Polypyrimidine tract-binding protein 1

Overview
NamePolypyrimidine tract-binding protein 1
Smed IDSMED30023057
Length (bp)1738
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Polypyrimidine tract-binding protein 1 (SMED30023057) t-SNE clustered cells

Violin plots show distribution of expression levels for Polypyrimidine tract-binding protein 1 (SMED30023057) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Polypyrimidine tract-binding protein 1 (SMED30023057) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Polypyrimidine tract-binding protein 1 (SMED30023057) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023057

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30023057SMESG000018057.1 SmedASXL_010766SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30023057SMESG000018057.1 SmedASXL_010766SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30023057SMESG000018057.1 dd_Smed_v4_2799_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30023057SMESG000018057.1 dd_Smed_v4_2799_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023057SMESG000018057.1 dd_Smed_v4_2799_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023057SMESG000018057.1 dd_Smed_v4_2799_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023057SMESG000018057.1 dd_Smed_v4_2799_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023057SMESG000018057.1 dd_Smed_v4_2799_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30023057SMESG000018057.1 dd_Smed_v4_2799_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023057SMESG000018057.1 dd_Smed_v6_2799_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Human
Match: PTBP2 (polypyrimidine tract binding protein 2 [Source:HGNC Symbol;Acc:HGNC:17662])

HSP 1 Score: 345.51 bits (885), Expect = 7.066e-112
Identity = 205/531 (38.61%), Postives = 297/531 (55.93%), Query Frame = 3
Query:  111 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNN-NSNIDKL------VQSANEKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMEDAN-HGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            N  KK K E  +D  PSRV+HIR +P EV +T V  L +PFG + NI+ ++  NQA +++     AI M +Y++   P +  + ++IQ+S H++L   N  N     +      VQ+AN       ++ +  T   S +LRI+IDN     +   V ++IFS+FG +++I++FTKNNQ   L+++   +++  A+L L+G N+   C T+RIDFSK    L V+  +DK RDY      R +L   +G     P  A                    +A A +T +   P A    A   AA              G  +                GN+V+LV+NLN E   P +LFTLFGVYGDV RVK+++NKK++AL+Q A+  Q+  A+ +L+   ++GK + + +SK   +QLP E  +  GLTKD+ NS LHRFKKP SKN+QNIFPPSA +HLSNIPP+ +E DL  +    G  VK FKF   D KMALL++ +VE+AI  LI+ HN  L E +HLR+SFSK+
Sbjct:   42 NDSKKFKGEDKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAAITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQAVLQAVTAVQTANTPLSGTTVSESAVTPAQSPVLRIIIDNM-YYPVTLDVLHQIFSKFGAVLKIITFTKNNQFQALLQYGDPVNAQQAKLALDGQNIYNACCTLRIDFSKLVN-LNVKYNNDKSRDY-----TRPDLPSGDGQPALDPAIA--------------------AAFAKETSLLAVPGALSPLAIPNAAAAAAAAAAGRVGMPGVSAG---------------GNTVLLVSNLNEEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMNHLNGQKMYGKIIRVTLSKHQTVQLPREGLDDQGLTKDFGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVAEEDLRTLFANTGGTVKAFKFFQRDHKMALLQMATVEEAIQALIDLHNYNLGENHHLRVSFSKS 530          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Human
Match: PTBP2 (polypyrimidine tract binding protein 2 [Source:HGNC Symbol;Acc:HGNC:17662])

