLK 4784
            T  +   + I   L + +   W+ +  +CK  D A       +G I   +F+ ++ +++  +S E    + + Y    NG+F  Y D I+S VL   +   SL+    +    K      +K + ++ S  ++  L +++ +I+  W+ +R+ F   D+   G +S   F T+++     LS + F+H+++ YD+  + N  Y  F+  FL+
Sbjct:  449 TPPLQNCDPIESRLRKRIQGCWRQLLKECKEKDVA------RQGDISASEFLALVEKFNLDISKEECQQLIIKYDLKNNGKFA-YCDFIQSCVLLLKAKESSLMQRMKIQNAHK------MKDSGAETS-SFYSALLRIQPKIVHCWRPMRRTFKSYDEAGTGLLSVADFRTVLRQYSINLSEEEFFHILEYYDKTLSSNISYNDFLRAFLQ 646          

HSP 5 Score: 65.4698 bits (158), Expect = 3.067e-9
Identity = 112/580 (19.31%), Postives = 220/580 (37.93%), Query Frame = 3
Query:  711 IMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGN-VNYMEFMKGMGIPIDNQGTI--QTKNSEETINIDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKE--------NLSAHKWLNSNHKVVE--------PRKDLQLSS------------------------ETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIF 2321
            I KAF   D +    I   +++KV+E   C LTE +   L+  +  S++ N +NY++F++     ++N  +   Q K  EE++ I+                     +   ++++   ++ +E     L   F  +D    GFV      ++L  F   ++ N ++  + K     T  I W  FLQ F    S  L  +           P           D+L  L   ++++Y +    F   +      I + EF  + NR    ++ +Q   +   +  + +G + Y  FL  F  +         + +A +  +S   V E        P ++L+  S                        + I+S +   I   W  ++ E    D+ R G IS  +   + +K    +  ++  +L+    LK+  G+  Y +      +             + ++ ++ L +R      K+++  K+ ++     S    ++RI+ +IV         +K Y+     G ++ +  R +L Q+   L+ E+F  I E  +   SS   I +N FL  F
Sbjct:  114 ISKAFTKIDKSKTNYISICKMQKVLEECGCSLTEGELTNLLNSWGVSRHDNSINYLDFLRA----VENSKSTGAQPKEKEESMPIN-------------------FATLNPQEVVRKIQEVVESSQLALSTAFSALDKEDTGFVKSTEFGQVLKDFCHKLTDNQYHYFLRKLRIHLTPYINWKYFLQNF----SCFLEETAEEWAEKMPKGPPPTSPKAMASRDILARLHKAVTSHYHAITQEFENFDTMKTNTISREEFRAVCNRNVQILTDEQFDRLWNEMPVNAKGRLKYPDFLSRFSSERAATPTATGDSAAAQRGSSVPDVSEGIRSALSLPNQELRPGSKPQSHPCTAASTTAIPGTPPLQNCDPIESRLRKRIQGCWRQLLKECKEKDVARQGDISASEFLALVEKFNLDISKEECQQLIIKYDLKN-NGKFAYCDFIQSCVL-------------LLKAKESSLMQRM-----KIQNAHKMKDSGAETSSFYSALLRIQPKIVHCWRPMRRTFKSYD-EAGTGLLSVADFRTVLRQYSINLSEEEFFHILEYYDKTLSSN--ISYNDFLRAF 644          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. TrEMBL
Match: A0A267H1X4 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003760g2 PE=4 SV=1)

HSP 1 Score: 682.559 bits (1760), Expect = 0.000e+0
Identity = 438/1465 (29.90%), Postives = 750/1465 (51.19%), Query Frame = 3
Query:  117 QSNSLNQPEKNSTIKDANYKMDPKLQISEINPIVKSQLLKNHKEILKALQTFDIECSGLVTKGELRRVLDSYCLPMTTDQYEQFLSHNSINYSKGSINYKELIDKIYDKTSAVGHFKKNIKLPQLQRSATTICLQNKHFTLPTTRRSSGKISRSQLFXXXXXXXXXXXXXXXXWNYNAYTIDDIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETINIDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHKWLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIEND-QFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQE---KTVGSIRINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGFNQKLNNLDIQX----------XXXXXXXXXXXXTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLKKNEFDNVNYGEFVKMXXXXXXXXXXXXXXXX----------XXXXXXXXXXNNIETDEMDTDESIRKNLERLLNRNWQSIFNKCKAIDQAINECQTAEGSIPIDDFVYIL-SEYDDSLSAENLAAINLYKTCKNGRFIKYGDLIRSIV 4436
            Q+N   Q    S +  A+    P  Q S ++  +   + +N  E+L A + +DIE +G VTKGELRR+++     + T  + + L + ++N + GS+ Y   + K Y     +G         + ++ A    L  K    P                                N NA  I+    +L+  I  N + +++ F+LFD+N D  IQ H L+K++E +C P++  QF+KL      S+ G ++YM+F+  +G+ + N G+          N+  R        E   ++ G  G N ++QL V +R+++++Q  +L+K  LV+D    G + ++    IL++F   +S   F+++M++ + KA+  I W  FLQKF DPQS   NG T+ I+  HK N ++G + + ++ DL++LL NHI + YSS R+AFLQI+   KGKI  ++F +++  F+F +S  Q+  I+  LDP + G+I+Y  FL +FE+KE+   HKWL S HK  +  K   L+ +T++  +   I  +W +        D   TGYI+  +LKK+  K+   L D+  D L+  L+ K   G++NYLE   ++ +D  P D+EG+S QIA  N+A+L+ R   H + M  IE     R N+MS EE+IVR++DR  Q R +  + + + + + +KG ++K++ R  L   G  L++E FS+++  L F    +  +D+  F+  F + R+S      +  +LP  NH  N +RGD+   M+   VE+ LR KI  NF  L  AFHK D   +GYL K DF+  LL  L+ + ND +F+ LC KLG+ +  KL+Y DFL +FQ +DD+  GHKWL S HR+N+     +   +A +V+ L+ EK++Q + +I+  F  +   G G+I  R  + LL RL ++M + E KKLW  YDT NRN + +  FL  +G+   F  GD  G SA IIQNS   +  HL  QE + +  V NQAVL   L  + LF ++++ +R  +  +  AF+A+  K+   G+ +  D    + Q+H+FV ++ F +L  R+G   P   ++YE FC  F +  +   +    KT G + ++       +   +     ++      +   +V     +EK F  MD +    +  ++FR ++ GFC  LTD QF +    L        +  D++DY  F+  F+Q     + +            +   A +  +++ Q+++  ++E +  RP L   +F   DYA L  ++K+DFR+I+ R +  + +  F++  + +  NE+ NV+Y EF+   + + +    ++               +  + +++    +   +  +      L R ++++W+++F++ K +DQA  +       I +DDF  +L S     L+   +A I      +   + +Y D +R+ V
Sbjct:    9 QTNFAAQGRNGSIMPVASTSRTP--QASAVDIAISKHVKENFDELLSAFKVYDIENNGSVTKGELRRIIEINITAINTADFGKVLKNATVNRN-GSVQYMTFL-KFYKD---LGQGASKEAEGEKRKQADATGLNGKKPIDP--------------------------------NLNAGEIE---KLLKNAIESNLSSVLRGFRLFDYNRDRKIQFHELRKILEQYCFPMSNVQFEKLWNSIDYSKMGLIDYMDFLGRLGVAVPNAGSK---------NVGQRT-------ERKKLQLGSSGMN-MDQLEVEYRRRLKEQHGLLKKACLVVDSKHSGLMPIKNFKAILDEFVIAVSDQEFSKLMERFSVKASHDIQWYGFLQKFVDPQSLS-NGQTLPIRPSHKANVVRGSHVEASVQDLIQLLYNHILSAYSSLRNAFLQIDINRKGKITIADFRRLVQGFKFELSEVQIKEIMVQLDPEHTGFITYQKFLDIFEEKESADGHKWLVSTHKYNKDTKPPILAWKTVEDLLHQKIVLRWKSFTAALKHYDSTGTGYINPTNLKKVLDKIAIPLSDEHYDSLLKRLSHKTADGKVNYLEFLAVMQIDVYPGDVEGVSAQIASGNEARLQMRQSQHEKAMADIETHASLRTNMMSLEEIIVRLRDRSSQTRQHIRDAFLQMD-DARKGFVSKAKFRLFLESHGIFLSDENFSQLTRELEF---GREGLDYMRFVKHF-EGRDSE----LNPSYLPMQNHKYNPVRGDEF-GMSAPAVENKLRSKIRENFTTLREAFHKMDSDGRGYLTKQDFRR-LLDQLMCLTNDAEFNKLCNKLGIDDDCKLSYRDFLGKFQEKDDLATGHKWLVSNHRYNE--LGDIKPKTAAEVHQLMAEKVHQNYKDIARAFCHIDYLGRGYITKREFKELLVRLNVTMDQEEFKKLWAYYDTANRNAITHDAFLKRVGVASAFSSGDGQGTSAKIIQNSAEYIAVHLEGQENRQENLVFNQAVLTVGLDADALFIILQKRIRDFFPTTYAAFRALDGKE--KGYLSQEDFRIAVHQMHLFVRDESFAELMRRIGLSQPTAQMTYEAFCLAFDEKFSGPRESQRPKTAGPM-LDGARGGQQQQQQQPQQRQDAKAFLKRLRASVVKDGEILEKVFRSMDTKQESRIGASDFRRVVDGFCFKLTDAQFKEVVKGL-------LSQGDQVDYYRFLANFSQTQEAAERREWMEAANGVGGGAGGSAEDGESLSQQEVEARVSEFVSARPHLLAQAFAEADYAQLGVLAKTDFRDILFRLVMRMSNEQFDQLMTRVPTNEYGNVDYKEFLSRFASAEQPQQQQQQPTRPDSPISLTPPASADQAQQQQQQPQQPTLSLETEAEAQLRRAMSQSWKTLFSRFKLLDQATPD---KPKQIHVDDFCAVLRSSGAVDLAPSQVAPILRRFGLRGDGYFRYQDCMRAFV 1387          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. TrEMBL
Match: A0A267FVL1 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003760g3 PE=4 SV=1)

HSP 1 Score: 679.863 bits (1753), Expect = 0.000e+0
Identity = 437/1470 (29.73%), Postives = 745/1470 (50.68%), Query Frame = 3
Query:  117 QSNSLNQPEKNSTIKDANYKMDPKLQISEINPIVKSQLLKNHKEILKALQTFDIECSGLVTKGELRRVLDSYCLPMTTDQYEQFLSHNSINYSKGSINYKELIDKIYDKTSAVGHFKKNIKLPQLQRSATTICLQNKHFTLPTTRRSSGKISRSQLFXXXXXXXXXXXXXXXXWNYNAYTIDDIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETINIDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHKWLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIEND-QFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQE---KTVGSIRINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGFNQKLNNLDIQXXXXXXXXXX----------XXXTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLKKNEFDNVNYGEFVKMXXXXXXXXXXXXXXXXXXXXXXXXXXN---------------NIETDEMDTDESIRKNLERLLNRNWQSIFNKCKAIDQAINECQTAEGSIPIDDFVYIL-SEYDDSLSAENLAAINLYKTCKNGRFIKYGDLIRSIV 4436
            Q+N   Q    S +  A+    P  Q S ++  +   + +N  E+L A + +DIE +G VTKGELRR+++     + T  + + L + ++N + GS+ Y   + K Y     +G         + ++ A    L  K    P                                N NA  I+    +L+  I  N + +++ F+LFD+N D  IQ H L+K++E +C P++  QF+KL      S+ G ++YM+F+  +G+ + N G+          N+  R        E   ++ G  G N ++QL V +R+++++Q  +L+K  LV+D    G + ++    IL++F   +S   F+++M++ + KA+  I W  FLQKF DPQS   NG T+ I+  HK N ++G + + ++ DL++LL NHI + YSS R+AFLQI+   KGKI  ++F +++  F+F +S  Q+  I+  LDP + G+I+Y  FL +FE+KE+   HKWL S HK  +  K   L+ +T++  +   I  +W +        D   TGYI+  +LKK+  K+   L D+  D L+  L+ K   G++NYLE   ++ +D  P D+EG+S QIA  N+A+L+ R   H + M  IE     R N+MS EE+IVR++DR  Q R +  + + + + + +KG ++K++ R  L   G  L++E FS+++  L F    +  +D+  F+  F + R+S      +  +LP  NH  N +RGD+   M+   VE+ LR KI  NF  L  AFHK D   +GYL K DF+  LL  L+ + ND +F+ LC KLG+ +  KL+Y DFL +FQ +DD+  GHKWL S HR+N+     +   +A +V+ L+ EK++Q + +I+  F  +   G G+I  R  + LL RL ++M + E KKLW  YDT NRN + +  FL  +G+   F  GD  G SA IIQNS   +  HL  QE + +  V NQAVL   L  + LF ++++ +R  +  +  AF+A+  K+   G+ +  D    + Q+H+FV ++ F +L  R+G   P   ++YE FC  F +  +   +    KT G + ++       +   +     ++      +   +V     +EK F  MD +    +  ++FR ++ GFC  LTD QF +    L        +  D++DY  F+  F+Q     + +                     +++ Q+++  ++E +  RP L   +F   DYA L  ++K+DFR+I+ R +  + +  F++  + +  NE+ NV+Y EF+   + + +    ++   +    +     +                 +   +  +      L R ++++W+++F++ K +DQA  +       I +DDF  +L S     L+   +A I      +   + +Y D +R+ V
Sbjct:    9 QTNFAAQGRNGSIMPVASTSRTP--QASAVDIAISKHVKENFDELLSAFKVYDIENNGSVTKGELRRIIEINITAINTADFGKVLKNATVNRN-GSVQYMTFL-KFYKD---LGQGASKEAEGEKRKQADATGLNGKKPIDP--------------------------------NLNAGEIE---KLLKNAIESNLSSVLRGFRLFDYNRDRKIQFHELRKILEQYCFPMSNVQFEKLWNSIDYSKMGLIDYMDFLGRLGVAVPNAGSK---------NVGQRT-------ERKKLQLGSSGMN-MDQLEVEYRRRLKEQHGLLKKACLVVDSKHSGLMPIKNFKAILDEFVIAVSDQEFSKLMERFSVKASHDIQWYGFLQKFVDPQSLS-NGQTLPIRPSHKANVVRGSHVEASVQDLIQLLYNHILSAYSSLRNAFLQIDINRKGKITIADFRRLVQGFKFELSEVQIKEIMVQLDPEHTGFITYQKFLDIFEEKESADGHKWLVSTHKYNKDTKPPILAWKTVEDLLHQKIVLRWKSFTAALKHYDSTGTGYINPTNLKKVLDKIAIPLSDEHYDSLLKRLSHKTADGKVNYLEFLAVMQIDVYPGDVEGVSAQIASGNEARLQMRQSQHEKAMADIETHASLRTNMMSLEEIIVRLRDRSSQTRQHIRDAFLQMD-DARKGFVSKAKFRLFLESHGIFLSDENFSQLTRELEF---GREGLDYMRFVKHF-EGRDSE----LNPSYLPMQNHKYNPVRGDEF-GMSAPAVENKLRSKIRENFTTLREAFHKMDSDGRGYLTKQDFRR-LLDQLMCLTNDAEFNKLCNKLGIDDDCKLSYRDFLGKFQEKDDLATGHKWLVSNHRYNE--LGDIKPKTAAEVHQLMAEKVHQNYKDIARAFCHIDYLGRGYITKREFKELLVRLNVTMDQEEFKKLWAYYDTANRNAITHDAFLKRVGVASAFSSGDGQGTSAKIIQNSAEYIAVHLEGQENRQENLVFNQAVLTVGLDADALFIILQKRIRDFFPTTYAAFRALDGKE--KGYLSQEDFRIAVHQMHLFVRDESFAELMRRIGLSQPIAQMTYEAFCLAFDEKFSGPRESQRPKTAGPM-LDGARGGQQQQQQQPQQRQDAKAFLKRLRASVVKDGEILEKVFRSMDTKQESRIGASDFRRVVDGFCFKLTDAQFKEVVKGL-------LSQGDQVDYYRFLANFSQTQEAAERREWMEAANGGGGGAGGSAEDGESLSQQEVEARVSEFVSARPHLLAQAFAEADYAQLGVLAKTDFRDILFRLVMRMSNEQFDQLMTRVPTNEYGNVDYKEFLSRFASAEQPQQQQQQPTAGGDARPDSPISLTPPASADQAQQQQQQPQQPTLSLETEAEAQLRRAMSQSWKTLFSRFKLLDQATPD---KPKQIHVDDFCAVLRSSGAVDLAPSQVAPILRRFGLRGDGYFRYQDCMRAFV 1392          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. TrEMBL
Match: A0A267DTE8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003760g1 PE=4 SV=1)