HSP 1 Score: 345.51 bits (885), Expect = 9.931e-112
Identity = 208/531 (39.17%), Postives = 303/531 (57.06%), Query Frame = 3
Query:  111 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNN-NSNIDKL------VQSANEKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMEDAN-HGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            N  KK K E  +D  PSRV+HIR +P EV +T V  L +PFG + NI+ ++  NQA +++     AI M +Y++   P +  + ++IQ+S H++L   N  N     +      VQ+AN       ++ +  T   S +LRI+IDN     +   V ++IFS+FG +++I++FTKNNQ   L+++   +++  A+L L+G N+   C T+RIDFSK    L V+  +DK RDY      R +L   +G     P  A                    +A A +T +   P AA+  A    A        A  +    G       M   ++G   GN+V+LV+NLN E   P +LFTLFGVYGDV RVK+++NKK++AL+Q A+  Q+  A+ +L+   ++GK + + +SK   +QLP E  +  GLTKD+ NS LHRFKKP SKN+QNIFPPSA +HLSNIPP+ +E DL  +    G  VK FKF   D KMALL++ +VE+AI  LI+ HN  L E +HLR+SFSK+
Sbjct:   42 NDSKKFKGEDKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAAITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQAVLQAVTAVQTANTPLSGTTVSESAVTPAQSPVLRIIIDNM-YYPVTLDVLHQIFSKFGAVLKIITFTKNNQFQALLQYGDPVNAQQAKLALDGQNIYNACCTLRIDFSKLVN-LNVKYNNDKSRDY-----TRPDLPSGDGQPALDPAIA--------------------AAFAKETSLLGLPVAAVPGALSPLAIPNAAAAAAAAAAGRVG-------MPGVSAG---GNTVLLVSNLNEEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMNHLNGQKMYGKIIRVTLSKHQTVQLPREGLDDQGLTKDFGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVAEEDLRTLFANTGGTVKAFKFFQRDHKMALLQMATVEEAIQALIDLHNYNLGENHHLRVSFSKS 535          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Human
Match: PTBP3 (polypyrimidine tract binding protein 3 [Source:HGNC Symbol;Acc:HGNC:10253])

HSP 1 Score: 343.199 bits (879), Expect = 4.776e-111
Identity = 202/537 (37.62%), Postives = 295/537 (54.93%), Query Frame = 3
Query:  111 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRN----NNSNIDKLVQSANEKRKHYLINWANNTG----GASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFG-----SNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPME-DANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            N  KK K ++     PSRV+H+R +P +V +  +  L +PFG + N++ ++  +QA ++M     A+ M +Y+    P +  + ++IQ+S H++L   N      +       SA +     L    +N G    G S +LRI+I+N     +   V ++IFS+FG +++I++FTKNNQ   L+++A  +++H A++ L+G N+   C T+RIDFSK    L V+  +DK RD+                            + +  G+ Q  +   ++A     G+  +P A  A  +      Q    +        G     S+     M  P +    GNSV+LVTNLN +   P  LF LFGVYGDV RVK+MFNKK  ALVQ A+  QA  A+ +L    L+GK +   +SK   +QLP E   + GLTKD+SNS LHRFKKP SKN+QNIFPPSA +HLSNIPP+ +  DL ++   AG  VK FKF   D+KMAL++L SVE+AI  LIE HN  L E +HLR+SFSK+
Sbjct:   15 NDSKKFKRDRP-PCSPSRVLHLRKIPCDVTEAEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMVNYYTPITPHLRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVSAVQSGSLALSGGPSNEGTVLPGQSPVLRIIIENL-FYPVTLEVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVNAHYAKMALDGQNIYNACCTLRIDFSKLTS-LNVKYNNDKSRDFTR--------------------------LDLPTGDGQPSLEPPMAAAFGAPGIISSPYAGAAGFAPAIGFPQATGLSVPAVPGALGPLTITSSAVTGRMAIPGASGIPGNSVLLVTNLNPDLITPHGLFILFGVYGDVHRVKIMFNKKENALVQMADANQAQLAMNHLSGQRLYGKVLRATLSKHQAVQLPREGQEDQGLTKDFSNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVTVDDLKNLFIEAGCSVKAFKFFQKDRKMALIQLGSVEEAIQALIELHNHDLGENHHLRVSFSKS 522          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Human
Match: PTBP3 (polypyrimidine tract binding protein 3 [Source:HGNC Symbol;Acc:HGNC:10253])

HSP 1 Score: 343.969 bits (881), Expect = 7.461e-111
Identity = 202/537 (37.62%), Postives = 295/537 (54.93%), Query Frame = 3
Query:  111 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRN----NNSNIDKLVQSANEKRKHYLINWANNTG----GASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFG-----SNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPME-DANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            N  KK K ++     PSRV+H+R +P +V +  +  L +PFG + N++ ++  +QA ++M     A+ M +Y+    P +  + ++IQ+S H++L   N      +       SA +     L    +N G    G S +LRI+I+N     +   V ++IFS+FG +++I++FTKNNQ   L+++A  +++H A++ L+G N+   C T+RIDFSK    L V+  +DK RD+                            + +  G+ Q  +   ++A     G+  +P A  A  +      Q    +        G     S+     M  P +    GNSV+LVTNLN +   P  LF LFGVYGDV RVK+MFNKK  ALVQ A+  QA  A+ +L    L+GK +   +SK   +QLP E   + GLTKD+SNS LHRFKKP SKN+QNIFPPSA +HLSNIPP+ +  DL ++   AG  VK FKF   D+KMAL++L SVE+AI  LIE HN  L E +HLR+SFSK+
Sbjct:   49 NDSKKFKRDRP-PCSPSRVLHLRKIPCDVTEAEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMVNYYTPITPHLRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVSAVQSGSLALSGGPSNEGTVLPGQSPVLRIIIENL-FYPVTLEVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVNAHYAKMALDGQNIYNACCTLRIDFSKLTS-LNVKYNNDKSRDFTR--------------------------LDLPTGDGQPSLEPPMAAAFGAPGIISSPYAGAAGFAPAIGFPQATGLSVPAVPGALGPLTITSSAVTGRMAIPGASGIPGNSVLLVTNLNPDLITPHGLFILFGVYGDVHRVKIMFNKKENALVQMADANQAQLAMNHLSGQRLYGKVLRATLSKHQAVQLPREGQEDQGLTKDFSNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVTVDDLKNLFIEAGCSVKAFKFFQKDRKMALIQLGSVEEAIQALIELHNHDLGENHHLRVSFSKS 556          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Human
Match: PTBP3 (polypyrimidine tract binding protein 3 [Source:HGNC Symbol;Acc:HGNC:10253])

HSP 1 Score: 342.813 bits (878), Expect = 1.402e-110
Identity = 202/537 (37.62%), Postives = 295/537 (54.93%), Query Frame = 3
Query:  111 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRN----NNSNIDKLVQSANEKRKHYLINWANNTG----GASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFG-----SNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMED-ANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            N  KK K ++     PSRV+H+R +P +V +  +  L +PFG + N++ ++  +QA ++M     A+ M +Y+    P +  + ++IQ+S H++L   N      +       SA +     L    +N G    G S +LRI+I+N     +   V ++IFS+FG +++I++FTKNNQ   L+++A  +++H A++ L+G N+   C T+RIDFSK    L V+  +DK RD+                            + +  G+ Q  +   ++A     G+  +P A  A  +      Q    +        G     S+     M  P +    GNSV+LVTNLN +   P  LF LFGVYGDV RVK+MFNKK  ALVQ A+  QA  A+ +L    L+GK +   +SK   +QLP E   + GLTKD+SNS LHRFKKP SKN+QNIFPPSA +HLSNIPP+ +  DL ++   AG  VK FKF   D+KMAL++L SVE+AI  LIE HN  L E +HLR+SFSK+
Sbjct:   43 NDSKKFKRDRP-PCSPSRVLHLRKIPCDVTEAEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMVNYYTPITPHLRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVSAVQSGSLALSGGPSNEGTVLPGQSPVLRIIIENL-FYPVTLEVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVNAHYAKMALDGQNIYNACCTLRIDFSKLTS-LNVKYNNDKSRDFTR--------------------------LDLPTGDGQPSLEPPMAAAFGAPGIISSPYAGAAGFAPAIGFPQATGLSVPAVPGALGPLTITSSAVTGRMAIPGASGIPGNSVLLVTNLNPDLITPHGLFILFGVYGDVHRVKIMFNKKENALVQMADANQAQLAMNHLSGQRLYGKVLRATLSKHQAVQLPREGQEDQGLTKDFSNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVTVDDLKNLFIEAGCSVKAFKFFQKDRKMALIQLGSVEEAIQALIELHNHDLGENHHLRVSFSKS 550          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Celegans
Match: ptb-1 (PTB (HnRNP) homolog; Putative RNA-binding protein PTB-1a [Source:UniProtKB/TrEMBL;Acc:Q18999])