HSP 1 Score: 679.093 bits (1751), Expect = 0.000e+0
Identity = 437/1470 (29.73%), Postives = 745/1470 (50.68%), Query Frame = 3
Query:  117 QSNSLNQPEKNSTIKDANYKMDPKLQISEINPIVKSQLLKNHKEILKALQTFDIECSGLVTKGELRRVLDSYCLPMTTDQYEQFLSHNSINYSKGSINYKELIDKIYDKTSAVGHFKKNIKLPQLQRSATTICLQNKHFTLPTTRRSSGKISRSQLFXXXXXXXXXXXXXXXXWNYNAYTIDDIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETINIDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHKWLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIEND-QFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQE---KTVGSIRINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGFNQKLNNLDIQXXXXXXXXXX----------XXXTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLKKNEFDNVNYGEFVKMXXXXXXXXXXXXXXXXXXXXXXXXXXN---------------NIETDEMDTDESIRKNLERLLNRNWQSIFNKCKAIDQAINECQTAEGSIPIDDFVYIL-SEYDDSLSAENLAAINLYKTCKNGRFIKYGDLIRSIV 4436
            Q+N   Q    S +  A+    P  Q S ++  +   + +N  E+L A + +DIE +G VTKGELRR+++     + T  + + L + ++N + GS+ Y   + K Y     +G         + ++ A    L  K    P                                N NA  I+ +   L+  I  N + +++ F+LFD+N D  IQ H L+K++E +C P++  QF+KL      S+ G ++YM+F+  +G+ + N G+          N+  R        E   ++ G  G N ++QL V +R+++++Q  +L+K  LV+D    G + ++    IL++F   +S   F+++M++ + KA+  I W  FLQKF DPQS   NG T+ I+  HK N ++G + + ++ DL++LL NHI + YSS R+AFLQI+   KGKI  ++F +++  F+F +S  Q+  I+  LDP + G+I+Y  FL +FE+KE+   HKWL S HK  +  K   L+ +T++  +   I  +W +        D   TGYI+  +LKK+  K+   L D+  D L+  L+ K   G++NYLE   ++ +D  P D+EG+S QIA  N+A+L+ R   H + M  IE     R N+MS EE+IVR++DR  Q R +  + + + + + +KG ++K++ R  L   G  L++E FS+++  L F    +  +D+  F+  F + R+S      +  +LP  NH  N +RGD+   M+   VE+ LR KI  NF  L  AFHK D   +GYL K DF+  LL  L+ + ND +F+ LC KLG+ +  KL+Y DFL +FQ +DD+  GHKWL S HR+N+     +   +A +V+ L+ EK++Q + +I+  F  +   G G+I  R  + LL RL ++M + E KKLW  YDT NRN + +  FL  +G+   F  GD  G SA IIQNS   +  HL  QE + +  V NQAVL   L  + LF ++++ +R  +  +  AF+A+  K+   G+ +  D    + Q+H+FV ++ F +L  R+G   P   ++YE FC  F +  +   +    KT G + ++       +   +     ++      +   +V     +EK F  MD +    +  ++FR ++ GFC  LTD QF +    L        +  D++DY  F+  F+Q     + +                     +++ Q+++  ++E +  RP L   +F   DYA L  ++K+DFR+I+ R +  + +  F++  + +  NE+ NV+Y EF+   + + +    ++   +    +     +                 +   +  +      L R ++++W+++F++ K +DQA  +       I +DDF  +L S     L+   +A I      +   + +Y D +R+ V
Sbjct:    9 QTNFAAQGRNGSIMPVASTSRTP--QASAVDIAISKHVKENFDELLSAFKVYDIENNGSVTKGELRRIIEINITAINTADFGKVLKNATVNRN-GSVQYMTFL-KFYKD---LGQGASKEAEGEKRKQADATGLNGKKPIDP--------------------------------NLNAGEIEKL---LKNAIESNLSSVLRGFRLFDYNRDRKIQFHELRKILEQYCFPMSNVQFEKLWNSIDYSKMGLIDYMDFLGRLGVAVPNAGSK---------NVGQRT-------ERKKLQLGSSGMN-MDQLEVEYRRRLKEQHGLLKKACLVVDSKHSGLMPIKNFKAILDEFVIAVSDQEFSKLMERFSVKASHDIQWYGFLQKFVDPQSLS-NGQTLPIRPSHKANVVRGSHVEASVQDLIQLLYNHILSAYSSLRNAFLQIDINRKGKITIADFRRLVQGFKFELSEVQIKEIMVQLDPEHTGFITYQKFLDIFEEKESADGHKWLVSTHKYNKDTKPPILAWKTVEDLLHQKIVLRWKSFTAALKHYDSTGTGYINPTNLKKVLDKIAIPLSDEHYDSLLKRLSHKTADGKVNYLEFLAVMQIDVYPGDVEGVSAQIASGNEARLQMRQSQHEKAMADIETHASLRTNMMSLEEIIVRLRDRSSQTRQHIRDAFLQMD-DARKGFVSKAKFRLFLESHGIFLSDENFSQLTRELEF---GREGLDYMRFVKHF-EGRDSE----LNPSYLPMQNHKYNPVRGDEF-GMSAPAVENKLRSKIRENFTTLREAFHKMDSDGRGYLTKQDFRR-LLDQLMCLTNDAEFNKLCNKLGIDDDCKLSYRDFLGKFQEKDDLATGHKWLVSNHRYNE--LGDIKPKTAAEVHQLMAEKVHQNYKDIARAFCHIDYLGRGYITKREFKELLVRLNVTMDQEEFKKLWAYYDTANRNAITHDAFLKRVGVASAFSSGDGQGTSAKIIQNSAEYIAVHLEGQENRQENLVFNQAVLTVGLDADALFIILQKRIRDFFPTTYAAFRALDGKE--KGYLSQEDFRIAVHQMHLFVRDESFAELMRRIGLSQPIAQMTYEAFCLAFDEKFSGPRESQRPKTAGPM-LDGARGGQQQQQQQPQQRQDAKAFLKRLRASVVKDGEILEKVFRSMDTKQESRIGASDFRRVVDGFCFKLTDAQFKEVVKGL-------LSQGDQVDYYRFLANFSQTQEAAERREWMEAANGGGGGAGGSAEDGESLSQQEVEARVSEFVSARPHLLAQAFAEADYAQLGVLAKTDFRDILFRLVMRMSNEQFDQLMTRVPTNEYGNVDYKEFLSRFASAEQPQQQQQQPTAGGDARPDSPISLTPPASADQAQQQQQQPQQPTLSLETEAEAQLRRAMSQSWKTLFSRFKLLDQATPD---KPKQIHVDDFCAVLRSSGAVDLAPSQVAPILRRFGLRGDGYFRYQDCMRAFV 1392          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. TrEMBL
Match: A0A267EGC4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025834g1 PE=4 SV=1)

HSP 1 Score: 677.552 bits (1747), Expect = 0.000e+0
Identity = 428/1410 (30.35%), Postives = 729/1410 (51.70%), Query Frame = 3
Query:  117 QSNSLNQPEKNSTIKDANYKMDPKLQISEINPIVKSQLLKNHKEILKALQTFDIECSGLVTKGELRRVLDSYCLPMTTDQYEQFLSHNSINYSKGSINYKELIDKIYDKTSAVGHFKKNIKLPQLQRSATTICLQNKHFTLPTTRRSSGKISRSQLFXXXXXXXXXXXXXXXXWNYNAYTIDDIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETINIDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHKWLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIEND-QFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQE---KTVGSIRINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGFNQKLNNLDIQX----------XXXXXXXXXXXXTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLKKNEFDNVNYGEFVKMXXXXXXXXXXXXXXXXXXXXXXXXXXN-------------NIETDEMDTDESIRKNLERLLNRNWQSIFNKCKAIDQA 4265
            Q+N   Q    S +  ++    P  Q S ++  + + + +N  E+L A + +DIE +G VTKGE+RR+++     + T  + + L + ++N + GS+ Y   + K Y     +G         + ++ A    L  K    P                                N NA  I+    +L+  I  N + +++ F+LFD+N D  IQ H L+K++E +C P++  QF+KL      S+ G ++YM+F+  +G+ + N G+          NI  R        E   ++ G  G N ++QL V +R+++++Q  +L+K  LV+D    G + ++    IL++F   +S   F+++M++ + KA+  I W  FLQKF DPQS   NG T+ I+  HK N ++G + + ++ DL++LL NHI + YSS R+AFLQI+   KGKI  ++F +++  F+F +S  Q+  I+  LDP + G+I+Y  FL +FE+KE+   HKWL S HK  +  K   L+ +T++  +   I  +W +        D   TGYI+  +LKK+  K+   L D+  D L+  L+ K   G++NYLE   ++ +D  P D+EG+S QIA  N+A+L+ R   H + M  IE     R N+MS EE+IVR++DR  Q R +  + + + + + +KG ++K++ R  L   G  L++E FS+++  L F    +  +D+  F+  F + R+S      +  +LP  NH  N +RGD+   M+ Q VE+ LR KI  NF  L  AFHK D   +GYL K DF+  LL  L+ + ND +F+ LC+KLG+ +  KL+Y DFL +FQ +DD+  GHKWL S HR+N+     +   +A +V+ L+ EK++Q + +I+  F  +   G G+I  R  + LL RL ++M++ E KKLW  YDT NRN + +  FL  +G+   F  GD  G SA IIQNS   +  HL  QE + +  V NQAVL   L  + LF ++++ +R  +  +  AF+A+  K+   G+ +  D    + Q+H+FV ++ F +L  R+G   P   ++YE FC  F +  +   +    KT G + ++       +   +     ++      +   +V     +EK F  MD +  G +  ++FR ++ GFC  LTD QF +    L        +  D++DY  F+  F+Q     + +            +   A    +++ Q+++  ++E +  RP L   +F   DYA L  ++K+DFR+I+ R +  + +  F++  + +  NE+ NV+Y EF+   + + +    ++   +    +     +               +   +  D      L R ++++W+S+F++ K +DQA
Sbjct:    9 QANFAAQGSNGSIMPVSSTSRTP--QASAVDIAISNHVKENFDELLSAFKVYDIENNGSVTKGEMRRIIEINITAINTADFGKVLKNATVNRN-GSVQYMTFL-KFYKD---LGQGASKEAEGEKRKQADATGLNGKKPIDP--------------------------------NLNAGEIE---KLLKNAIESNLSSVLRGFRLFDYNRDRKIQFHELRKILEQYCFPMSNVQFEKLWNSIDYSKMGLIDYMDFLGRLGVTVPNAGSK---------NIGQRT-------ERKKLQLGSSGMN-MDQLEVEYRRRLKEQHGLLKKACLVVDSKHSGLMPIKNFKAILDEFVIAVSDQEFSKLMERFSVKASHDIQWYGFLQKFVDPQSLS-NGQTLPIRPSHKANVVRGSHVEASVQDLIQLLYNHILSAYSSLRNAFLQIDINRKGKITIADFRRLVQGFKFELSEVQIKEIMVQLDPEHTGFITYQKFLDIFEEKESADGHKWLVSTHKYNKDTKPPILAWKTVEDLLHQKIVLRWKSFTAALKHYDSTGTGYINPTNLKKVLDKIAIPLSDEHYDSLLKRLSHKTADGKVNYLEFLAVMQIDVYPGDVEGVSAQIASGNEARLQMRQSQHEKAMADIETHASLRTNMMSLEEIIVRLRDRSSQTRQHIRDAFLQMD-DARKGFVSKAKFRLFLESHGIFLSDENFSQLTRELEF---GREGLDYMRFVKHF-EGRDSE----LNPSYLPMHNHKYNPVRGDEF-GMSAQVVENKLRSKIRENFTTLREAFHKMDSDGRGYLTKQDFRR-LLDQLMCLTNDAEFNKLCKKLGIDDDCKLSYRDFLGKFQEKDDLATGHKWLVSNHRYNE--LGDIKPKTAAEVHQLMAEKVHQNYKDIARAFCHIDYLGRGYITKREFKELLVRLNVTMNQEEFKKLWAYYDTANRNAITHDAFLKRVGVASAFSSGDGQGTSAKIIQNSAEYIAVHLEGQENRQENLVFNQAVLTVGLDADALFIILQKRIRDFFPTTYAAFRALDVKE--KGYLSQEDFRIAVHQMHLFVRDESFAELMRRIGLSQPTAQMTYEAFCLAFDEKFSGPRESQRPKTAGPM-LDGARGGQQQQQQQPQQRQDAKAFLKRLRASVVKDGEILEKVFRSMDTKQEGRIGASDFRRVVDGFCFKLTDAQFKEVVKGL-------LSQGDQVDYYRFLANFSQTQEAAERREWMEAANGGGGGAGGSAEVGESLSQQEVEARVSEFVSARPYLLAQAFAEADYAQLGVLAKTDFRDILFRLVMRMSNEQFDQLMTRVPTNEYGNVDYKEFLSRFASAEQPQQQQQQPTAGGDARPDSPISLTPPASADQAQQQQPQQPTLSLDTEAEAQLRRAMSQSWKSLFSRFKMLDQA 1335          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. TrEMBL
Match: K1R9E2 (EF-hand calcium-binding domain-containing protein 6 OS=Crassostrea gigas OX=29159 GN=CGI_10017631 PE=4 SV=1)

HSP 1 Score: 660.218 bits (1702), Expect = 0.000e+0
Identity = 454/1580 (28.73%), Postives = 782/1580 (49.49%), Query Frame = 3
Query:  201 EINPIVKSQLLKNHKEILKALQTFDIECSGLVTKGELRRVLDSYCLPMTTDQYEQFLSHNSINYSKGSINYKELIDKIYDKTSAVGHFKKNIKLPQLQRSATTICLQNKHFTLPTTRRSSGKISRSQLFXXXXXXXXXXXXXXXXWNYNAYTIDDIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETI----NIDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHKWLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKD-KKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNR-ESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGT-GFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQEKTVGSIRINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGF--------NQKLNNLDIQXXXXXXXXXXXXXTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWS--------NLKKNEF-----------------DNVNYGEFVKMXXXXXXXXXXXXXXXXXXXXXXXXXXNNIETDEMDTD----ESIRKNLERLLNRNWQSIFNKCKAIDQAINECQTAEGSIPIDDFVYILSEYDDSLSAENLA-AINLYKTCKNGRFIKYGDLIRSIVLSSR----GSLISNENVTEVQKKFLNV---GIKTTNSDNSKDYFPQLFKLRRQILENWKDLRKNFLQSDKKQNGAVSGNIFMTIMKTVCGQLSADLFYHLMKIYDQDGTGNFHYKRFIEDFLK 4784
            E+  I++ ++   H+ I++A  T+D+E +  VTKGE RRVL+S+C+P+T++Q+E  ++    N S G++ Y + ++K Y +                                P +  + G+ +  Q FS   +                  ID I  +L+ +IS+N   ++KA +LFD+N D  IQRH L++V+EN+C  LT+ QF KL  R+     G V+Y EF+  +G+  +NQ       ++  +     I   N+K   IF+    +   L     +Q+ + FR ++   +  L+K FL  D + +GF+ LE L  IL QF  PMS  +F Q+M++C  K +GKI W  FL KFQDPQ    NG TI ++++HK  PI+        DD+ +LL  H+ ++Y S + AFLQI+ T KG+I ++E   ++ +F F +  +Q   ++  LDP++   ISYH FL+LFE+ +    HKWLNS H+  E  K   ++ ETI+  + + I   W  V       D    GYIS+  +K I       + +D    +V+    +D     INY+E   +LNVD  P DL GLS+QI   ++ +   R +NHI +   + +  + R N M+ +E+I R+KDR+ Q+++   + +  ++    KG + K   R++L  FG  +T++QF +++E + F       ++++ F+  F D R +   D +  V      NH VN IRGD+   M   EVE  LR K+  NF +L  AF+KFD  + G + K++F+  L   + +I +++F+ LC++LG+ + +K++Y +FL RF++RD  V+GHKWL+S HR+N  ST+   +M+AE  +  L  K ++ + +++  F  +   G+ G +R R L+ LL ++ I M   E K+LW  YD + +  ++Y DFL  LG  E F   D+MG SA II NSH  ++ H  +Q  KHQ+   +QA+    ++ E +   ++  +R ++ D+  AF     +K   G  ++N++ K+LS LH F+ +++F +L  ++G       L+YE+F   F+D    +  ++ +  +RI            EE G L+  +  + + + I +Q   + K F   D   S  +S+ +FR +L  F   LT+ Q+   ++ L          D  ++Y  F++ +         + L+ L  Q    +           ++QE + E++        N FK  DYA +  ISK DFR+++++ +    D  F+K W+        NL   EF                   +N     +M     ++    +S       +     +  ++  M T     ES    ++  + RNW+ I   C+  D+         G+I + +   IL      +  E     +  Y   ++G F  Y D +R  +L+ +    G+L S   V + +   L+      + +    S  ++  + +LR  +++NWK++R+ F   D+   GA+    F  +++     L  D F+HL+  YD++  G   Y  FI+ +L+
Sbjct:  302 EVEAILREKVRAKHQNIMQAFMTYDVEHNLGVTKGEFRRVLESFCVPLTSEQFEAVVAKVEKN-SNGTVRYPDFMEKFYGQ--------------------------------PPSSVAGGQWAGYQKFSPPPAA-------------REINIDMIEKMLKDKISQNFKAVVKALQLFDYNRDGKIQRHELRRVIENYCFKLTDDQFQKLWLRYDFHHTGLVSYKEFLSRLGVAANNQNRPPVDGAKGALLWPQQIPVSNSK---IFKQRKDDEEALQRLNFDQIELEFRNRMRKNYLNLKKIFLTFDRHLDGFINLEDLKSILCQFTVPMSDQLFRQMMERCGVKGSGKISWEQFLDKFQDPQGGG-NGQTIPMRNNHKFFPIREGIETVATDDIWKLLYKHVQSHYPSLKQAFLQIDATRKGRITRTELRNVIEKFAFRLDNEQFKQLMLKLDPYHTNSISYHDFLKLFEETDTPEGHKWLNSVHRFNETPKPAIMAWETIEEILREKITEYWKPVSAAIMAADSKGDGYISIPKMKSIIDNCVLPVSEDHFKSMVS--RCQDCSNNMINYVEFLEMLNVDVRPGDLVGLSSQIQSGSEEREAIRVKNHIARATRVNRRAQNRTNTMTADEVITRLKDRMSQHKVQIRQAFLSFD-KSGKGRVTKKNFREVLGSFGVLMTDDQFKELTERVGF---MNGYMNYSDFVMAFEDPRAQGPGDEILRV-----GNHRVNPIRGDE-WGMTADEVEAKLRSKLRENFANLRAAFYKFDDDHNGLINKANFRRILDSFMCIISDNEFEELCKRLGITKSTKISYEEFLQRFEVRD-TVEGHKWLNSVHRYN--STHPTQEMTAESAHEALKLKCHRQWKDLAQAFTQIDAIGSKGVLRRRELRDLLFKMVIPMGPEEFKRLWTFYDEDGKGYINYQDFLDKLGASE-FAPADMMGTSADIIDNSHKTIMVHNEDQLAKHQRMTKHQAIKVAFMNAEQVERQLRDKIRDSFKDTYEAFTKYDTQK--KGSLSVNEIQKVLSDLHFFMDDEQFFKLMDKIGLGTKGSRLNYEEFLRAFEDGRK-EHYQRPLPEVRI------------EECGALSPQEAETKLRRVIENQGDVLGKAFASFDKTQSNLISLADFRRVLDIFAFKLTEPQWRHLQSRLQL-------VDKSVNYVLFLENYAMSDQEDAEKWLSALQKQMRDQSQTLM----PIDEVQERLREAVHAHFYTLANLFKEVDYADIGVISKEDFRDVMDKNVMRFTDEQFDKVWASLPTNDFGNLDYKEFLRRYSSNMEIPPTHRPASTINGRPGTQMSGRRLQSRAMSRSITQMEFGRPGSRLSRAQS-RMSTPLINAESAEARIKNRIFRNWKEIQRSCRNCDR------NNTGTIQVQELKDILVRNGIDMPDEEFYDLMTKYDLREDGSFA-YVDFLRHFILNLKPQDDGNLFSRRRVPQGRVSSLSSVSEDTQVSAGHTSTHFYDAMIRLRECVVQNWKEMRRLFRSMDRDNQGAIPSLDFRYVLRQFSVNLEEDEFFHLLSYYDKNLNGMIAYNDFIKAYLQ 1781          

HSP 2 Score: 116.701 bits (291), Expect = 3.615e-22
Identity = 129/569 (22.67%), Postives = 245/569 (43.06%), Query Frame = 3
Query: 2415 NRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIR-DDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEK--------FGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQEKTVGSIRINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGFNQK--------LNNLDIQXXXXXXXXXXXXXTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLKKNEFDNVNYGEFVKM 4070
            N +++  EVE +LR+K+     ++M AF  +D  +   + K +F+  L    + + ++QF+ +  K+       + Y DF+ +F  +    V G +W     +F+ P   A  +++ + +  +L +KI Q F  +         +  G I+   L+ ++      ++  + +KLW RYD ++   + Y +FL  LG+              G L+ P    + NS           +   Q+  D +A+    L+ + +    +  +R  Y +    F  +   + L GF  + DL  +L Q  + +++  F Q+  R G +G    +S+E+F   FQD     G  +T+  +R N     P + GIE    + +  I  ++ K +   Y  +++ FL +D    G ++  E RN++  F   L ++QF +    L  Y   S      I Y  F+K F +         LN++       N     + M ++ I+E + E I    K    +  + D     +IS    + II+  +  V + HF+   S  +    + +NY EF++M
Sbjct:  295 NASLSSIEVEAILREKVRAKHQNIMQAFMTYDVEHNLGVTKGEFRRVLESFCVPLTSEQFEAVVAKVEKNSNGTVRYPDFMEKFYGQPPSSVAGGQWA-GYQKFSPPP--AAREINIDMIEKMLKDKISQNFKAVVKALQLFDYNRDGKIQRHELRRVIENYCFKLTDDQFQKLWLRYDFHHTGLVSYKEFLSRLGVAANNQNRPPVDGAKGALLWPQQIPVSNS-----------KIFKQRKDDEEAL--QRLNFDQIELEFRNRMRKNYLNLKKIF--LTFDRHLDGFINLEDLKSILCQFTVPMSDQLFRQMMERCGVKG-SGKISWEQFLDKFQDPQG-GGNGQTI-PMRNNHKF-FPIREGIE---TVATDDIWKLLYKHVQSHYPSLKQAFLQIDATRKGRITRTELRNVIEKFAFRLDNEQFKQLMLKLDPYHTNS------ISYHDFLKLFEETDTPEGHKWLNSV----HRFNETPKPAIMAWETIEEILREKITEYWKPVSAAIMAADSKGDGYISIPKMKSIIDNCVLPVSEDHFKSMVSRCQDCSNNMINYVEFLEM 828          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Cavefish
Match: ENSAMXT00000042990.1 (EF-hand calcium-binding domain-containing protein 6-like [Source:NCBI gene;Acc:111195861])

HSP 1 Score: 95.5153 bits (236), Expect = 9.172e-21
Identity = 66/269 (24.54%), Postives = 128/269 (47.58%), Query Frame = 3
Query:  180 DPKLQISEINPIVKSQLLKNHKEILKALQTFDIECSGLVTKGELRRVLDSYCLPMTTDQYEQFLSHNSINYSKGSINYKELIDKIYDKTSAVGHFKKNIKLPQLQRSATTICLQNKHFTLPTTRRSSGKISRSQLFXXXXXXXXXXXXXXXXWNYNAYTIDDIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETINIDTRN-TKGSR 983
            D  L ++ I  ++  ++     ++  A + FD E    VTKGE RRV++ + +P+T  Q+   L+      + G+I Y E + +    +SA      +I++P                       S+G                         ++ ++ + ++   L+ +I  N   I++AF LFD+N D  IQ+H L++V+E++C PL++Q+F +L + +S S +  ++Y EF++ +G+  +N   I   +++  +N D  N +KG R
Sbjct:   57 DENLSLAHIESMLSQKVRIKKDDLKAAFRGFDQERRNTVTKGEFRRVIEGFLMPLTQSQFNALLAKIP-KTANGAIPYMEFLRQYCRVSSA------SIRIP-----------------------SAG-------------------------SHRSWPLGELQCHLKDKIGGNLKNILRAFCLFDYNRDGRIQKHELRRVLESYCFPLSQQEFHRLWSHYSPSNSHTISYKEFLERLGVDCENYRKIAPDSAKLALNWDAVNQSKGYR 270          

HSP 2 Score: 62.7734 bits (151), Expect = 7.849e-10
Identity = 48/189 (25.40%), Postives = 90/189 (47.62%), Query Frame = 3
Query: 3501 NLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGFNQKLNNLDIQXXXXXXXXXXXXXTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLKKNEFDNVNYGEFVK 4067
            NL+   I S++ +++  +  +++  F   D E    V+  EFR ++ GF + LT  QFN    +L   I K+AN    I Y  F++ +  ++++  I+  SA    +       ++Q H+ + I    K  L +F   DY     I K + R ++E + F +    F + WS+   +    ++Y EF++
Sbjct:   59 NLSLAHIESMLSQKVRIKKDDLKAAFRGFDQERRNTVTKGEFRRVIEGFLMPLTQSQFN----ALLAKIPKTAN--GAIPYMEFLRQYC-RVSSASIRIPSAGSHRSW---PLGELQCHLKDKIGGNLKNILRAFCLFDYNRDGRIQKHELRRVLESYCFPLSQQEFHRLWSHYSPSNSHTISYKEFLE 237          

HSP 3 Score: 60.077 bits (144), Expect = 6.245e-9
Identity = 45/196 (22.96%), Postives = 81/196 (41.33%), Query Frame = 3
Query: 2415 NRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGL 3002
            + N++   +E +L QK+     DL  AF  FD+  +  + K +F+  + G L+ +   QF+ L  K+       + Y +FL ++              S      PS  +       ++   L +KI      I   F     +  G I+   L+ +L      +S+ E  +LW  Y  +N + + Y +FL  LG+
Sbjct:   57 DENLSLAHIESMLSQKVRIKKDDLKAAFRGFDQERRNTVTKGEFRRVIEGFLMPLTQSQFNALLAKIPKTANGAIPYMEFLRQY-----------CRVSSASIRIPSAGSHRSWPLGELQCHLKDKIGGNLKNILRAFCLFDYNRDGRIQKHELRRVLESYCFPLSQQEFHRLWSHYSPSNSHTISYKEFLERLGV 241          

HSP 4 Score: 52.373 bits (124), Expect = 2.085e-6
Identity = 39/170 (22.94%), Postives = 71/170 (41.76%), Query Frame = 3
Query: 1086 LRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQ 1595
            L+  F   D      VT     +++  F  P++ + FN ++ K    A G I ++ FL+++       ++ ++I I       P  G +    + +L   L + I  N  +   AF   +    G+I K E  ++L  + F +S  +   +     P N   ISY  FL+
Sbjct:   80 LKAAFRGFDQERRNTVTKGEFRRVIEGFLMPLTQSQFNALLAKIPKTANGAIPYMEFLRQYC-----RVSSASIRI-------PSAGSHRSWPLGELQCHLKDKIGGNLKNILRAFCLFDYNRDGRIQKHELRRVLESYCFPLSQQEFHRLWSHYSPSNSHTISYKEFLE 237          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Cavefish
Match: ENSAMXT00000045911.1 (pep primary_assembly:Astyanax_mexicanus-2.0:24:36828479:36830332:-1 gene:ENSAMXG00000039191.1 transcript:ENSAMXT00000045911.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.447 bits (119), Expect = 5.427e-6
Identity = 62/260 (23.85%), Postives = 109/260 (41.92%), Query Frame = 3
Query:  861 NVNYMEFMKGMGIPIDNQGTIQTKNSEETINID--------TRNTKGSRIFEAALIENG--LLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLE-ILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQ 1607
            N+NY EF+K     +  +       + E + +          R    S I E + + +G  L  S+ +E+ L   R KI   +  +++     D    G + +E  L  ++     P   + F Q+ +K   K  G++ +  FLQ F       L  +        + +  +   S+   D LL L S  I   + S + AF+  ++   GKIP  EF K+L +    +S +    +  F D +  G ISY+ FL +F++
Sbjct:    8 NLNYREFLKKFSGELIEKEKPAAPPTPEHLGLSESSPAVLLQRPKTASCIPERSKVNSGPELSSSSAVERRL---RFKIRSCWREIQRRCKEADTQRTGGIEIEAFLGNVVKMVTTP---SQFEQLSEKYNLKNKGRLSYPEFLQNF----VLMLKPNAPTFTERRRLHLPKTPVSRQCTDALLRLCS-PIQLRWKSIKRAFVFYDKERTGKIPLQEFRKVLRQHNVNLSEEDFFHLASFFDKNISGNISYNEFLCIFQK 256          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004536.1 (pep scaffold:Pmarinus_7.0:GL477109:94389:131012:-1 gene:ENSPMAG00000004110.1 transcript:ENSPMAT00000004536.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 467.233 bits (1201), Expect = 6.061e-139
Identity = 383/1588 (24.12%), Postives = 682/1588 (42.95%), Query Frame = 3
Query:  183 PKLQISEINPIVKSQLLKNHKEILKALQTFDIECSGLVTKGELRRVLDSYCLPMTTDQYEQFLSHNSINYSKGSINYKELIDKIYDKTSAVGHFKKNIKLPQLQRSATTICLQNKHFTLPTTRRSSGKISRSQLFXXXXXXXXXXXXXXXXWNYNAYTIDDIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETINI----------DTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHKWLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKG-RINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEAR--LNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGH-KWLDSKHR---FNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLW-KRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQEKTVGSIRINQDLENPSK-IGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGF---NQKLNNLDIQXXXXXXXXXX------XXXTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLKKNEFDNV---NYGEFVKMXXXXXXXXXXXXXXXXXXXXXXXXXXNNIETDEMDTD---------------------ESIRKNLERLLNRNWQSIFNKCKAIDQAINECQTAEGSIPIDDFVYILSEYDDSLSAENLAAINLYKTCKNGRFIKYGDLIRSIVLSSRG---SLISNENVTEVQKKFLNVGIKTTNSDNSKDYFPQLFKLRRQILENWKDLRKNFLQSDKKQNGAVSGNIFMTIMKTVCGQLSADLFYHLMKIYDQDGTGNFHYKRFIEDFL 4781
            P L  SE+  +V+  + +  +++++A +  D   +G V+ GELRRVLD + LP+T  Q+    S      + G+I Y + ++          HF     L Q  R +T    Q    T P  R                               N  T  D++  L+ ++ R+  G+++ F+LFD+N D  +QRH L+ V+E+    L+E QF KL AR    Q G V Y EF++ +G+  ++Q   +     +T+ +           T+ +  SR +E   I       N +     + R   E+ +  L++ F   D +  G + +E    +L  F  P++     +++ +   KATGK+ W  FL KF +PQS   NG T+ ++S H+ NP +G +   +  ++L  L  HI   Y S ++AFL ++   +G++ + E  +++  F F +       ++  LDP + G++ Y  FL LFE +E L AHKWLNS H+V   +    L+ +  +  + D +  +W +V   F+  D +  G+I+ ++L+ I ++    L D+  ++L      +   G RI + E    L VD  P D  G+S+++   ++A+  +R  +   ++E IE  GEAR     +   E++VR++D + Q     H+ + +++    +G ++    R++L + G  + ++QF+ + + L F   S   I ++ F+A F D R            L   NH V +     +R  +C      L  K+   + DL  AF+K D    G +   D +  L      + + +F  L   LG+ E+S+L+Y DFL  F       +G  +WL++  R     DPS     +M+ E  +  L  +  + + ++S  F     +G   ++   L+ LL R  + ++  +   LW +RYD +    +   + L  L  + +   G   GPSA I + +   L      Q  +  +    QA  G   ++E L + +K   R  YSD   AF      K   GF T +DL  +L + +  +  ++F QL  ++G       LSY  F              + V   R ++    PSK  G      L+     + + +++    + ++K F   D    G V   EFR +L  FCL L   QF      L          D  +D++ F++ F   + K    D Q   A  A           ++   +   + + +  R      +    D   +  +++  FR+++ R    + D  FE+ W+ L  +E D +   +Y EF+K   + +       +  +   + I +   ++ T                           E++   L   ++R WQ I  +C+  D       TA G I  +D + +L  +D  LS + LA +       +   + Y   +R +VL+ R     L+  + +   Q  F   G    ++     +   +  LR Q+L NW+ +R+ F   D   +G +S   F  ++K     L+ D F+ ++  YD        Y  F+  FL
Sbjct:   59 PALSASEVAELVRHGVEERTEQLVRAFRALDPGRAGTVSHGELRRVLDLFVLPLTDPQFGALFSMVPAGRN-GNIPYLQFLE----------HF-----LGQPTRPSTASSRQKS--TPPAGR-----------------------------GINEET--DLL--LRKKLGRDLKGVVRTFRLFDYNGDGRVQRHELRGVLESHGARLSESQFSKLWARHDVHQGGTVAYQEFLESLGLSQESQWHPEP----DTVQLCMLHARHRWEHTQPSCHSRPYEIYEISVKGYCLNIVSTESAVQRIVCEN-YGNLQRAFRAFDGSGSGTLAVEDFVSVLRSFTLPLAPEAMLRVLTQLGIKATGKVPWELFLAKFPNPQSIG-NGQTLPMRSSHRVNPFRGADESTSASEVLARLRKHILECYPSLKEAFLALDINRQGRVTRQELRRLVEGFGFRMGDGHFRELMLLLDPGHSGFVDYTDFLCLFEPRETLDAHKWLNSTHRVNGHKTTDILTWKAAEEILRDKLTERWKDVCEAFDSCDQDADGFITQDNLRAILRRFGPSLSDEHFNKLCT--GCEQGPGFRILFSEFLLRLGVDPRPGDFAGVSSRLHSESNAREVKRQADLSARLELIE--GEARKLTGALPLREVLVRLRDHVAQRDTTLHQSFARHD-RRGEGRVSHFDFRQILQECGMIMEDDQFNALLQRLGFTNGS---ITYSDFVACFDDRRIHGPGEQ----LLLSPNHRVAEASRQHSRAEDCHAA---LPDKLRQVYTDLRSAFNKADGDRDGAVTAGDLRRLLETLHFSLTDGEFGRLLGMLGLNERSRLSYGDFLQTFD--PPTQEGEPRWLEAGARIMEIKDPS-----EMACEQAHQYLVSRARKSWKDVSQAFRDYDENGDRVVQKSELRTLLFRYMLPLTSHDFDSLWARRYDPDGHGVISEQE-LAQLLDVARPPTGVDKGPSARIAEQNQATLATLAEGQRERRCELAGQQARRGAFYNLEQLAQEIKDKFRDKYSDFGAAFARADRDK--DGFVTEDDLRHMLCEHNYSLDREQFEQLLGKLGIPTEGSRLSYADFL-------------RAVDDGRASRYGVRPSKPCGGNATQRLSPEGALAFLREKVPSLLAVLQKAFSAFDKSQRGLVKEEEFRRVLDNFCLKLDGPQFQHLLKRLKR------GGDGTVDWQDFLEAFSLLSDKTEGADWQREVARAALAGHRGAGDHALSAGGVLRRLRDVVSARFYAVARALVCADLPGVGRLTREQFRQVVHRHFLRLSDKQFEELWAQLPVDECDKLDYRDYREFLKRFCDGTALPAAAFTSSAPPALGIYKPPQSLNTGHRPASVAGSVRGGTARAVRSTPLVDCEALESRLRERVSRRWQEILRECRLKD------PTASGEIGANDLLGVLRTFDVWLSEDELAGLASKFAAHSTGHVAYRAFLRHLVLTLRPRQHGLLQRQRLQ--QPSFTPGGTAPNDA-----FLEAMLHLREQVLPNWRPMRRAFRAVDPSASGFLSAPDFRQVLKQFAINLTEDEFFQILNYYDGQLHNRVPYNAFLRTFL 1532          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004547.1 (pep scaffold:Pmarinus_7.0:GL477109:94389:129511:-1 gene:ENSPMAG00000004110.1 transcript:ENSPMAT00000004547.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 401.364 bits (1030), Expect = 2.239e-116
Identity = 360/1598 (22.53%), Postives = 668/1598 (41.80%), Query Frame = 3
Query:  183 PKLQISEINPIVKSQLLKNHKEILKALQTFDIECSGLVTKGELRRVLDSYCLPMTTDQYEQFLSHNSINYSKGSINYKELIDKIYDKTSAVGHFKKNIKLPQLQRSATTICLQNKHFTLPTTRRSSGKISRSQLFXXXXXXXXXXXXXXXXWNYNAYTIDDIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETINIDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRK------------KIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHKWLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEAR--LNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGH-KWLDSKHR---FNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLW-KRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQEKTVGSIRINQDLENPSK-IGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGF---NQKLNNLDIQXXXXXXXXXX------XXXTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLKKNEFDNV---NYGEFVKMXXXXXXXXXXXXXXXXXXXXXXXXXXNNIETD--------------EMDTDESIRKNLERLLNRNWQSIFNKCKAID------------QAINECQ----TAEGSIPIDDFVYILSEYDDSLSAENLAAINLYKTCKNGRFIKYGDLIRSIVLSSRG---SLISNENVTEVQKKFLNVGIKTTNSDNSKDYFPQLFKLRRQILENWKDLRKNFLQSDKKQNGAVSGNIFMTIMKTVCGQLSADLFYHLMKIYDQDGTGNFHYKRFIEDFL 4781
            P L  SE+  +V+  + +  +++++A +  D   +G V+ GELRRVLD + LP+T  Q+   +       + G+I Y + ++          HF     L Q  R +T    Q    T P  R                               N  T  D++  L+ ++ R+  G+++ F+LFD+N D  +QRH L+ V+E+    L+E QF KL AR    Q G V Y EF++ +G+  ++Q   +    +  +       + ++ F   + ++  LG   L+  + I ++            ++ + +  L++ F   D +  G + +E    +L  F  P++     +++ +   KATGK+ W  FL KF +PQS   NG T+ ++S H+ NP +G +   +  ++L  L  HI   Y S ++AFL ++   +G++ + E  +++  F F +       ++  LDP + G++ Y  FL LFE +E L       + HK  +      L+ +  +  + D +  +W +V   F+  D +  G+I+ ++L+ I ++    L D+  ++L      +    RI + E    L VD  P D  G+S+++   ++A+  +R  +   ++E IE  GEAR     +   E++VR++D + Q     H+ + +++    +G ++    R++L + G  + ++QF+ + + L F   S   I ++ F+A F D R            L   NH V +     +R  +C      L  K+   + DL  AF+K D    G +   D +  L      + + +F  L   LG+ E+S+L+Y DFL  F       +G  +WL++  R     DPS     +M+ E  +  L  +  + + ++S  F     +G   ++   L+ LL R  + ++  +   LW +RYD +    +   +    L         D+   S  ++Q   N +  +++   TK Q  +    +      +       +   R  YSD   AF      K   GF T +DL  +L + +  +  ++F QL  ++G       LSY  F              + V   R ++    PSK  G      L+     + + +++    + ++K F   D    G V   EFR +L  FCL L   QF      L          D  +D++ F++ F   + K    D Q   A  A           ++   +   + + +  R      +    D   +  +++  FR+++ R    + D  FE+ W+ L  +E D +   +Y EF+K   + +       +  +          +  +T                  T  S+     R +     +    C+A++            + + EC+    TA G I  +D + +L  +D  LS + LA +       +   + Y   +R +VL+ R     L+  + +   Q  F   G    ++     +   +  LR Q+L NW+ +R+ F   D   +G +S   F  ++K     L+ D F+ ++  YD        Y  F+  FL
Sbjct:    1 PALSASEVAELVRHGVEERTEQLVRAFRALDPGRAGTVSHGELRRVLDLFVLPLTDPQFGACVIQVPAGRN-GNIPYLQFLE----------HF-----LGQPTRPSTASSRQKS--TPPAGR-----------------------------GINEET--DLL--LRKKLGRDLKGVVRTFRLFDYNGDGRVQRHELRGVLESHGARLSESQFSKLWARHDVHQGGTVAYQEFLESLGLSQESQWHPEPDTVQLCMLHARHRWEHTQPFN--VKDHTRLG---LQSSISIKKQHKVSIHQNSTVLQVCENYGNLQRAFRAFDGSGSGTLAVEDFVSVLRSFTLPLAPEAMLRVLTQLGIKATGKVPWELFLAKFPNPQSIG-NGQTLPMRSSHRVNPFRGADESTSASEVLARLRKHILECYPSLKEAFLALDINRQGRVTRQELRRLVEGFGFRMGDGHFRELMLLLDPGHSGFVDYTDFLCLFEPRETLVGLTHRVNGHKTTD-----ILTWKAAEEILRDKLTERWKDVCEAFDSCDQDADGFITQDNLRAILRRFGPSLSDEHFNKLCTGCE-QGPGFRILFSEFLLRLGVDPRPGDFAGVSSRLHSESNAREVKRQADLSARLELIE--GEARKLTGALPLREVLVRLRDHVAQRDTTLHQSFARHD-RRGEGRVSHFDFRQILQECGMIMEDDQFNALLQRLGFTNGS---ITYSDFVACFDDRRIHGPGEQ----LLLSPNHRVAEASRQHSRAEDCHAA---LPDKLRQVYTDLRSAFNKADGDRDGAVTAGDLRRLLETLHFSLTDGEFGRLLGMLGLNERSRLSYGDFLQTFD--PPTQEGEPRWLEAGARIMEIKDPS-----EMACEQAHQYLVSRARKSWKDVSQAFRDYDENGDRVVQKSELRTLLFRYMLPLTSHDFDSLWARRYDPDGHGVISEQELAQLL---------DVQQSSTCLLQC--NGIYCNVMKGCTKKQCPLIMGRIEEMSFSLSLSSSFHRDKFRDKYSDFGAAFARADRDK--DGFVTEDDLRHMLCEHNYSLDREQFEQLLGKLGIPTEGSRLSYADFL-------------RAVDDGRASRYGVRPSKPCGGNATQRLSPEGALAFLREKVPSLLAVLQKAFSAFDKSQRGLVKEEEFRRVLDNFCLKLDGPQFQHLLKRLKR------GGDGTVDWQDFLEAFSLLSDKTEGADWQREVARAALAGHRGAGDHALSAGGVLRRLRDVVSARFYAVARALVCADLPGVGRLTREQFRQVVHRHFLRLSDKQFEELWAQLPVDECDKLDYRDYREFLKRFCDGTALPAAAFTSSAPPDNGATAMKSRPKTTASCLLTRSEHTHGHAQSTHPSLSGGTARAVR---STPLVDCEALESRLRERVSRRWQEILRECRLKDPTASGEIGANDLLGVLRTFDVWLSEDELAGLASKFAAHSTGHVAYRAFLRHLVLTLRPRQHGLLQRQRLQ--QPSFTPGGTAPNDA-----FLEAMLHLREQVLPNWRPMRRAFRAVDPSASGFLSAPDFRQVLKQFAINLTEDEFFQILNYYDGQLHNRVPYNAFLRTFL 1473          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004557.1 (pep scaffold:Pmarinus_7.0:GL477109:94389:108111:-1 gene:ENSPMAG00000004110.1 transcript:ENSPMAT00000004557.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.087 bits (292), Expect = 7.736e-27
Identity = 118/528 (22.35%), Postives = 217/528 (41.10%), Query Frame = 3
Query: 2160 NDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTNAVPD--MSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAII--------------QNSHNALVDHLVNQETKHQ-QSVDNQAVLGTHLHVEHL----FEMVKRHL--RVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQEKTVGSIRINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQF 3674
             DK G + +  LR ML +  Y+L  EQF ++   L  PT   SR+ +  FL    D R S   +                  G+  + ++ +     LR+K+ +    L  AF  FD+S +G + + +F+  L    + ++  QF  L ++L  G    + + DFL  F +  D  +G  W     R          D  +SA  V   L + +   F+ ++   +     G G +     + ++ R  + +S  + ++LW +   +  +KLDY D+      L++F C     P+AA                Q++H +L     +  T H+  SV      GT   V        E ++  L  RV+     +  +      T SG    NDL  +L    ++++ D+   LA++         ++Y  F       L +  + +  G ++  Q L+ PS      A N    +    + ++++  +  + + F  +DP  SG++S  +FR +L  F ++LT+ +F
Sbjct:  126 RDKDGFVTEDDLRHMLCEHNYSLDREQFEQLLGKLGIPTEG-SRLSYADFLRAVDDGRASRYGVRPS-----------KPCGGNATQRLSPEGALAFLREKVPSLLAVLQKAFSAFDKSQRGLVKEEEFRRVLDNFCLKLDGPQFQHLLKRLKRGGDGTVDWQDFLEAFSLLSDKTEGADWQREVARAALAGHRGAGDHALSAGGVLRRLRDVVSARFYAVARALVCADLPGVGRLTREQFRQVVHRHFLRLSDKQFEELWAQLPVDECDKLDYRDYRE---FLKRF-CDGTALPAAAFTSSAPPGIEHTHGHAQSTHPSLSFPPQSLNTGHRPASVAGSVRGGTARAVRSTPLVDCEALESRLRERVSRRWQEILRECRLKDPTASGEIGANDLLGVLRTFDVWLSEDELAGLASKFAAHS-TGHVAYRAFL----RHLVLTLRPRQHGLLQ-RQRLQQPSFTPGGTAPNDAFLEAMLHLREQVLPNWRPMRRAFRAVDPSASGFLSAPDFRQVLKQFAINLTEDEF 631          