HSP 1 Score: 288.886 bits (738), Expect = 1.812e-89
Identity = 188/520 (36.15%), Postives = 285/520 (54.81%), Query Frame = 3
Query:  159 SRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLVQSANEKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYM-------ESPLNRTELQELEGPQYSFPL----FAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPME-DANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKAG 1682
            S+V+H+RN+P ++ D  +  L + +G + N + ++  +QA ++  E   A             + G+ LF Q+S H++L    N + I      AN    ++ +         + +LR +I+N     ++  V Y++F+R+G+++RI++F KNN    LV+ +   S+ +A+  L   N+   C T+RID+SK    L V+  +DK RDY        E  L +T    + G Q   P     FA G + +        F+T QL+A  +          +  AA+L    N +   +A+ +        S ++M  P   + N   V+LV+NL+  K   DALFTLFGVYGDVMRVK+++NKK+ AL+Q++  QQA  A+ +LD      + + +  SK   +Q+P E   + GLT+DY++STLHRFKKP SKNY NI+PP A +HLSNIP + SE  L +M   AG+ VK FKF P D KMAL +L  +E AI  LI  HN KL+E  HLR+SFSK+G
Sbjct:  120 SKVVHVRNIPPDLVDVELMQLCIQYGPVSNYMMLKGKSQAFVEYEEEASAAAFVSGMTAVPIQIRGRTLFAQYSTHRELKFDKNKA-ISDTESVANGSVSNFEVGTQQQ---PNSVLRTIIENM-MFPVSLDVLYQLFTRYGKVLRIITFNKNNTFQALVQMSEANSAQLAKQGLENQNVYNGCCTLRIDYSKL-STLNVKYNNDKSRDYTNPNLPAGEMTLEQTIAMSIPGLQNLIPANPYNFAFGANPATT------FLTTQLAASTAAAAAVND---SANAAALAPYLNPLGLTSANLA-------PSISSMRFP---MINLTPVILVSNLHEMKVTTDALFTLFGVYGDVMRVKILYNKKDNALIQYSEPQQAQLALTHLDKVKWHDRLIRVAPSKHTNVQMPKEGQPDAGLTRDYAHSTLHRFKKPGSKNYLNIYPPCATLHLSNIPTSVSEEKLKEMFAEAGFAVKAFKFFPKDHKMALCQLEDIETAIDALIAMHNHKLAENAHLRVSFSKSG 614          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Celegans
Match: ptb-1 (PTB (HnRNP) homolog; Putative RNA-binding protein PTB-1a [Source:UniProtKB/TrEMBL;Acc:Q18999])

HSP 1 Score: 257.299 bits (656), Expect = 2.729e-79
Identity = 163/405 (40.25%), Postives = 234/405 (57.78%), Query Frame = 3
Query:  504 ILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYM-------ESPLNRTELQELEGPQYSFPL----FAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPME-DANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKAG 1682
            +LR +I+N     ++  V Y++F+R+G+++RI++F KNN    LV+ +   S+ +A+  L   N+   C T+RID+SK    L V+  +DK RDY        E  L +T    + G Q   P     FA G + +        F+T QL+A  +          +  AA+L    N +   +A+ +        S ++M  P   + N   V+LV+NL+  K   DALFTLFGVYGDVMRVK+++NKK+ AL+Q++  QQA  A+ +LD      + + +  SK   +Q+P E   + GLT+DY++STLHRFKKP SKNY NI+PP A +HLSNIP + SE  L +M   AG+ VK FKF P D KMAL +L  +E AI  LI  HN KL+E  HLR+SFSK+G
Sbjct:   69 VLRTIIENM-MFPVSLDVLYQLFTRYGKVLRIITFNKNNTFQALVQMSEANSAQLAKQGLENQNVYNGCCTLRIDYSKL-STLNVKYNNDKSRDYTNPNLPAGEMTLEQTIAMSIPGLQNLIPANPYNFAFGANPATT------FLTTQLAASTAAAAAVND---SANAAALAPYLNPLGLTSANLA-------PSISSMRFP---MINLTPVILVSNLHEMKVTTDALFTLFGVYGDVMRVKILYNKKDNALIQYSEPQQAQLALTHLDKVKWHDRLIRVAPSKHTNVQMPKEGQPDAGLTRDYAHSTLHRFKKPGSKNYLNIYPPCATLHLSNIPTSVSEEKLKEMFAEAGFAVKAFKFFPKDHKMALCQLEDIETAIDALIAMHNHKLAENAHLRVSFSKSG 452          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Celegans
Match: ptb-1 (PTB (HnRNP) homolog; Putative RNA-binding protein PTB-1a [Source:UniProtKB/TrEMBL;Acc:Q18999])