HSP 2 Score: 115.161 bits (287), Expect = 3.134e-26
Identity = 136/682 (19.94%), Postives = 255/682 (37.39%), Query Frame = 3
Query: 2874 LQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQEKTVGSIRINQDLENPSK-IGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGFN---QKLNNLDIQXXXXXXXXXXX------XXTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLKKNEFDNV---NYGEFVK-------MXXXXXXXXXXXXXXXXXXXXXXXXXXNNIETDEMDTDE-------SIRKNLERLLNRNWQSIFNKCKAID------------QAINECQ----TAEGSIPIDDFVYILSEYDDSLSAENLAAINLYKTCKNGRFIKYGDLIRSIVLSSRG---SLISNENVTEVQKKFLNVGIKTTNSDNSKDYFPQLFKLRRQILENWKDLRKNFLQSDKKQNGAVSGNIFMTIMKTVCGQLSADLFYHLMKIYDQDGTGNFHYKRFIEDFL 4781
            L+ LL R  + ++  +   LW RYD +    +   +    L         D+   S  ++Q   N +  +++   TK Q  +    +      +       +   R  YSD   AF      K   GF T +DL  +L + +  +  ++F QL  ++G       LSY  F              + V   R ++    PSK  G      L+     + + +++    + ++K F   D    G V   EFR +L  FCL L   QF      L          D  +D++ F++ F+    K    D Q   A  A           ++   +   + + +  R      +    D   +  +++  FR+++ R    + D  FE+ W+ L  +E D +   +Y EF+K       + + +  +      + +    +    + +     ++T         S+R    R +     +    C+A++            + + EC+    TA G I  +D + +L  +D  LS + LA +       +   + Y   +R +VL+ R     L+  + +   Q  F   G    ++     +   +  LR Q+L NW+ +R+ F   D   +G +S   F  ++K     L+ D F+ ++  YD        Y  F+  FL
Sbjct:   17 LRTLLFRYMLPLTSHDFDSLWARYDPDGHGVISEQELAQLL---------DVQQSSTCLLQC--NGIYCNVMKGCTKKQCPLIMGRIEEMSFSLSLSSSFHRDKFRDKYSDFGAAFARADRDK--DGFVTEDDLRHMLCEHNYSLDREQFEQLLGKLGIPTEGSRLSYADFL-------------RAVDDGRASRYGVRPSKPCGGNATQRLSPEGALAFLREKVPSLLAVLQKAFSAFDKSQRGLVKEEEFRRVLDNFCLKLDGPQFQHLLKRLKR------GGDGTVDWQDFLEAFSLLSDKTEGADWQREVARAALAGHRGAGDHALSAGGVLRRLRDVVSARFYAVARALVCADLPGVGRLTREQFRQVVHRHFLRLSDKQFEELWAQLPVDECDKLDYRDYREFLKRFCDGTALPAAAFTSSAPPGIEHTHGHAQSTHPSLSFPPQSLNTGHRPASVAGSVRGGTARAVR---STPLVDCEALESRLRERVSRRWQEILRECRLKDPTASGEIGANDLLGVLRTFDVWLSEDELAGLASKFAAHSTGHVAYRAFLRHLVLTLRPRQHGLLQRQRLQ--QPSFTPGGTAPNDA-----FLEAMLHLREQVLPNWRPMRRAFRAVDPSASGFLSAPDFRQVLKQFAINLTEDEFFQILNYYDGQLHNRVPYNAFLRTFL 656          

HSP 3 Score: 98.2117 bits (243), Expect = 6.264e-21
Identity = 133/690 (19.28%), Postives = 262/690 (37.97%), Query Frame = 3
Query:  723 FKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETINIDTRNTKGSRIFEAALIENGLLGSNE-----LEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATG-KIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFE-QKENLSAHKWLNSNHKVV----EPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLN-------------VDTSPSDLEGLSTQIAESNDA-QLKERHENHIEKMESIE---KLGEARLNLMSP----EELIVRIKDRIVQNRLNYHELYKKYECND--KKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLA-IFADNRESSNDL-----MTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQI 2672
            F+ +D N D  +Q+  L+ ++  +  PLT   FD L AR+    +G ++  E  + + +   +   +Q         I     KG    +  LI    +G  E     L       R K  D++S     F   D + +GFVT + L  +L +  + +    F Q++ K      G ++ +  FL+   D ++     S   ++    C        + + +  L  L   + +  +  + AF   +++ +G + + EF ++L+ F   +   Q   +LK L    +G + +  FL+ F    +      W     +          D  LS+  +   + D +  ++  V       DL   G ++ E  +++  + F  L D   + L A L + D+  +++Y +    L                ++P  +E        ++ +     +  N   +  S+    + G AR    +P    E L  R+++R+ +    + E+ ++    D    G I  + L  +L  F   L+ ++ + ++    F   S   + +  FL  +    R   + L     +    F P          G    N    E    LR++++ N+  +  AF   D S  G+L   DF+  L    I +  D+F  +         +++ YN FL  F +
Sbjct:    1 FRDYDENGDRVVQKSELRTLLFRYMLPLTSHDFDSLWARYDPDGHGVISEQELAQLLDVQQSSTCLLQCN------GIYCNVMKGCTKKQCPLI----MGRIEEMSFSLSLSSSFHRDKFRDKYSDFGAAFARADRDKDGFVTEDDLRHMLCEHNYSLDREQFEQLLGKLGIPTEGSRLSYADFLRAVDDGRA-----SRYGVRPSKPCG--GNATQRLSPEGALAFLREKVPSLLAVLQKAFSAFDKSQRGLVKEEEFRRVLDNFCLKLDGPQFQHLLKRLKRGGDGTVDWQDFLEAFSLLSDKTEGADWQREVARAALAGHRGAGDHALSAGGVLRRLRDVVSARFYAVARALVCADLPGVGRLTREQFRQVVHRHFLRLSDKQFEELWAQLPV-DECDKLDYRDYREFLKRFCDGTALPAAAFTSSAPPGIEHTHGHAQSTHPSLSFPPQSLNTGHRPASVAGSVRGGTARAVRSTPLVDCEALESRLRERVSR---RWQEILRECRLKDPTASGEIGANDLLGVLRTFDVWLSEDELAGLAS--KFAAHSTGHVAYRAFLRHLVLTLRPRQHGLLQRQRLQQPSFTP----------GGTAPNDAFLEAMLHLREQVLPNWRPMRRAFRAVDPSASGFLSAPDFRQVLKQFAINLTEDEFFQILNYYDGQLHNRVPYNAFLRTFLV 657          

HSP 4 Score: 84.3445 bits (207), Expect = 1.038e-16
Identity = 138/695 (19.86%), Postives = 260/695 (37.41%), Query Frame = 3
Query: 2178 INKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGF-------LAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRN--MNCQEVEDLL----------RQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVG-EKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDP-STNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLL-EKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTHLHVEHLFEMVKRHLR--VAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPD--DSLSYEKFCCIFQDSLNI----------DGQEKTVGSIR------------INQDLENPSKIGIEEAGNLNSTQ---------IASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGF--------NQKLNNLDIQXXXXXXXXXXXXXTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLKKNEFDNVNYGEFVK 4067
            + KS+LR +L ++   LT+  F  +           +R D +G        LA   D ++SS       C L  +  + N ++G   +   +    +E++           R K  + + D   AF + DR   G++ + D ++ L  +   ++ +QF+ L  KLG+  E S+L+Y DFL         VD  +      R + P   NA   +S E     L EK+      +   F A   S  G ++    + +L    + +   + + L KR        +D+ DFL    LL +K    D     A      H    DH ++                           V R LR  V+    A+A   V       G  T     +++ +  + +++ +F +L A++  +  D  D   Y +F   F D   +           G E T G  +            +N      S  G    G   + +         + S + +R+  ++ EI +   + DP  SG +  N+   +L  F + L++ +     +        +A++   + YR F++          +  L    +Q  S  P   A N  + +   H+ E +    +    +F++ D ++  F+S  DFR+++++F   + +  F +  +       + V Y  F++
Sbjct:   12 VQKSELRTLLFRYMLPLTSHDFDSLW----------ARYDPDGHGVISEQELAQLLDVQQSST------CLLQCNGIYCNVMKGCTKKQCPLIMGRIEEMSFSLSLSSSFHRDKFRDKYSDFGAAFARADRDKDGFVTEDDLRHMLCEHNYSLDREQFEQLLGKLGIPTEGSRLSYADFLR-------AVDDGRASRYGVRPSKPCGGNATQRLSPEGALAFLREKVPSLLAVLQKAFSAFDKSQRGLVKEEEFRRVLDNFCLKLDGPQFQHLLKRLKRGGDGTVDWQDFLEAFSLLSDKTEGADWQREVARAALAGHRGAGDHALSAGG------------------------VLRRLRDVVSARFYAVARALVCADLPGVGRLTREQFRQVVHRHFLRLSDKQFEELWAQLPVDECDKLDYRDYREFLKRFCDGTALPAAAFTSSAPPGIEHTHGHAQSTHPSLSFPPQSLNTGHRPASVAGSVRGGTARAVRSTPLVDCEALESRLRERVSRRWQEILRECRLKDPTASGEIGANDLLGVLRTFDVWLSEDELAGLASKF------AAHSTGHVAYRAFLRHLVLTLRPRQHGLLQRQRLQQPSFTPGGTAPNDAFLEAMLHLREQVLPNWRPMRRAFRAVDPSASGFLSAPDFRQVLKQFAINLTEDEFFQILNYYDGQLHNRVPYNAFLR 653          

HSP 5 Score: 75.8702 bits (185), Expect = 4.377e-14
Identity = 85/434 (19.59%), Postives = 170/434 (39.17%), Query Frame = 3
Query:  711 IMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETINIDTRNTKGSRIFEAALIENGLLGSNELEQLLVI--FRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKI---IWLSFLQKFQD--------------PQSKHLNG-----------STIAIKSDHKCNPIQG---------VNSKPNID--DLLELLSNHISNNYSS-FRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHKWLNSNHKVVEPRKDLQLSSETIKST------------ISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDI 1850
            + KAF  FD +    ++    ++V++NFC  L   QF  L+ R  +  +G V++ +F++   +            S++T   D +      +  AAL  +   G + L    V+   R  +  +F  + +  +  D    G +T E   +++++    +S   F ++  +       K+    +  FL++F D              P  +H +G              ++ + H+   + G         V S P +D   L   L   +S  +    R+  L+ + T  G+I  ++ L +L  F  ++S D+L+ +      H+ G+++Y  FL+          H  L         R+ LQ  S T   T            + + +   W  +   F  VD + +G++S  D +++ K+    L +D+ 
Sbjct:  222 LQKAFSAFDKSQRGLVKEEEFRRVLDNFCLKLDGPQFQHLLKRLKRGGDGTVDWQDFLEAFSL-----------LSDKTEGADWQRE----VARAALAGHRGAGDHALSAGGVLRRLRDVVSARFYAVARALVCADLPGVGRLTREQFRQVVHRHFLRLSDKQFEELWAQLPVDECDKLDYRDYREFLKRFCDGTALPAAAFTSSAPPGIEHTHGHAQSTHPSLSFPPQSLNTGHRPASVAGSVRGGTARAVRSTPLVDCEALESRLRERVSRRWQEILRECRLK-DPTASGEIGANDLLGVLRTFDVWLSEDELAGLASKFAAHSTGHVAYRAFLRHLVLTLRPRQHGLLQ--------RQRLQQPSFTPGGTAPNDAFLEAMLHLREQVLPNWRPMRRAFRAVDPSASGFLSAPDFRQVLKQFAINLTEDEF 631          

HSP 6 Score: 60.4622 bits (145), Expect = 2.545e-9
Identity = 60/348 (17.24%), Postives = 149/348 (42.82%), Query Frame = 3
Query:  249 ILKALQTFDIECSGLVTKGELRRVLDSYCLPMTTDQYEQFLSH------NSINYSKGSINYKELIDKIYDKTSAVGHFKKNIKLPQLQRSATTICLQNKHFTLPTTRRSSGKISRSQLFXXXXXXXXXXXXXXXXWNYNAYTIDDIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPID--NQGTIQTKNSEETINIDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKF 1268
            + +AL   D+   G +T+ + R+V+  + L ++  Q+E+  +       + ++Y     +Y+E + +  D T+       +   P ++ +       +   + P    ++G    S       + S+    +    +      + +   L+ ++SR    I++  +L D  +   I  + L  V+  F   L+E +   L ++F+    G+V Y  F++ + + +     G +Q +                R+ + +    G   ++   + ++  R+++   +  +R+ F  +DP+A GF++     ++L QFA  ++ + F QI++    +   ++ + +FL+ F
Sbjct:  334 VARALVCADLPGVGRLTREQFRQVVHRHFLRLSDKQFEELWAQLPVDECDKLDYR----DYREFLKRFCDGTALPAAAFTSSAPPGIEHTHGHAQSTHPSLSFPPQSLNTGHRPAS------VAGSVRGGTARAVRSTPLVDCEALESRLRERVSRRWQEILRECRLKDPTASGEIGANDLLGVLRTFDVWLSEDELAGLASKFAAHSTGHVAYRAFLRHLVLTLRPRQHGLLQRQ----------------RLQQPSFTPGGTAPNDAFLEAMLHLREQVLPNWRPMRRAFRAVDPSASGFLSAPDFRQVLKQFAINLTEDEFFQILNYYDGQLHNRVPYNAFLRTF 655          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Nematostella
Match: EDO28210 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T743])

HSP 1 Score: 205.297 bits (521), Expect = 1.633e-57
Identity = 114/330 (34.55%), Postives = 192/330 (58.18%), Query Frame = 3
Query:  663 DIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGN-VNYMEFMKGMGIPID-----------NQGTIQTKNSEETINIDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKEN 1616
            DI   L+ +I+     ++KA +LFD+N D  IQRH L++V+ENFC  LT +QFD+L  ++  ++NG+ ++YM+F+K +G+              NQG   T+N  + +  + R   GS   + +     ++   +LE+ L   R K+ + F  +++ F+  D   +GFVTL+ L +IL  F FPMS ++F  +M +C  +A+ KI +  FL+KFQDP+    NG TI IK +HK NP++     P  +D+ + L + ++++++S + AFL  +    G+I + +F +IL  F F ++ +Q   ++  +DP N GYISY  FL  FE +E+
Sbjct:   14 DIEQQLRTKIAGQLQAVLKAIRLFDYNRDGQIQRHELRRVVENFCFRLTNEQFDRLWCKYDLTRNGHTLDYMDFLKRLGVNTHPKRRPSTANRLNQGN-GTENKVKFLATNKRPLSGSSSRDGS---PAVMTVKDLERKL---RAKMVENFENIQRAFVAFDRRCDGFVTLDQLKRILTHFVFPMSDSLFEDLMRRCGIRASHKIGYEQFLEKFQDPRVSG-NGQTIPIKPNHKFNPVREAEDMPTTEDIWKFLFSKVTDSFTSVKQAFLVFDDNKDGRITRRDFRRILESFCFRMTEEQFHELMAKIDPMNRGYISYLEFLDRFEHRES 335          

HSP 2 Score: 93.9745 bits (232), Expect = 6.088e-20
Identity = 89/389 (22.88%), Postives = 174/389 (44.73%), Query Frame = 3
Query:  168 NYKMDPKLQ-ISEINPIVKSQLLKNHKEILKALQTFDIECSGLVTKGELRRVLDSYCLPMTTDQYEQFLSHNSINYSKGSINYKELIDKIYDKTSAVGHFKKNIKLP-QLQRSATTICLQNKHFTLPTTRRS-SGKISRSQLFXXXXXXXXXXXXXXXXWNYNAYTIDDIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETINIDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDH 1325
            N    PK Q  ++I   +++++    + +LKA++ FD    G + + ELRRV++++C  +T +Q+++      +  +  +++Y + + ++   T    H K+      +L +   T   +NK   L T +R  SG  SR                     +    T+ D+   L+ ++  N   I +AF  FD   D  +   +LK+++ +F  P+++  F+ L+ R     +  + Y +F++    P       +   + +TI I   N K + + EA  +          E +      K+ D F+ +++ FLV D N +G +T     +IL  F F M+   F+++M K      G I +L FL +F+  +S  L+   + +  D 
Sbjct:    2 NQTKSPKEQSFADIEQQLRTKIAGQLQAVLKAIRLFDYNRDGQIQRHELRRVVENFCFRLTNEQFDRLWCKYDLTRNGHTLDYMDFLKRLGVNT----HPKRRPSTANRLNQGNGT---ENKVKFLATNKRPLSGSSSRD-------------------GSPAVMTVKDLERKLRAKMVENFENIQRAFVAFDRRCDGFVTLDQLKRILTHFVFPMSDSLFEDLMRRCGIRASHKIGYEQFLEKFQDP-------RVSGNGQTIPIKP-NHKFNPVREAEDMPT-------TEDIWKFLFSKVTDSFTSVKQAFLVFDDNKDGRITRRDFRRILESFCFRMTEEQFHELMAKIDPMNRGYISYLEFLDRFEHRESPVLDSLGLYMTDDQ 349          

HSP 3 Score: 87.0409 bits (214), Expect = 1.127e-17
Identity = 73/333 (21.92%), Postives = 147/333 (44.14%), Query Frame = 3
Query: 1695 IKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYE--CNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMV 2687
            I+  +   I  +   V+    L D NR G I   +L+++ +     L ++  DRL     L      ++Y++    L V+T P      + ++ + N  + K +     ++  S     +    +M+ ++L  +++ ++V+N  N    +  ++  C+   G +   QL+++LT F + +++  F  +        S K  I +  FL  F D R S N     +    K NH  N +R  ++     +++   L  K+ ++F  +  AF  FD +  G + + DF+  L      +  +QF  L  K+    +  ++Y +FL+RF+ R+  V
Sbjct:   15 IEQQLRTKIAGQLQAVLKAIRLFDYNRDGQIQRHELRRVVENFCFRLTNEQFDRLWCKYDLTRNGHTLDYMDFLKRLGVNTHPKRRPSTANRLNQGNGTENKVKFLATNKRPLSGSSSRDGSPAVMTVKDLERKLRAKMVENFENIQRAFVAFDRRCD---GFVTLDQLKRILTHFVFPMSDSLFEDLMRRCGIRASHK--IGYEQFLEKFQDPRVSGNGQTIPI----KPNHKFNPVREAEDMP-TTEDIWKFLFSKVTDSFTSVKQAFLVFDDNKDGRITRRDFRRILESFCFRMTEEQFHELMAKIDPMNRGYISYLEFLDRFEHRESPV 337          

HSP 4 Score: 83.1889 bits (204), Expect = 1.930e-16
Identity = 73/292 (25.00%), Postives = 128/292 (43.84%), Query Frame = 3
Query: 2163 DKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADN-----RESS-------NDLMTDVCFLPKSNHHVNDIRGDDNRN--MNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKW---LDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFL 2987
            ++ G I + +LR+++  F + LTNEQF ++    +  T +   +D+  FL     N     R S+       N     V FL  +   ++     D     M  +++E  LR K+V NF ++  AF  FDR   G++     +  L   +  + +  F+ L  + G+    K+ Y  FL +FQ  D  V G+     +   H+FN P   A    + ED++  L  K+   F  +   F+    +  G I  R+ + +L      M++ +  +L  + D  NR  + Y +FL
Sbjct:   40 NRDGQIQRHELRRVVENFCFRLTNEQFDRLWCKYDL-TRNGHTLDYMDFLKRLGVNTHPKRRPSTANRLNQGNGTENKVKFLATNKRPLSGSSSRDGSPAVMTVKDLERKLRAKMVENFENIQRAFVAFDRRCDGFVTLDQLKRILTHFVFPMSDSLFEDLMRRCGIRASHKIGYEQFLEKFQ--DPRVSGNGQTIPIKPNHKFN-PVREAEDMPTTEDIWKFLFSKVTDSFTSVKQAFLVFDDNKDGRITRRDFRRILESFCFRMTEEQFHELMAKIDPMNRGYISYLEFL 327          

HSP 5 Score: 80.1073 bits (196), Expect = 2.019e-15
Identity = 64/289 (22.15%), Postives = 122/289 (42.21%), Query Frame = 3
Query:   66 DITDSLIVRKSIYREPIQSNSLNQ----------------PEKNSTIKDANYKMDPKLQISEINPIVKSQLLKNHKEILKALQTFDIECSGLVTKGELRRVLDSYCLPMTTDQYEQFLSHNSINYSKGSINYKELIDKIYDKTSAVGHFKKNIKLPQLQRSATTICLQNKHFTLPTTRRSSGKISRSQLFXXXXXXXXXXXXXXXXWNYNAYTIDDIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFM 884
            D    L V     R P  +N LNQ                P   S+ +D +  +   + + ++   +++++++N + I +A   FD  C G VT  +L+R+L  +  PM+   +E  +    I  S   I Y++ ++K  D              P++  +  TI ++  H   P   R +  +                            T +DI   L  +++ +   + +AF +FD N D  I R   ++++E+FC  +TE+QF +L+A+      G ++Y+EF+
Sbjct:   86 DFLKRLGVNTHPKRRPSTANRLNQGNGTENKVKFLATNKRPLSGSSSRDGSPAV---MTVKDLERKLRAKMVENFENIQRAFVAFDRRCDGFVTLDQLKRILTHFVFPMSDSLFEDLMRRCGIRASH-KIGYEQFLEKFQD--------------PRVSGNGQTIPIKPNHKFNPV--REAEDMP---------------------------TTEDIWKFLFSKVTDSFTSVKQAFLVFDDNKDGRITRRDFRRILESFCFRMTEEQFHELMAKIDPMNRGYISYLEFL 327          

HSP 6 Score: 79.337 bits (194), Expect = 3.383e-15
Identity = 69/280 (24.64%), Postives = 130/280 (46.43%), Query Frame = 3
Query: 2853 GFIRFRNLQHLLSRLQISMSKSEMKKLWKRYD-TNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTH--LHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQEKTVGSIRINQDLENPSKIGIEEAGNLNSTQ-IASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNK 3680
            G I+   L+ ++      ++  +  +LW +YD T N + LDY DFL  LG+           PS A   N  N   + +    T  +    + +  G+   + V+ L   ++  +   + +   AF  VA  +   GF T++ L ++L+     +++  F  L  R G       + YE+F   FQD   + G  +T+  I+ N    NP    + EA ++ +T+ I   +  ++ D ++ +++ FLV D    G ++  +FR +L  FC  +T++QF++
Sbjct:   43 GQIQRHELRRVVENFCFRLTNEQFDRLWCKYDLTRNGHTLDYMDFLKRLGV----NTHPKRRPSTANRLNQGNGTENKVKFLATNKRPLSGSSSRDGSPAVMTVKDLERKLRAKMVENFENIQRAF--VAFDRRCDGFVTLDQLKRILTHFVFPMSDSLFEDLMRRCGIRA-SHKIGYEQFLEKFQDP-RVSGNGQTI-PIKPNHKF-NP----VREAEDMPTTEDIWKFLFSKVTDSFTSVKQAFLVFDDNKDGRITRRDFRRILESFCFRMTEEQFHE 308          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Nematostella
Match: EDO46548 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPQ2])

HSP 1 Score: 86.6557 bits (213), Expect = 6.319e-17
Identity = 107/465 (23.01%), Postives = 196/465 (42.15%), Query Frame = 3
Query: 2403 RGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFL---LGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQ-LAARMGFE-GPDDSLSYEKFCCIFQDSLNIDGQEKTVGSIRINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSE----IEKTFLVMDPENSGYVSMNEFRNLLVG-FCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGFN 3767
            RG D  +++  E E LLR+K+   +  +   F + D  NKG + +      L   +G  I +   QF+ L  +L +  K  + Y++F   F+      +G  WL+       P+      M+A  V+  L EK  Q F +++     +   G+G I    L+++L+++   M   E +KLW +YDT N   +     +  LG+  K G    M  S   ++      +D                           +   +KR  R  +SD   AF  +   +T  G    +D  K+L++  + ++ DK V+   AR G     DD + Y++F   FQD  + DG    + + +++       +    + G+  ST   S +  R++D +      +  TF  +D ++ G ++  +FR  + G F L ++D+++  +   +        N D  + Y  FM  F+
Sbjct:  126 RGPDKASVD--EFEYLLREKMKTGYFTIKNLFKQRDPENKGIVSRESLSQILTTFVGKPISLS--QFNKLMVRLNLDHKKMIAYDEFYAAFRPPKKADEGPAWLE----LEKPNMRT---MTASQVHAHLKEKAKQRFLDVAELIPQMNPGGSGRILRPELRNVLNQMGFYMDDDEFEKLWLKYDTENVGTIRAEKLMGKLGISIKPGSTGDMPRSPRKLEVERKVQLD---------------------------IERWLKRKFREGFSDMKHAFMELDLDRT--GRVRKDDFRKVLAEFDLKLSTDKQVEDFLARCGVTLTSDDLVPYKEFLRRFQDR-SQDGMPHKILANQLH-------RYHHSDQGSQFST--TSAVEARLMDLFQRDFLALLGTFHNIDRKDCGLLTQQQFRAAIEGRFELGMSDEEYEDFLTRVPI------NNDGMVKYVEFMSKFD 534          

HSP 2 Score: 74.7146 bits (182), Expect = 2.498e-13
Identity = 88/469 (18.76%), Postives = 194/469 (41.36%), Query Frame = 3
Query:  240 HKEILKALQTF---DIECSGLVTKGELRRVLDS-YCLPMTTDQYEQFLSHNSINYSKGSINYKELIDK-----------IYDKTSAVGHFKKNIKLPQLQRSATTICLQNKHFTLPTTRRSSGKISRSQLFXXXXXXXXXXXXXXXXWNYNAYTIDDIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETINIDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCN-PIQGVNSKPN--IDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFL 1592
             ++ L  L TF   D +  GL+T+ + R  ++  + L M+ ++YE FL+   IN + G + Y E + K           ++D++S +G  +    +P ++   +      KH       R    +     +                 + +  + +++  +++  +  N     +AF   D  +   +    ++K+++ F   +   +  KL   F   Q G++ Y++F++  G  I +      K S           +G   F   ++ +  L S+ ++ L    + K++  +  LR  F   DPN  GFV+ E   +IL      ++    + + +K   K   ++ ++ FL+ +   + ++ + +   + +  +   P+  +  KPN  +  +   L   +S  + + R AF +++  + G +   EF  +L      +  D++  +L  LD    G ++Y  FL
Sbjct:  466 QRDFLALLGTFHNIDRKDCGLLTQQQFRAAIEGRFELGMSDEEYEDFLTRVPIN-NDGMVKYVEFMSKFDTTFDRDNNSLFDRSSVLGAPEP---MPPIREKESPPGSPRKH-------RRPRPVKTVDSYD----------------SQDGRSAEELKRVIKNVLVNNFQDFEQAFYDLDELNSKRLTPEMMRKLLKKFDVDVNRNEIKKLWDTFITDQRGHLEYLQFVRHFGYSIGSAAFPNAKVSPPK--------RGDNDF---MMRSNKLNSD-VDMLFDQLKSKVDFHWDRLRGEFAAADPNNAGFVSREAFKEILQDLCIELTDYELSYVTNKFDPKNENRVSYVKFLEPYAKRRRRYFSNNMGTVMNHPQAELPMDDIVPKPNKGLSGITAKLRQKLSGEWKNLRKAFRKLDLQNDGYLSIPEFRSVLRLCNTVLEEDEIYHLLSELDSGMSGNVNYREFL 895          