HSP 1 Score: 257.299 bits (656), Expect = 2.729e-79
Identity = 163/405 (40.25%), Postives = 234/405 (57.78%), Query Frame = 3
Query:  504 ILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYM-------ESPLNRTELQELEGPQYSFPL----FAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPME-DANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKAG 1682
            +LR +I+N     ++  V Y++F+R+G+++RI++F KNN    LV+ +   S+ +A+  L   N+   C T+RID+SK    L V+  +DK RDY        E  L +T    + G Q   P     FA G + +        F+T QL+A  +          +  AA+L    N +   +A+ +        S ++M  P   + N   V+LV+NL+  K   DALFTLFGVYGDVMRVK+++NKK+ AL+Q++  QQA  A+ +LD      + + +  SK   +Q+P E   + GLT+DY++STLHRFKKP SKNY NI+PP A +HLSNIP + SE  L +M   AG+ VK FKF P D KMAL +L  +E AI  LI  HN KL+E  HLR+SFSK+G
Sbjct:   69 VLRTIIENM-MFPVSLDVLYQLFTRYGKVLRIITFNKNNTFQALVQMSEANSAQLAKQGLENQNVYNGCCTLRIDYSKL-STLNVKYNNDKSRDYTNPNLPAGEMTLEQTIAMSIPGLQNLIPANPYNFAFGANPATT------FLTTQLAASTAAAAAVND---SANAAALAPYLNPLGLTSANLA-------PSISSMRFP---MINLTPVILVSNLHEMKVTTDALFTLFGVYGDVMRVKILYNKKDNALIQYSEPQQAQLALTHLDKVKWHDRLIRVAPSKHTNVQMPKEGQPDAGLTRDYAHSTLHRFKKPGSKNYLNIYPPCATLHLSNIPTSVSEEKLKEMFAEAGFAVKAFKFFPKDHKMALCQLEDIETAIDALIAMHNHKLAENAHLRVSFSKSG 452          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Celegans
Match: hrpl-1 (Heterogeneous nuclear RibonucleoProtein (HnRNP) L homolog [Source:UniProtKB/TrEMBL;Acc:Q95QR5])

HSP 1 Score: 60.077 bits (144), Expect = 1.678e-9
Identity = 50/223 (22.42%), Postives = 101/223 (45.29%), Query Frame = 3
Query:  156 PSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLVQSANEKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQE 824
            PS V+H+RN+ Q+V +  +      FG +     +  +  AL++  ++                  G    + F+   Q+++    +  +       E+     + + + T   +++L + + NA    I+  V Y+I +  G+++R+    K      LVEF S   +  A+  +NGA++   C T++++F+K P  ++VQRQ    RD+   P NR   ++
Sbjct:   30 PSIVVHVRNLHQKVTEADLLEALSNFGPVAYATCIPHSRMALVEFEDIE-----------------GAKACVNFATSNQINVGGQGALFNYSTSQCIER-----MGFESAT--PNKVLVVTVLNA-QYPIDADVIYQISNAQGKVLRVAVMHKPTVVQALVEFESMEVAKAAKHAMNGADIYSGCCTLKVEFAK-PDRVRVQRQDKDQRDFT-LPDNRRPYED 225          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Celegans
Match: hrpl-1 (Heterogeneous nuclear RibonucleoProtein (HnRNP) L homolog [Source:UniProtKB/TrEMBL;Acc:Q95QR5])

HSP 1 Score: 59.6918 bits (143), Expect = 3.962e-9
Identity = 47/211 (22.27%), Postives = 96/211 (45.50%), Query Frame = 3
Query:  156 PSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLVQSANEKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDY 788
            PS V+H+RN+ Q+V +  +      FG +     +  +  AL++  ++                  G    + F+   Q+++    +  +       E+     + + + T   +++L + + NA    I+  V Y+I +  G+++R+    K      LVEF S   +  A+  +NGA++   C T++++F+K P  ++VQRQ    RD+
Sbjct:   30 PSIVVHVRNLHQKVTEADLLEALSNFGPVAYATCIPHSRMALVEFEDIE-----------------GAKACVNFATSNQINVGGQGALFNYSTSQCIER-----MGFESAT--PNKVLVVTVLNA-QYPIDADVIYQISNAQGKVLRVAVMHKPTVVQALVEFESMEVAKAAKHAMNGADIYSGCCTLKVEFAK-PDRVRVQRQDKDQRDF 214          