HSP 3 Score: 72.7886 bits (177), Expect = 8.998e-13
Identity = 135/679 (19.88%), Postives = 278/679 (40.94%), Query Frame = 3
Query:  756 IQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETINIDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMD---KCAFKATGK--IIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNIDDLLEL-LSNHISNNYSSFRDAFLQINQTHKGKIPKSEF-LKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQ------------LFEQKENLSAHKWLNS------------NHKVVEPRKDLQ-------LSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDK--KGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRES--SNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFL-LGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNR 2663
            I R  L+ V+      + + +F+KL  ++     G +   + M  +GI I    T     S   + ++ +                     ++E+ L   ++K  + FS ++  F+ +D +  G V  +   K+L +F   +S +   Q+ D   +C    T    + +  FL++FQD     +    +A +     +  QG  S+ +    +E  L +    ++ +    F  I++   G + + +F   I  RF+  +S ++    L  +  +N+G + Y  F+             LF++   L A + +               H+   P K +         S+E +K  I + + N + +    F  +D   +  ++ E ++K+ KK    +  ++I +L     + D++G + YL+               G S   A   +A++        + M    KL          + L  ++K ++     ++  L  ++   D    G +++   +++L      LT+ + S ++    F   +++R+ +  FL  +A  R    SN++ T V   P++   ++DI    N+ ++   +   LRQK+   + +L  AF K D  N GYL   +F++ L L N ++ E++ + LL E L  G    + Y +FL +
Sbjct:  270 ILRPELRNVLNQMGFYMDDDEFEKLWLKYDTENVGTIRAEKLMGKLGISIKPGSTGDMPRSPRKLEVERKVQL------------------DIERWL---KRKFREGFSDMKHAFMELDLDRTGRVRKDDFRKVLAEFDLKLSTD--KQVEDFLARCGVTLTSDDLVPYKEFLRRFQDRSQDGMPHKILANQLHRYHHSDQG--SQFSTTSAVEARLMDLFQRDFLALLGTFHNIDRKDCGLLTQQQFRAAIEGRFELGMSDEEYEDFLTRVPINNDGMVKYVEFMSKFDTTFDRDNNSLFDRSSVLGAPEPMPPIREKESPPGSPRKHRRPRPVKTVDSYDSQDGRSAEELKRVIKNVLVNNFQDFEQAFYDLDELNSKRLTPEMMRKLLKKFDVDVNRNEIKKLWDTF-ITDQRGHLEYLQFVRHF----------GYSIGSAAFPNAKVSPPKRGDNDFMMRSNKLNS------DVDMLFDQLKSKV---DFHWDRLRGEFAAADPNNAGFVSREAFKEILQDLCIELTDYELSYVTN--KFDPKNENRVSYVKFLEPYAKRRRRYFSNNMGT-VMNHPQAELPMDDIVPKPNKGLSG--ITAKLRQKLSGEWKNLRKAFRKLDLQNDGYLSIPEFRSVLRLCNTVLEEDEIYHLLSE-LDSGMSGNVNYREFLTK 897          

HSP 4 Score: 65.4698 bits (158), Expect = 1.806e-10
Identity = 148/796 (18.59%), Postives = 316/796 (39.70%), Query Frame = 3
Query: 1356 KPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRF-QFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQ-KENLSAHKWLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTL-TNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNL-IMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQI---RDD--MVDGHKWLDS------------------KHRFNDP-----STNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTH---LHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQEKTVGSIRINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLL 3638
            K ++D+   LL   +   Y + ++ F Q +  +KG + +    +IL  F    IS  Q + ++  L+  ++  I+Y  F   F   K+      WL      +E      +++  + + + +    ++ +V      ++   +G I   +L+ +  ++  Y+ DD+ ++L      ++  G I   +L   L          G+S +   + D     R      K+E      E ++ L     L  + ++     +  + EL       D+ G + K   RK+L +F   L T++Q            +S   + +  FL  F D    S D M       + + + +  +G  ++      VE  L      +F  L+  FH  DR + G L +  F+  + G   + + +++++    ++ +     + Y +F+++F     RD+  + D    L +                  KHR   P     S ++    SAE++  ++   +   F +    F  L    +  +    ++ LL +  + ++++E+KKLW  + T+ R  L+Y  F+ + G    +  G    P+A +                       DN  ++ ++     V+ LF+ +K   +V +    L  +  A     +GF +     ++L  L + +T+ +   +  +   +  ++ +SY KF   +            +G++  +   E P    I    N   + I + + +++  ++  + K F  +D +N GY+S+ EFR++L
Sbjct:  130 KASVDEFEYLLREKMKTGYFTIKNLFKQRDPENKGIVSRESLSQILTTFVGKPISLSQFNKLMVRLNLDHKKMIAYDEFYAAFRPPKKADEGPAWLE-----LEKPNMRTMTASQVHAHLKEKAKQRFLDVAELIPQMNPGGSGRILRPELRNVLNQMGFYMDDDEFEKLWLKYDTENV-GTIRAEKLMGKL----------GISIKPGSTGDMPRSPR------KLEV-----ERKVQLDIERWLKRKFREGFSDMKHAFMEL-----DLDRTGRVRKDDFRKVLAEFDLKLSTDKQVEDFLARCGVTLTSDDLVPYKEFLRRFQDR---SQDGMPHKILANQLHRYHHSDQG--SQFSTTSAVEARLMDLFQRDFLALLGTFHNIDRKDCGLLTQQQFRAAIEGRFELGMSDEEYEDFLTRVPINNDGMVKYVEFMSKFDTTFDRDNNSLFDRSSVLGAPEPMPPIREKESPPGSPRKHRRPRPVKTVDSYDSQDGRSAEELKRVIKNVLVNNFQDFEQAFYDLDELNSKRLTPEMMRKLLKKFDVDVNRNEIKKLWDTFITDQRGHLEYLQFVRHFG----YSIGSAAFPNAKVSPPKRG-----------------DNDFMMRSNKLNSDVDMLFDQLKS--KVDFHWDRLRGEFAAADPNNAGFVSREAFKEILQDLCIELTDYELSYVTNKFDPKN-ENRVSYVKFLEPYAKRRR-RYFSNNMGTVMNHPQAELPMD-DIVPKPNKGLSGITAKLRQKLSGEWKNLRKAFRKLDLQNDGYLSIPEFRSVL 862          

HSP 5 Score: 58.5362 bits (140), Expect = 2.013e-8
Identity = 132/690 (19.13%), Postives = 275/690 (39.86%), Query Frame = 3
Query:  711 IMKAFKLFDFNSDYCIQRHRLKKVMENFCC-PLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETINIDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKS--DHKCNPIQ-GVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISAD-QLSIILK--FLDPHNEGYISYHHFLQLFEQK-ENLSAHKWL-NSNHKVVEPRKDLQLSSET-IKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGY-LKDDDIDRLVAPLTLKDKKGRINYLE---------------LFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHE-LYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFA--------DNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIR 2675
            I   FK  D  +   + R  L +++  F   P++  QF+KL+ R +      + Y EF      P         K ++E          G    E   +E   + +    Q+    ++K + +F  + +    M+P   G +    L  +LNQ  F M  + F ++  K   +  G I     + K          G +I   S  D   +P +  V  K  +D +   L       +S  + AF++++    G++ K +F K+L  F   +S D Q+   L    +   ++  + Y  FL+ F+ + ++   HK L N  H+     +  Q S+ + +++ + D     +  ++  F+ +D    G ++ +  +   +  F   + D++ +  +  + + +  G + Y+E               LF+  +V  +P  +  +  + +     + K R    ++ ++S +       +  S EEL   IK+ +V N  ++ +  Y   E N K+  +    +RK+L +F   +   +  K+ +   F T  +  +++  F+  F          N + S     D  F+ +SN   +D+            + D L+ K+  ++  L   F   D +N G++ +  F+  L    I + + +   +  K     +++++Y  FL  +  R
Sbjct:  151 IKNLFKQRDPENKGIVSRESLSQILTTFVGKPISLSQFNKLMVRLNLDHKKMIAYDEFYAAFRPP---------KKADE----------GPAWLE---LEKPNMRTMTASQVHAHLKEKAKQRFLDVAELIPQMNPGGSGRILRPELRNVLNQMGFYMDDDEFEKLWLKYDTENVGTIRAEKLMGKL---------GISIKPGSTGDMPRSPRKLEVERKVQLD-IERWLKRKFREGFSDMKHAFMELDLDRTGRVRKDDFRKVLAEFDLKLSTDKQVEDFLARCGVTLTSDDLVPYKEFLRRFQDRSQDGMPHKILANQLHRYHHSDQGSQFSTTSAVEARLMDLFQRDFLALLGTFHNIDRKDCGLLTQQQFRAAIEGRFELGMSDEEYEDFLTRVPI-NNDGMVKYVEFMSKFDTTFDRDNNSLFDRSSVLGAPEPMPPIREKESPPGSPR-KHRRPRPVKTVDSYDS-----QDGRSAEELKRVIKNVLVNNFQDFEQAFYDLDELNSKR--LTPEMMRKLLKKFDVDVNRNEIKKLWD--TFITDQRGHLEYLQFVRHFGYSIGSAAFPNAKVSPPKRGDNDFMMRSNKLNSDV----------DMLFDQLKSKVDFHWDRLRGEFAAADPNNAGFVSREAFKEILQDLCIELTDYELSYVTNKFDPKNENRVSYVKFLEPYAKR 787          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Nematostella
Match: EDO32038 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW85])

HSP 1 Score: 63.5438 bits (153), Expect = 2.689e-10
Identity = 50/214 (23.36%), Postives = 95/214 (44.39%), Query Frame = 3
Query: 2373 PKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIR-FRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEK 3011
            P+  HH         R M+  EV+  +++ ++  F  L  AF   D S  G +     +  L  ++  + +DQFD + + L      ++ Y +FL  +  RDD++        + +   PS  ++  +S     M+ P K Y      SP     + S +   R  +N   +L +  + ++ +E+  LW+++D N + ++ Y DFL +  L  K
Sbjct:   56 PEGYHH--------RRTMSEDEVKQRVKEVVMARFYRLAKAFTDQDSSRSGTVSPRGLRRVLDEHVFRMNDDQFDQIWQSLPKVPDGRVEYREFLKTYSTRDDVIRSQSATPPRTQERKPSRESL--LSP----MMSPTKPY------SPDIPTPLPSASDVERKIKNTVDVLVQHHVILNNNELLSLWRKHDVNGKGRIVYKDFLRHFVLAMK 249          

HSP 2 Score: 58.9214 bits (141), Expect = 7.343e-9
Identity = 59/315 (18.73%), Postives = 125/315 (39.68%), Query Frame = 3
Query: 3843 QIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLKKNEFDNVNYGEFVKMXXXXXXXXXXXXXXXXXXXXXXXXXXNNIETDEMDTDESIRKNLERLLNRNWQSIFNKCKAIDQAINECQTAEGSIPIDDFVYILSEYDDSLSAENLAAI-NLYKTCKNGRFIKYGDLIRSIVLSSRGSLISNENVTEVQKKFLNVGIKTTNSDNSKDYFPQLFKLRRQILENWKDLRKNFLQSDKKQNGAVSGNIFMTIMKTVCGQLSADLFYHLMKIYDQDGTGNFHYKRFIEDFLK 4784
            ++++ + E +  R      +F  +D +    +S    R +++  +F + D  F++ W +L K     V Y EF+K  S   +                       ++      +  + + E LL+            I   +      E  I   + V +L ++   L+   L ++   +     GR + Y D +R  VL+    +   ++   ++ K     + ++    S +    +  +R ++ E+WK++R+ F   DK  +G  +   F  ++K     L+ + F+H+   YD+D TG   Y  F+   L+
Sbjct:   69 EVKQRVKEVVMARFYRLAKAFTDQDSSRSGTVSPRGLRRVLDEHVFRMNDDQFDQIWQSLPKVPDGRVEYREFLKTYSTRDDVIRS-------------------QSATPPRTQERKPSRESLLSPMMSPTKPYSPDIPTPLPSASDVERKI--KNTVDVLVQHHVILNNNELLSLWRKHDVNGKGRIV-YKDFLRHFVLA----MKPQDDSKLIRPKLQPTKVPSSPGVRSDELIDVMATIRGKVQEDWKEMRRAFRAIDKDGSGLCNPLDFRQMLKRFKIDLNEEEFFHVYSFYDKDMTGKISYNEFLRAHLE 357          

HSP 3 Score: 57.3806 bits (137), Expect = 2.810e-8
Identity = 64/309 (20.71%), Postives = 133/309 (43.04%), Query Frame = 3
Query: 2070 MSPEELIVRIKDRIVQNRLNYHELYKKYECND--KKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFND-PSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFL 2987
            MS +E+  R+K+ +V  R  ++ L K +   D  + G ++   LR++L +  + + ++QF +I + L  P     R+++  FL  ++    + +D++      P         R      M          +    + P  + +    +R  K  +      + L+ + +++ N++   L  K  V  K ++ Y DFL  F +     D  K +  K +    PS+  V      DV   +  K+ + + E+   F A+   G+G     + + +L R +I +++ E   ++  YD +   K+ Y++FL
Sbjct:   65 MSEDEVKQRVKE-VVMAR--FYRLAKAFTDQDSSRSGTVSPRGLRRVLDEHVFRMNDDQFDQIWQSL--PKVPDGRVEYREFLKTYS----TRDDVIRSQSATPPRTQERKPSRESLLSPMMSPT------KPYSPDIPTPLPSASDVERKIKNTV------DVLVQHHVILNNNELLSLWRKHDVNGKGRIVYKDFLRHFVLAMKPQDDSKLIRPKLQPTKVPSSPGVRSDELIDVMATIRGKVQEDWKEMRRAFRAIDKDGSGLCNPLDFRQMLKRFKIDLNEEEFFHVYSFYDKDMTGKISYNEFL 352          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Nematostella
Match: EDO28943 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T520])

HSP 1 Score: 56.9954 bits (136), Expect = 7.168e-9
Identity = 41/177 (23.16%), Postives = 82/177 (46.33%), Query Frame = 3
Query: 2460 KIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFND-PSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFL 2987
            ++  N+  L  +F   D  N G++     ++ L+ + +++ N++   L  K  V  K ++ Y DFL  F +     D  K +  K +    PS+  V      DV   +  K+ + + E+   F A+   G+G     + + +L R +I +++ E   ++  YD +   K+ Y++FL
Sbjct:   24 EVCRNWQQLQKSFRNLDPDNTGHVSFHQLKDVLVQHYVILNNNELLSLWRKHDVDGKGRIVYKDFLRHFVLAMKPQDDSKLIRPKLQPTKVPSSPGVRSDELIDVMATIRGKVQEDWKEMRRAFRAIDKDGSGLCNPVDFRQMLKRFKIDLNEEEFFHVYSFYDKDMTGKISYNEFL 200          

HSP 2 Score: 51.2174 bits (121), Expect = 7.666e-7
Identity = 31/130 (23.85%), Postives = 62/130 (47.69%), Query Frame = 3
Query: 4395 GRFIKYGDLIRSIVLSSRGSLISNENVTEVQKKFLNVGIKTTNSDNSKDYFPQLFKLRRQILENWKDLRKNFLQSDKKQNGAVSGNIFMTIMKTVCGQLSADLFYHLMKIYDQDGTGNFHYKRFIEDFLK 4784
            GR + Y D +R  VL+ +      ++   ++ K     + ++    S +    +  +R ++ E+WK++R+ F   DK  +G  +   F  ++K     L+ + F+H+   YD+D TG   Y  F+   L+
Sbjct:   81 GRIV-YKDFLRHFVLAMK----PQDDSKLIRPKLQPTKVPSSPGVRSDELIDVMATIRGKVQEDWKEMRRAFRAIDKDGSGLCNPVDFRQMLKRFKIDLNEEEFFHVYSFYDKDMTGKISYNEFLRAHLE 205          

HSP 3 Score: 50.447 bits (119), Expect = 1.431e-6
Identity = 42/171 (24.56%), Postives = 75/171 (43.86%), Query Frame = 3
Query: 1086 LRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIK-SDHKCNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQ 1595
            L+K+F  +DP+  G V+   L  +L Q    ++ N    +  K      G+I++  FL+ F        +   I  K    K     GV S   ID ++  +   +  ++   R AF  I++   G     +F ++L RF+  ++ ++   +  F D    G ISY+ FL+
Sbjct:   32 LQKSFRNLDPDNTGHVSFHQLKDVLVQHYVILNNNELLSLWRKHDVDGKGRIVYKDFLRHFVLAMKPQDDSKLIRPKLQPTKVPSSPGVRSDELID-VMATIRGKVQEDWKEMRRAFRAIDKDGSGLCNPVDFRQMLKRFKIDLNEEEFFHVYSFYDKDMTGKISYNEFLR 201          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Planmine SMEST
Match: SMESG000052556.1 (SMESG000052556.1)

HSP 1 Score: 2090.85 bits (5416), Expect = 0.000e+0
Identity = 1060/1071 (98.97%), Postives = 1065/1071 (99.44%), Query Frame = 3
Query: 1305 IAIKSDHKCNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHKWLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQEKTVGSIRINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGFNQKLNNLDIQXXXXXXXXXXXXXTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLKKNEFDNVNYGEFVKMXXXXXXXXXXXXXXXXXXXXXXXXXXNNIETDEMDTDESIRKNLERLLNRNWQSIFNKCKAIDQAINECQTAEGSIPIDDFVYILSEYDDSLSAENLAAINLYKTCKNGRFIKYGDLIRSIVLSSRGSLISNENVTEVQKKFLNVGIKT 4517
            I++  D  CNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHKWLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKME I+KLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTL+GFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQEKTVGSIRINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGFNQK+NNLDIQSMSANPAANASNMTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLKKNEFDNVNYGEFVKMISESSETDDDKKSKISKTKVKIKEETNNIETDEMDTDESIRKNLERLLNRNWQSIFNKCKAIDQAINECQTAEGSIPIDDFVYILSEYDDSLSAENLAAINLYKTCKNGRFIKYGDLIRSIVLSSRGSLISNENVTEVQKKFLNVGIK 
Sbjct:   28 ISLVIDLACNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHKWLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMEYIDKLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLTGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQEKTVGSIRINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGFNQKVNNLDIQSMSANPAANASNMTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLKKNEFDNVNYGEFVKMISESSETDDDKKSKISKTKVKIKEETNNIETDEMDTDESIRKNLERLLNRNWQSIFNKCKAIDQAINECQTAEGSIPIDDFVYILSEYDDSLSAENLAAINLYKTCKNGRFIKYGDLIRSIVLSSRGSLISNENVTEVQKKFLNVGIKV 1098          

HSP 2 Score: 113.235 bits (282), Expect = 8.561e-25
Identity = 171/797 (21.46%), Postives = 348/797 (43.66%), Query Frame = 3
Query:  711 IMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFS-QSQNGNVNYMEFMKGMGI---PIDNQGTIQTKNSEETINIDTRNTKGSRIFEAALIENGLLGSNEL-----EQLLVIFRKKIED---QFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGK--IIWLSFLQKFQDPQSKH---LNGSTIAIKSDHKCNPIQG-VNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENL-SAHKWLNSNHKVVEPRKDL--QLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLE-LFNLLNVDT-SPSDLEGLSTQIAESNDAQLKERHEN----HIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHE--LYKKYECNDK--KGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRE-SSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKL------GVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFL 2987
            ++  F L D N    I    LKK+ +     L +   D+LVA  + + + G +NY+E    + +   P D +G + T+ +E   +   +    + I +   I+   LG   L     E+L+V  + +I      +  L K +   D   +G +    L K+L QF + ++   F++I +   F  + K  I +  FL  F D +      +       KS+H  N I+G  N   N  ++ +LL   I NN+     AF + ++++KG + KS+F   L      I  DQ  ++ + L    +  ++Y+ FL  F+ ++++   HKWL+S H+  +P  +    +S+E +   + + I   +  +   F  +  + TG+I   +L+ +  +L   +   ++ +L       + + +++Y + L+NL  ++     DL G S  I +++   L +   N    H + +++   LG      +  E L   +K  +   R+ Y +  L  K   N K   G    + L K+L+Q    +TN++F +++  + F     S + +  F  IF D+      +       + +   + + I  ++  N+N  ++  ++ ++IV+ + ++   F   D  N GY+  ++F+N L+G  + + + QF+     L            K+ Y  F+  F  + +       LD +    +P+ NA  +M+ + +   + E I         +F +   +   FI   + + ++ R   ++  S  +K W     N  + ++Y +F+
Sbjct:  173 VVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEG-LSTQIAESN-DAQLKERHENHIEKMEYIDK--LGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECND--KKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYD-TNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTH----LHVEHLFEMVKRHL---RVAYSDSALAFKAVANKKTLTGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDS-LSYEKFCCIFQDSLNIDGQEKTVGSIRINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGFNQKVNN------LDIQSMSANPAANA-SNMTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLKKNEFDNVNYGEFV 947          

HSP 3 Score: 77.0258 bits (188), Expect = 1.069e-13
Identity = 211/980 (21.53%), Postives = 393/980 (40.10%), Query Frame = 3
Query: 1011 GLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHK-CNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHN-EGYISYHHFLQLF------EQKENLSAH---------KWLNSNH--------KVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLN-RTGYISVEDLKKIFKKLFGY-LKDDDIDRLVAPLTL-KDKKGRIN---YLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDF------LNRFQIRDDM-------VDGHKWL-------DSKHRFN-DPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVT--SGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYD-TNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGT----HLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGF-----EGPDDSLSYEKFCCIFQDSLNIDGQEKTVGSIRINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMK 3758
            G+     ++ LL +    I + +S  R  FL ++   +G +      KILN+F F +S +  + I+        G I +  FLQ F+  Q ++L+     + S+HK   P + +  + + + +   +S++I N +S+    F  ++    G I   +  KI  +   Y+  D +  ++  L   + +G I+Y     L          E LS           K  + NH        K+ E R +L +S E +   I D I     N    +   + N + G I+   L+K+  + FGY L ++   ++   L      K RI+   +L +F   +   S +DL      + +SN       H N I         G+   N M+ +E+   ++ +IV N  +    + K++ ++ KG + KS  +  L      + N+QF  + E L      KS++ +N FL     NR    D M D      S H  ND   +   +M+ ++V  LL +KI   F ++   F     S  G++   + Q+ L    I +   +   L ++     ++KL Y+DF      L +F   D M        + H  L       ++KH+ + D        +  E ++ ++   +   + + +  F A+    + TGF    +L  LLS+L + ++  +  +L  R       + L Y          EKF C         I Q+S N           +  Q ++N + +G     +L+   +  ++ + +   YS+    F  +  +   SG+ ++N+   LL    + +T+ +F +    +          DD + Y  F   F   +N             N D+++ S      A N+   QI   I + I  +      +F   D  +  ++S ++FR ++  F  ++ D  F K+ ++L        N  D ++Y  F+K
Sbjct:   41 GVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFE--QKENLSAHK-WLNSNHKVVEPRKDL--QLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMEYIDKLGEARLNL-MSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQ-FGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIF--ADNRESSNDLMTDVCFLPKSN------HHVNDIR--------GDDNRN-MNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSN-KGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLG--VGEKSKLTYNDFL-----NRFQIRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLTGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSY----------EKFCC---------IFQDSLNIDGQEKTVGSIRINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPEN--SGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGFNQKVN-------------NLDIQSMSANPAANASNMTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNL------KKNEFDNVNYGEFVK 948          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Planmine SMEST
Match: SMESG000052556.1 (SMESG000052556.1)

HSP 1 Score: 2088.54 bits (5410), Expect = 0.000e+0
Identity = 1060/1071 (98.97%), Postives = 1065/1071 (99.44%), Query Frame = 3
Query: 1305 IAIKSDHKCNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHKWLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQEKTVGSIRINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGFNQKLNNLDIQXXXXXXXXXXXXXTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLKKNEFDNVNYGEFVKMXXXXXXXXXXXXXXXXXXXXXXXXXXNNIETDEMDTDESIRKNLERLLNRNWQSIFNKCKAIDQAINECQTAEGSIPIDDFVYILSEYDDSLSAENLAAINLYKTCKNGRFIKYGDLIRSIVLSSRGSLISNENVTEVQKKFLNVGIKT 4517
            I++  D  CNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHKWLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKME I+KLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTL+GFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQEKTVGSIRINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGFNQK+NNLDIQSMSANPAANASNMTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLKKNEFDNVNYGEFVKMISESSETDDDKKSKISKTKVKIKEETNNIETDEMDTDESIRKNLERLLNRNWQSIFNKCKAIDQAINECQTAEGSIPIDDFVYILSEYDDSLSAENLAAINLYKTCKNGRFIKYGDLIRSIVLSSRGSLISNENVTEVQKKFLNVGIK 
Sbjct:   10 ISLVIDLACNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENLSAHKWLNSNHKVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMEYIDKLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLTGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSYEKFCCIFQDSLNIDGQEKTVGSIRINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGFNQKVNNLDIQSMSANPAANASNMTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLKKNEFDNVNYGEFVKMISESSETDDDKKSKISKTKVKIKEETNNIETDEMDTDESIRKNLERLLNRNWQSIFNKCKAIDQAINECQTAEGSIPIDDFVYILSEYDDSLSAENLAAINLYKTCKNGRFIKYGDLIRSIVLSSRGSLISNENVTEVQKKFLNVGIKV 1080          

HSP 2 Score: 113.235 bits (282), Expect = 8.093e-25
Identity = 170/797 (21.33%), Postives = 346/797 (43.41%), Query Frame = 3
Query:  711 IMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFS-QSQNGNVNYMEFMKGMGI---PIDNQGTIQTKNSEETINIDTRNTKGSRIFEAALIENGLLGSNEL-----EQLLVIFRKKIED---QFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGK--IIWLSFLQKFQDPQSKH---LNGSTIAIKSDHKCNPIQG-VNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFEQKENL-SAHKWLNSNHKVVEPRKDL--QLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLE-LFNLLNVDT-SPSDLEGLSTQIAESNDAQLKERHEN----HIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHE--LYKKYECNDK--KGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRE-SSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKL------GVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFL 2987
            ++  F L D N    I    LKK+ +     L +   D+LVA  + + + G +NY+E    + +   P D +G   +    E+ +   +    + I +   I+   LG   L     E+L+V  + +I      +  L K +   D   +G +    L K+L QF + ++   F++I +   F  + K  I +  FL  F D +      +       KS+H  N I+G  N   N  ++ +LL   I NN+     AF + ++++KG + KS+F   L      I  DQ  ++ + L    +  ++Y+ FL  F+ ++++   HKWL+S H+  +P  +    +S+E +   + + I   +  +   F  +  + TG+I   +L+ +  +L   +   ++ +L       + + +++Y + L+NL  ++     DL G S  I +++   L +   N    H + +++   LG      +  E L   +K  +   R+ Y +  L  K   N K   G    + L K+L+Q    +TN++F +++  + F     S + +  F  IF D+      +       + +   + + I  ++  N+N  ++  ++ ++IV+ + ++   F   D  N GY+  ++F+N L+G  + + + QF+     L            K+ Y  F+  F  + +       LD +    +P+ NA  +M+ + +   + E I         +F +   +   FI   + + ++ R   ++  S  +K W     N  + ++Y +F+
Sbjct:  155 VVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEGL--STQIAESNDAQLKERHENHIEKMEYIDK--LGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECND--KKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYD-TNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTH----LHVEHLFEMVKRHL---RVAYSDSALAFKAVANKKTLTGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDS-LSYEKFCCIFQDSLNIDGQEKTVGSIRINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGFNQKVNN------LDIQSMSANPAANA-SNMTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNLKKNEFDNVNYGEFV 929          

HSP 3 Score: 77.0258 bits (188), Expect = 1.126e-13
Identity = 211/980 (21.53%), Postives = 393/980 (40.10%), Query Frame = 3
Query: 1011 GLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHK-CNPIQGVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHN-EGYISYHHFLQLF------EQKENLSAH---------KWLNSNH--------KVVEPRKDLQLSSETIKSTISDNIGNKWSNVVHEFNLVDLN-RTGYISVEDLKKIFKKLFGY-LKDDDIDRLVAPLTL-KDKKGRIN---YLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLGVGEKSKLTYNDF------LNRFQIRDDM-------VDGHKWL-------DSKHRFN-DPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVT--SGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYD-TNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGT----HLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGF-----EGPDDSLSYEKFCCIFQDSLNIDGQEKTVGSIRINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMK 3758
            G+     ++ LL +    I + +S  R  FL ++   +G +      KILN+F F +S +  + I+        G I +  FLQ F+  Q ++L+     + S+HK   P + +  + + + +   +S++I N +S+    F  ++    G I   +  KI  +   Y+  D +  ++  L   + +G I+Y     L          E LS           K  + NH        K+ E R +L +S E +   I D I     N    +   + N + G I+   L+K+  + FGY L ++   ++   L      K RI+   +L +F   +   S +DL      + +SN       H N I         G+   N M+ +E+   ++ +IV N  +    + K++ ++ KG + KS  +  L      + N+QF  + E L      KS++ +N FL     NR    D M D      S H  ND   +   +M+ ++V  LL +KI   F ++   F     S  G++   + Q+ L    I +   +   L ++     ++KL Y+DF      L +F   D M        + H  L       ++KH+ + D        +  E ++ ++   +   + + +  F A+    + TGF    +L  LLS+L + ++  +  +L  R       + L Y          EKF C         I Q+S N           +  Q ++N + +G     +L+   +  ++ + +   YS+    F  +  +   SG+ ++N+   LL    + +T+ +F +    +          DD + Y  F   F   +N             N D+++ S      A N+   QI   I + I  +      +F   D  +  ++S ++FR ++  F  ++ D  F K+ ++L        N  D ++Y  F+K
Sbjct:   23 GVNSKPNIDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFE--QKENLSAHK-WLNSNHKVVEPRKDL--QLSSETIKSTISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDRLVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKERHENHIEKMEYIDKLGEARLNL-MSPEELIVRIKDRIVQNRLNYHELYKKYECNDKKGGINKSQLRKMLTQ-FGYTLTNEQFSKISEILNFPTSSKSRIDFNGFLAIF--ADNRESSNDLMTDVCFLPKSN------HHVNDIR--------GDDNRN-MNCQEVEDLLRQKIVNNFPDLMIAFHKFDRSN-KGYLVKSDFQNFLLGNLIMIENDQFDLLCEKLG--VGEKSKLTYNDFL-----NRFQIRDDMVDGHKWLDSKHRFNDPSTNAVPDMSAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQISMSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQNSHNALVDHLVNQETKHQQSVDNQAVLGTHLHVEHLFEMVKRHLRVAYSDSALAFKAVANKKTLTGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEGPDDSLSY----------EKFCC---------IFQDSLNIDGQEKTVGSIRINQDLENPSKIGIEEAGNLNSTQIASIIGKRIVDQYSEIEKTFLVMDPEN--SGYVSMNEFRNLLVGFCLSLTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGFNQKVN-------------NLDIQSMSANPAANASNMTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFREIIERFLFTVPDSHFEKFWSNL------KKNEFDNVNYGEFVK 930          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Planmine SMEST
Match: SMESG000052552.1 (SMESG000052552.1)

HSP 1 Score: 829.706 bits (2142), Expect = 0.000e+0
Identity = 419/424 (98.82%), Postives = 422/424 (99.53%), Query Frame = 3
Query:   57 MTTDITDSLIVRKSIYREPIQSNSLNQPEKNSTIKDANYKMDPKLQISEINPIVKSQLLKNHKEILKALQTFDIECSGLVTKGELRRVLDSYCLPMTTDQYEQFLSHNSINYSKGSINYKELIDKIYDKTSAVGHFKKNIKLPQLQRSATTICLQNKHFTLPTTRRSSGKISRSQLFXXXXXXXXXXXXXXXXWNYNAYTIDDIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETINIDTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHK 1328
            MTTDITDSLIVRKSI REPIQSNSLNQPEKNSTIKDANYKM+PKLQISEINPIVKSQLLKNHKEILKALQTFDIECSGLVTKGELRRVLDSYCLPMTTDQYEQFLSHNSINYSKGSINYKELIDKIYDKTSAVGHF+KNIKLPQLQRSATTICLQNKHFTLPTTRRSSGKISRSQLFSQCSSRSLNSQQSSRSWNYNAYTIDDIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETINIDTRNTK SRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKI+WLSFLQKFQDPQSKHLNGSTIAIKSDHK
Sbjct:    1 MTTDITDSLIVRKSICREPIQSNSLNQPEKNSTIKDANYKMNPKLQISEINPIVKSQLLKNHKEILKALQTFDIECSGLVTKGELRRVLDSYCLPMTTDQYEQFLSHNSINYSKGSINYKELIDKIYDKTSAVGHFEKNIKLPQLQRSATTICLQNKHFTLPTTRRSSGKISRSQLFSQCSSRSLNSQQSSRSWNYNAYTIDDIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETINIDTRNTKESRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIVWLSFLQKFQDPQSKHLNGSTIAIKSDHK 424          