HSP 2 Score: 53.9138 bits (128), Expect = 2.396e-7
Identity = 47/181 (25.97%), Postives = 73/181 (40.33%), Query Frame = 3
Query: 1101 NSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQ-----LPMEDANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSD-MIRIAGYEVKKFKFLP--NDKKMA-LLELNSVEDAIHVL 1616
              V+++  L   K N D LF +   YG+V+R+  M  K  T +++    ++    +  L    L+G  +    S    +        + D +    KDYS+S   RF  P       I  P+  +H  N P T  E  L D M     ++  K    P  N++  A   E  +VE A  VL
Sbjct:  307 GCVMMIYGLEHGKINCDMLFNILCQYGNVLRISFMRTKTETGIIELGTPEERQNVLDFLQGSALFGLTLEFKPSHQECVHHLRDPFLLPDGSPSF-KDYSSSRNQRFSTPELAAKNRIIFPTNTLHWFNAPGTMDEQALLDLMAEKTEHKPVKIDIFPSRNERSAAGTAEFETVEIANEVL 486          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Fly
Match: heph (gene:FBgn0011224 transcript:FBtr0346192)

HSP 1 Score: 333.183 bits (853), Expect = 1.632e-106
Identity = 217/573 (37.87%), Postives = 306/573 (53.40%), Query Frame = 3
Query:   99 NSFDNSHKKVKMEQGID-----EKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQL--DLRNNNSNI--DKLVQSANEKRKHYL-----------------------------INWANNT---GGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVE----LTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPME-DANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            N+ D + KK K+E G        K S+VIH+RN+P E  +  V  L +PFG + N++ ++  NQA I+M +   A  M   +    P M G+ +++QFS H++L  D  +NNS    D  VQS        L                             +N   NT   GG + +LR+++++     ++  + ++IF R+G++++IV+FTKNN    L+++    S+  A+  L+G N+   C T+RID SK    L V+  +DK RD+    L   E      P       A G    +   ND   + A+     S  G+     L P A      L    N      A  S    G+ Q+         G  N   V+LV+NLN E   PDALFTLFGVYGDV RVK+++NKK++AL+Q A  QQA  A+ +LD   LWGK + +  SK   +QLP E   + GLT+DYS + LHRFKKP SKNYQNI+PPSA +HLSNIP + SE D+ +      +EVK FKF P D+KMALL+L SVE+A+  LI+ HN +LSE NHLR+SFSK+
Sbjct:   48 NNQDLATKKAKLEPGTVLAGGIAKASKVIHLRNIPNESGEADVIALGIPFGRVTNVLVLKGKNQAFIEMADEISATSMVSCYTVTPPQMRGRMVYVQFSNHRELKTDQGHNNSTAHSDYSVQSPASGSPLPLSAAANATSNNANSSSDSNSAMGILQNTSAVNAGGNTNAAGGPNTVLRVIVESL-MYPVSLDILHQIFQRYGKVLKIVTFTKNNSFQALIQYPDANSAQHAKSLLDGQNIYNGCCTLRIDNSKLTA-LNVKYNNDKSRDFTNPALPPGE------PGVDIMPTAGG----LMNTNDLLLIAARQRPSLSVNGLGAPGVLPPFALGLGTPLTGGYNNALPNLAAFSLANSGALQTTAPAMR---GYSN---VLLVSNLNEEMVTPDALFTLFGVYGDVQRVKILYNKKDSALIQMAEPQQAYLAMSHLDKLRLWGKPIRVMASKHQAVQLPKEGQPDAGLTRDYSQNPLHRFKKPGSKNYQNIYPPSATLHLSNIPSSCSEDDIKEAFTSNSFEVKAFKFFPKDRKMALLQLLSVEEAVLALIKMHNHQLSESNHLRVSFSKS 602          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Fly
Match: heph (gene:FBgn0011224 transcript:FBtr0306692)

HSP 1 Score: 333.569 bits (854), Expect = 1.656e-104
Identity = 217/573 (37.87%), Postives = 306/573 (53.40%), Query Frame = 3
Query:   99 NSFDNSHKKVKMEQGID-----EKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQL--DLRNNNSNI--DKLVQSANEKRKHYL-----------------------------INWANNT---GGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVE----LTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPME-DANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            N+ D + KK K+E G        K S+VIH+RN+P E  +  V  L +PFG + N++ ++  NQA I+M +   A  M   +    P M G+ +++QFS H++L  D  +NNS    D  VQS        L                             +N   NT   GG + +LR+++++     ++  + ++IF R+G++++IV+FTKNN    L+++    S+  A+  L+G N+   C T+RID SK    L V+  +DK RD+    L   E      P       A G    +   ND   + A+     S  G+     L P A      L    N      A  S    G+ Q+         G  N   V+LV+NLN E   PDALFTLFGVYGDV RVK+++NKK++AL+Q A  QQA  A+ +LD   LWGK + +  SK   +QLP E   + GLT+DYS + LHRFKKP SKNYQNI+PPSA +HLSNIP + SE D+ +      +EVK FKF P D+KMALL+L SVE+A+  LI+ HN +LSE NHLR+SFSK+
Sbjct:  243 NNQDLATKKAKLEPGTVLAGGIAKASKVIHLRNIPNESGEADVIALGIPFGRVTNVLVLKGKNQAFIEMADEISATSMVSCYTVTPPQMRGRMVYVQFSNHRELKTDQGHNNSTAHSDYSVQSPASGSPLPLSAAANATSNNANSSSDSNSAMGILQNTSAVNAGGNTNAAGGPNTVLRVIVESL-MYPVSLDILHQIFQRYGKVLKIVTFTKNNSFQALIQYPDANSAQHAKSLLDGQNIYNGCCTLRIDNSKLTA-LNVKYNNDKSRDFTNPALPPGE------PGVDIMPTAGG----LMNTNDLLLIAARQRPSLSVNGLGAPGVLPPFALGLGTPLTGGYNNALPNLAAFSLANSGALQTTAPAMR---GYSN---VLLVSNLNEEMVTPDALFTLFGVYGDVQRVKILYNKKDSALIQMAEPQQAYLAMSHLDKLRLWGKPIRVMASKHQAVQLPKEGQPDAGLTRDYSQNPLHRFKKPGSKNYQNIYPPSATLHLSNIPSSCSEDDIKEAFTSNSFEVKAFKFFPKDRKMALLQLLSVEEAVLALIKMHNHQLSESNHLRVSFSKS 797          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Fly
Match: heph (gene:FBgn0011224 transcript:FBtr0306693)

HSP 1 Score: 333.954 bits (855), Expect = 7.782e-104
Identity = 217/573 (37.87%), Postives = 306/573 (53.40%), Query Frame = 3
Query:   99 NSFDNSHKKVKMEQGID-----EKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQL--DLRNNNSNI--DKLVQSANEKRKHYL-----------------------------INWANNT---GGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVE----LTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPME-DANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            N+ D + KK K+E G        K S+VIH+RN+P E  +  V  L +PFG + N++ ++  NQA I+M +   A  M   +    P M G+ +++QFS H++L  D  +NNS    D  VQS        L                             +N   NT   GG + +LR+++++     ++  + ++IF R+G++++IV+FTKNN    L+++    S+  A+  L+G N+   C T+RID SK    L V+  +DK RD+    L   E      P       A G    +   ND   + A+     S  G+     L P A      L    N      A  S    G+ Q+         G  N   V+LV+NLN E   PDALFTLFGVYGDV RVK+++NKK++AL+Q A  QQA  A+ +LD   LWGK + +  SK   +QLP E   + GLT+DYS + LHRFKKP SKNYQNI+PPSA +HLSNIP + SE D+ +      +EVK FKF P D+KMALL+L SVE+A+  LI+ HN +LSE NHLR+SFSK+
Sbjct:  342 NNQDLATKKAKLEPGTVLAGGIAKASKVIHLRNIPNESGEADVIALGIPFGRVTNVLVLKGKNQAFIEMADEISATSMVSCYTVTPPQMRGRMVYVQFSNHRELKTDQGHNNSTAHSDYSVQSPASGSPLPLSAAANATSNNANSSSDSNSAMGILQNTSAVNAGGNTNAAGGPNTVLRVIVESL-MYPVSLDILHQIFQRYGKVLKIVTFTKNNSFQALIQYPDANSAQHAKSLLDGQNIYNGCCTLRIDNSKLTA-LNVKYNNDKSRDFTNPALPPGE------PGVDIMPTAGG----LMNTNDLLLIAARQRPSLSVNGLGAPGVLPPFALGLGTPLTGGYNNALPNLAAFSLANSGALQTTAPAMR---GYSN---VLLVSNLNEEMVTPDALFTLFGVYGDVQRVKILYNKKDSALIQMAEPQQAYLAMSHLDKLRLWGKPIRVMASKHQAVQLPKEGQPDAGLTRDYSQNPLHRFKKPGSKNYQNIYPPSATLHLSNIPSSCSEDDIKEAFTSNSFEVKAFKFFPKDRKMALLQLLSVEEAVLALIKMHNHQLSESNHLRVSFSKS 896          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Fly
Match: heph (gene:FBgn0011224 transcript:FBtr0300265)