HSP 2 Score: 72.0182 bits (175), Expect = 1.533e-12
Identity = 83/381 (21.78%), Postives = 168/381 (44.09%), Query Frame = 3
Query:  657 IDDIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFS-QSQNGNVNYME--------------FMKGMGIPI--DNQGTIQTKNSEETINIDTRNT-KGSRIFEAALIENGLLGSNE-----------LEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSFLQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSKPN-----------------IDDLLELLSNHISNNYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDPHNEGYISYHHFLQLFE--QKENLSAHK-WLNSNHK 1652
            I +I PI++ Q+ +N   I+KA + FD      + +  L++V++++C P+T  Q+++ ++  S     G++NY E              F K + +P    +  TI  +N   T+    R++ K SR    +   +  L S +           ++ ++ I + +I    + + K F + D N++  +    L K++  F  P++   F++++ + +    G + ++ F++    P     N  TI  K+  +   I   N+K +                 ++ LL +    I + +S  R  FL ++   +G +      KILN+F F +S +  + I+        G I +  FLQ F+  Q ++L+     + S+HK
Sbjct:   47 ISEINPIVKSQLLKNHKEILKALQTFDIECSGLVTKGELRRVLDSYCLPMTTDQYEQFLSHNSINYSKGSINYKELIDKIYDKTSAVGHFEKNIKLPQLQRSATTICLQNKHFTLPTTRRSSGKISRSQLFSQCSSRSLNSQQSSRSWNYNAYTIDDIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPLTEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPID---NQGTIQTKNSEETINIDTRNTKESRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLVMDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIVWLSFLQKFQDPQSKHLNGSTIAIKSDHK 424          
The following BLAST results are available for this feature:
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
EFCAB64.816e-5722.26EF-hand calcium binding domain 6 [Source:HGNC Symb... [more]
EFCAB69.005e-5722.14EF-hand calcium binding domain 6 [Source:HGNC Symb... [more]
EFCAB61.193e-630.86EF-hand calcium binding domain 6 [Source:HGNC Symb... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
immp2l2.606e-13025.69inner mitochondrial membrane peptidase subunit 2 [... [more]
immp2l8.361e-12224.96inner mitochondrial membrane peptidase subunit 2 [... [more]
immp2l7.694e-9525.82inner mitochondrial membrane peptidase subunit 2 [... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Efcab65.099e-4919.42EF-hand calcium binding domain 6 [Source:MGI Symbo... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q5THR3|EFCB6_HUMAN4.324e-5622.14EF-hand calcium-binding domain-containing protein ... [more]
sp|Q5RE62|EFCB6_PONAB2.872e-4922.07EF-hand calcium-binding domain-containing protein ... [more]
sp|Q6P1E8|EFCB6_MOUSE4.450e-4819.42EF-hand calcium-binding domain-containing protein ... [more]
sp|Q4R8T1|EFCB6_MACFA1.571e-2120.15EF-hand calcium-binding domain-containing protein ... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267H1X40.000e+029.90Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267FVL10.000e+029.73Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267DTE80.000e+029.73Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EGC40.000e+030.35Uncharacterized protein OS=Macrostomum lignano OX=... [more]
K1R9E23.615e-2228.73EF-hand calcium-binding domain-containing protein ... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000042990.19.172e-2124.54EF-hand calcium-binding domain-containing protein ... [more]
ENSAMXT00000045911.15.427e-623.85pep primary_assembly:Astyanax_mexicanus-2.0:24:368... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000004536.16.061e-13924.12pep scaffold:Pmarinus_7.0:GL477109:94389:131012:-1... [more]
ENSPMAT00000004547.12.239e-11622.53pep scaffold:Pmarinus_7.0:GL477109:94389:129511:-1... [more]
ENSPMAT00000004557.17.736e-2722.35pep scaffold:Pmarinus_7.0:GL477109:94389:108111:-1... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO282101.633e-5734.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465486.319e-1723.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320382.689e-1023.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO289437.168e-923.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000052556.18.561e-2598.97SMESG000052556.1[more]
SMESG000052556.18.093e-2598.97SMESG000052556.1[more]
SMESG000052552.11.533e-1298.82SMESG000052552.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023059 ID=SMED30023059|Name=EF-hand calcium-binding domain-containing protein 6|organism=Schmidtea mediterranea sexual|type=transcript|length=4864bp
TGCGTTTCTATAGTTACTTCAACGAAATAGTTTGAATTAATAATTCCAAA
TTAAAAATGACAACTGACATCACTGATTCGCTGATAGTACGGAAATCAAT
TTACCGAGAGCCAATTCAATCAAACTCGCTCAATCAACCGGAAAAGAATT
CAACAATAAAAGATGCGAATTACAAAATGGACCCAAAATTACAGATTTCA
GAAATCAATCCCATTGTCAAGTCACAGCTGCTCAAAAATCATAAAGAAAT
TTTAAAAGCCTTGCAGACCTTTGACATTGAATGCTCGGGACTCGTAACCA
AGGGGGAGTTGAGGCGAGTTCTAGATTCTTACTGCCTTCCTATGACCACA
GATCAATATGAACAATTTCTATCTCATAATTCGATAAACTACTCCAAGGG
ATCAATAAATTATAAAGAATTAATTGATAAAATTTACGACAAAACTTCGG
CAGTTGGGCATTTTAAGAAGAATATTAAGCTACCACAACTTCAGAGATCT
GCTACAACAATATGTTTACAAAACAAACATTTTACACTTCCAACAACTCG
CAGATCGAGCGGGAAAATTTCAAGATCCCAATTATTCAGTCAGTGCAGTT
CTAGGAGTTTGAATTCTCAACAAAGTTCTAGAAGTTGGAATTACAATGCA
TATACTATTGATGATATAATCCCAATATTGCAGATGCAGATTTCGCGAAA
TCCAAATGGAATAATGAAAGCATTTAAATTGTTTGATTTCAATTCTGATT
ATTGCATCCAAAGACACAGATTGAAGAAAGTAATGGAAAACTTTTGTTGT
CCTTTGACTGAACAGCAATTTGATAAATTGGTAGCAAGATTTAGTCAGTC
TCAAAACGGAAATGTAAATTATATGGAATTCATGAAAGGAATGGGCATTC
CCATTGATAATCAAGGAACAATTCAAACTAAAAATTCAGAAGAAACGATC
AACATTGATACTAGGAATACAAAGGGGAGTAGGATTTTCGAGGCTGCTTT
GATTGAAAATGGATTACTTGGATCTAATGAATTGGAACAACTTCTAGTAA
TTTTTAGGAAGAAAATTGAAGATCAATTTTCAGTTCTTAGAAAGACATTT
TTAGTAATGGACCCGAACGCAGAAGGCTTTGTAACTTTAGAAATCTTATA
TAAAATATTGAACCAGTTTGCATTTCCTATGTCACTTAATGTTTTCAACC
AAATAATGGACAAATGTGCATTCAAAGCAACAGGAAAAATAATTTGGTTA
TCATTTTTGCAAAAGTTCCAAGATCCACAATCGAAGCATTTAAATGGATC
AACTATTGCTATAAAATCCGATCACAAATGCAATCCAATCCAAGGCGTGA
ATTCCAAACCCAATATTGACGATTTATTGGAATTATTGTCCAATCACATT
AGCAATAATTACAGCTCATTTCGGGACGCATTTCTTCAAATAAATCAGAC
TCATAAAGGAAAAATCCCAAAATCAGAATTCCTAAAAATTCTCAACCGAT
TTCAATTCTATATTTCAGCGGATCAGCTAAGCATCATTCTAAAATTTTTG
GACCCCCATAATGAGGGATATATTTCATATCATCATTTCTTACAGCTTTT
TGAACAGAAGGAAAATTTAAGTGCACACAAATGGCTTAATTCGAACCACA
AAGTTGTTGAACCACGCAAAGACCTACAGCTAAGTTCAGAGACCATCAAG
TCAACAATATCGGATAATATTGGAAATAAATGGTCAAATGTCGTCCATGA
ATTTAATTTGGTTGATTTAAACCGAACTGGCTATATTTCTGTTGAGGACT
TGAAAAAGATCTTTAAAAAATTATTTGGCTACTTAAAAGATGACGATATT
GACAGATTAGTTGCCCCGCTTACCTTAAAAGACAAAAAGGGAAGAATAAA
TTATTTAGAACTTTTCAACTTATTAAATGTTGACACTTCACCATCTGACC
TAGAGGGTTTATCAACCCAGATAGCTGAATCAAATGATGCTCAATTGAAA
GAACGTCATGAAAATCATATTGAAAAAATGGAATCCATAGAAAAGCTGGG
AGAGGCCAGGCTTAATTTAATGAGTCCAGAAGAGTTAATTGTGAGAATTA
AAGACCGTATTGTTCAGAATCGTTTAAATTATCATGAGCTCTACAAGAAA
TACGAATGTAATGACAAAAAAGGCGGAATAAATAAAAGTCAATTAAGAAA
AATGCTAACGCAATTTGGGTACACATTGACCAATGAACAGTTCAGCAAAA
TAAGTGAAATCTTAAACTTTCCCACAAGTTCTAAATCTAGAATCGACTTC
AACGGGTTCTTAGCAATATTCGCAGACAATAGAGAAAGTTCTAACGACCT
TATGACCGATGTTTGTTTCCTTCCAAAAAGTAATCATCATGTCAATGACA
TTCGGGGAGATGATAATAGAAATATGAATTGTCAAGAAGTAGAGGATCTC
CTCCGTCAGAAAATAGTCAATAACTTTCCAGATTTGATGATAGCATTTCA
TAAATTTGACAGAAGTAACAAGGGTTACCTAGTAAAATCAGATTTTCAGA
ACTTTCTTTTGGGAAATCTTATTATGATCGAAAATGATCAGTTTGACTTG
TTGTGTGAAAAATTAGGTGTTGGAGAAAAGTCAAAATTAACTTACAATGA
TTTCCTAAATAGATTTCAGATCCGAGACGACATGGTCGATGGTCACAAAT
GGTTGGATTCAAAGCATAGATTCAATGACCCATCAACCAATGCAGTGCCT
GATATGTCAGCCGAAGACGTTTACATGCTGTTACCGGAAAAGATTTATCA
GTATTTCCATGAAATCTCCCCTACATTCATTGCTCTCGTCACAAGTGGTA
CTGGCTTTATCAGATTTAGAAATCTTCAACATCTTCTCTCAAGATTGCAA
ATAAGCATGTCAAAATCTGAAATGAAGAAACTTTGGAAAAGATACGACAC
AAATAATCGCAACAAGCTCGATTATCATGATTTCCTATACAATCTTGGTT
TGTTGGAGAAGTTTGGATGTGGTGATCTCATGGGTCCTAGTGCTGCCATT
ATACAGAATAGCCACAATGCCCTGGTGGACCATCTTGTCAATCAAGAAAC
GAAACATCAACAATCAGTAGATAATCAAGCCGTCCTGGGAACTCACTTGC
ATGTCGAGCATTTATTTGAAATGGTGAAAAGACATTTAAGAGTGGCCTAT
TCAGACTCAGCATTAGCTTTCAAAGCTGTTGCAAACAAGAAAACTTTGAG
TGGATTTTTTACTATTAATGATTTGAACAAACTGCTAAGTCAGCTTCATA
TGTTTGTTACAAATGACAAATTTGTACAATTGGCGGCAAGAATGGGGTTT
GAGGGCCCTGACGATTCATTGAGTTATGAGAAATTTTGCTGTATATTCCA
AGACTCATTAAACATTGATGGCCAGGAGAAAACAGTGGGATCTATTAGAA
TCAACCAAGATTTGGAAAACCCATCGAAAATTGGTATTGAAGAGGCTGGA
AACTTGAACAGCACCCAAATCGCATCAATTATTGGCAAAAGAATTGTTGA
TCAATATTCGGAAATTGAAAAGACATTCCTCGTAATGGATCCCGAGAATT
CTGGCTATGTCTCAATGAATGAATTTAGGAACCTCCTTGTTGGGTTCTGT
TTGAGCCTGACAGATAAACAGTTCAATAAATACAGAAATTCATTATCAAC
CTATATTGTAAAAAGTGCCAATACAGACGACAAAATAGACTATCGGTATT
TTATGAAGGGATTCAATCAAAAACTAAATAATCTGGACATCCAATCAATG
AGCGCGAATCCGGCGGCAAACGCATCTAACATGACCTATCAGCAAATTCA
AGAACACATCAACGAATCGATAAAAGTCCGTCCAAAACTCTTTCTAAACT
CCTTCAAATCCAAAGATTATGCTTCGTTGAATTTTATTTCCAAATCAGAT
TTCCGTGAAATCATTGAGCGCTTTTTATTTACGGTTCCCGATTCCCATTT
TGAGAAATTTTGGTCTAATTTAAAGAAAAATGAATTCGACAATGTTAATT
ATGGGGAATTTGTCAAAATGATTTCTGAATCTTCAGAAACTGATGATGAC
AAAAAATCGAAAATTTCTAAAACAAAAGTCAAAATCAAAGAAGAGACCAA
TAATATTGAAACTGATGAAATGGATACGGATGAAAGCATAAGAAAGAATC
TAGAAAGATTACTGAACAGAAATTGGCAAAGTATTTTCAATAAGTGCAAA
GCAATTGATCAAGCAATAAATGAATGTCAAACGGCGGAAGGATCCATTCC
AATTGATGATTTCGTATATATTTTATCAGAATATGACGATTCTTTGTCTG
CTGAAAATTTAGCTGCTATCAATTTGTATAAAACCTGTAAAAATGGAAGA
TTTATCAAATATGGTGATTTAATTCGAAGTATTGTTCTAAGTTCCCGAGG
CTCCTTGATTTCCAATGAAAATGTTACAGAGGTGCAGAAAAAGTTCTTGA
ATGTTGGAATCAAAACAACAAATTCTGACAACTCAAAAGATTATTTTCCT
CAACTATTCAAACTCCGCCGTCAGATATTGGAGAACTGGAAAGACCTACG
AAAGAATTTTCTACAAAGTGATAAGAAGCAAAATGGTGCCGTCAGCGGTA
ACATTTTCATGACAATCATGAAAACAGTTTGTGGCCAACTTAGTGCAGAC
TTATTTTACCATTTGATGAAGATTTATGATCAAGATGGAACGGGAAACTT
TCATTACAAAAGATTCATTGAAGATTTTCTTAAAACAGCCTAAAATGGTA
ATTTGAGCAAGACTCAGAGTACCTGATTAGGATTATATTCCTTTATTTTC
AAATGAAATTGCTG
back to top

protein sequence of SMED30023059-orf-1

>SMED30023059-orf-1 ID=SMED30023059-orf-1|Name=SMED30023059-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1579bp
MTTDITDSLIVRKSIYREPIQSNSLNQPEKNSTIKDANYKMDPKLQISEI
NPIVKSQLLKNHKEILKALQTFDIECSGLVTKGELRRVLDSYCLPMTTDQ
YEQFLSHNSINYSKGSINYKELIDKIYDKTSAVGHFKKNIKLPQLQRSAT
TICLQNKHFTLPTTRRSSGKISRSQLFSQCSSRSLNSQQSSRSWNYNAYT
IDDIIPILQMQISRNPNGIMKAFKLFDFNSDYCIQRHRLKKVMENFCCPL
TEQQFDKLVARFSQSQNGNVNYMEFMKGMGIPIDNQGTIQTKNSEETINI
DTRNTKGSRIFEAALIENGLLGSNELEQLLVIFRKKIEDQFSVLRKTFLV
MDPNAEGFVTLEILYKILNQFAFPMSLNVFNQIMDKCAFKATGKIIWLSF
LQKFQDPQSKHLNGSTIAIKSDHKCNPIQGVNSKPNIDDLLELLSNHISN
NYSSFRDAFLQINQTHKGKIPKSEFLKILNRFQFYISADQLSIILKFLDP
HNEGYISYHHFLQLFEQKENLSAHKWLNSNHKVVEPRKDLQLSSETIKST
ISDNIGNKWSNVVHEFNLVDLNRTGYISVEDLKKIFKKLFGYLKDDDIDR
LVAPLTLKDKKGRINYLELFNLLNVDTSPSDLEGLSTQIAESNDAQLKER
HENHIEKMESIEKLGEARLNLMSPEELIVRIKDRIVQNRLNYHELYKKYE
CNDKKGGINKSQLRKMLTQFGYTLTNEQFSKISEILNFPTSSKSRIDFNG
FLAIFADNRESSNDLMTDVCFLPKSNHHVNDIRGDDNRNMNCQEVEDLLR
QKIVNNFPDLMIAFHKFDRSNKGYLVKSDFQNFLLGNLIMIENDQFDLLC
EKLGVGEKSKLTYNDFLNRFQIRDDMVDGHKWLDSKHRFNDPSTNAVPDM
SAEDVYMLLPEKIYQYFHEISPTFIALVTSGTGFIRFRNLQHLLSRLQIS
MSKSEMKKLWKRYDTNNRNKLDYHDFLYNLGLLEKFGCGDLMGPSAAIIQ
NSHNALVDHLVNQETKHQQSVDNQAVLGTHLHVEHLFEMVKRHLRVAYSD
SALAFKAVANKKTLSGFFTINDLNKLLSQLHMFVTNDKFVQLAARMGFEG
PDDSLSYEKFCCIFQDSLNIDGQEKTVGSIRINQDLENPSKIGIEEAGNL
NSTQIASIIGKRIVDQYSEIEKTFLVMDPENSGYVSMNEFRNLLVGFCLS
LTDKQFNKYRNSLSTYIVKSANTDDKIDYRYFMKGFNQKLNNLDIQSMSA
NPAANASNMTYQQIQEHINESIKVRPKLFLNSFKSKDYASLNFISKSDFR
EIIERFLFTVPDSHFEKFWSNLKKNEFDNVNYGEFVKMISESSETDDDKK
SKISKTKVKIKEETNNIETDEMDTDESIRKNLERLLNRNWQSIFNKCKAI
DQAINECQTAEGSIPIDDFVYILSEYDDSLSAENLAAINLYKTCKNGRFI
KYGDLIRSIVLSSRGSLISNENVTEVQKKFLNVGIKTTNSDNSKDYFPQL
FKLRRQILENWKDLRKNFLQSDKKQNGAVSGNIFMTIMKTVCGQLSADLF
YHLMKIYDQDGTGNFHYKRFIEDFLKTA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR002048EF_hand_dom
IPR011992EF-hand-dom_pair
IPR018247EF_Hand_1_Ca_BS
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0016765transferase activity, transferring alkyl or aryl (other than methyl) groups
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002048EF-hand domainSMARTSM00054efh_1coord: 955..983
e-value: 3.8
score: 13.1
coord: 454..482
e-value: 20.0
score: 7.2
coord: 1169..1197
e-value: 0.071
score: 22.2
coord: 561..589
e-value: 0.87
score: 18.2
coord: 343..371
e-value: 75.0
score: 2.6
coord: 64..92
e-value: 3.3
score: 13.6
coord: 218..246
e-value: 19.0
score: 7.4
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 951..986
score: 8.99
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 486..521
score: 7.037
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 250..285
score: 6.731
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 566..592
score: 9.66
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 339..374
score: 7.065
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 1509..1544
score: 6.982
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 1165..1200
score: 11.305
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 608..629
score: 5.838
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 805..840
score: 7.205
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 60..95
score: 8.99
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 450..485
score: 7.735
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 1545..1578
score: 5.615
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 703..723
score: 5.838
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 214..249
score: 7.372
IPR002048EF-hand domainCDDcd00051EFhcoord: 219..279
e-value: 1.08816E-6
score: 45.2313
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 913..1134
e-value: 1.9E-13
score: 52.3
NoneNo IPR availablePFAMPF13833EF-hand_8coord: 466..517
e-value: 0.0014
score: 18.5
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 1500..1574
e-value: 4.5E-10
score: 41.2
coord: 48..125
e-value: 2.5E-9
score: 38.9
coord: 1153..1236
e-value: 1.7E-10
score: 42.6
coord: 675..755
e-value: 4.0E-6
score: 28.6
coord: 545..622
e-value: 4.2E-9
score: 38.1
coord: 202..278
e-value: 7.8E-14
score: 53.3
coord: 438..515
e-value: 1.8E-10
score: 42.5
coord: 792..871
e-value: 6.2E-8
score: 34.4
coord: 1261..1339
e-value: 3.0E-6
score: 29.0
coord: 327..405
e-value: 1.4E-8
score: 36.5
NoneNo IPR availablePANTHERPTHR20875FAMILY NOT NAMEDcoord: 897..1096
coord: 1140..1326
NoneNo IPR availablePANTHERPTHR20875:SF2EF-HAND CALCIUM-BINDING DOMAIN-CONTAINING PROTEIN 6coord: 897..1096
NoneNo IPR availablePANTHERPTHR20875:SF2EF-HAND CALCIUM-BINDING DOMAIN-CONTAINING PROTEIN 6coord: 542..623
NoneNo IPR availablePANTHERPTHR20875FAMILY NOT NAMEDcoord: 636..763
NoneNo IPR availablePANTHERPTHR20875FAMILY NOT NAMEDcoord: 28..535
NoneNo IPR availablePANTHERPTHR20875FAMILY NOT NAMEDcoord: 1322..1575
NoneNo IPR availablePANTHERPTHR20875:SF2EF-HAND CALCIUM-BINDING DOMAIN-CONTAINING PROTEIN 6coord: 780..946
NoneNo IPR availablePANTHERPTHR20875:SF2EF-HAND CALCIUM-BINDING DOMAIN-CONTAINING PROTEIN 6coord: 636..763
coord: 1140..1326
NoneNo IPR availablePANTHERPTHR20875:SF2EF-HAND CALCIUM-BINDING DOMAIN-CONTAINING PROTEIN 6coord: 1322..1575
NoneNo IPR availablePANTHERPTHR20875:SF2EF-HAND CALCIUM-BINDING DOMAIN-CONTAINING PROTEIN 6coord: 28..535
NoneNo IPR availablePANTHERPTHR20875FAMILY NOT NAMEDcoord: 542..623
NoneNo IPR availablePANTHERPTHR20875FAMILY NOT NAMEDcoord: 780..946
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 570..582
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 326..403
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 608..757
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 58..279
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 809..980
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 454..623
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 1165..1339
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 1500..1573