HSP 1 Score: 235.343 bits (599), Expect = 2.141e-70
Identity = 113/192 (58.85%), Postives = 143/192 (74.48%), Query Frame = 3
Query: 1107 VVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPME-DANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            V+LV+NLN E   PDALFTLFGVYGDV RVK+++NKK++AL+Q A  QQA  A+ +LD   LWGK + +  SK   +QLP E   + GLT+DYS + LHRFKKP SKNYQNI+PPSA +HLSNIP + SE D+ +      +EVK FKF P D+KMALL+L SVE+A+  LI+ HN +LSE NHLR+SFSK+
Sbjct:  300 VLLVSNLNEEMVTPDALFTLFGVYGDVQRVKILYNKKDSALIQMAEPQQAYLAMSHLDKLRLWGKPIRVMASKHQAVQLPKEGQPDAGLTRDYSQNPLHRFKKPGSKNYQNIYPPSATLHLSNIPSSCSEDDIKEAFTSNSFEVKAFKFFPKDRKMALLQLLSVEEAVLALIKMHNHQLSESNHLRVSFSKS 491          

HSP 2 Score: 75.485 bits (184), Expect = 3.838e-14
Identity = 58/207 (28.02%), Postives = 96/207 (46.38%), Query Frame = 3
Query:  303 EAIEMADYFNQYVPLMYGKHLFIQFSKHQQL--DLRNNNSNI--DKLVQSANEKRKHYL-----------------------------INWANNT---GGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTE 815
             A  M   +    P M G+ +++QFS H++L  D  +NNS    D  VQS        L                             +N   NT   GG + +LR+++++     ++  + ++IF R+G++++IV+FTKNN    L+++    S+  A+  L+G N+   C T+RID SK    L V+  +DK RD+    L   E
Sbjct:    6 SATSMVSCYTVTPPQMRGRMVYVQFSNHRELKTDQGHNNSTAHSDYSVQSPASGSPLPLSAAANATSNNANSSSDSNSAMGILQNTSAVNAGGNTNAAGGPNTVLRVIVESL-MYPVSLDILHQIFQRYGKVLKIVTFTKNNSFQALIQYPDANSAQHAKSLLDGQNIYNGCCTLRIDNSKLTA-LNVKYNNDKSRDFTNPALPPGE 210          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Fly
Match: heph (gene:FBgn0011224 transcript:FBtr0300268)

HSP 1 Score: 235.728 bits (600), Expect = 1.102e-69
Identity = 113/192 (58.85%), Postives = 143/192 (74.48%), Query Frame = 3
Query: 1107 VVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPME-DANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            V+LV+NLN E   PDALFTLFGVYGDV RVK+++NKK++AL+Q A  QQA  A+ +LD   LWGK + +  SK   +QLP E   + GLT+DYS + LHRFKKP SKNYQNI+PPSA +HLSNIP + SE D+ +      +EVK FKF P D+KMALL+L SVE+A+  LI+ HN +LSE NHLR+SFSK+
Sbjct:  388 VLLVSNLNEEMVTPDALFTLFGVYGDVQRVKILYNKKDSALIQMAEPQQAYLAMSHLDKLRLWGKPIRVMASKHQAVQLPKEGQPDAGLTRDYSQNPLHRFKKPGSKNYQNIYPPSATLHLSNIPSSCSEDDIKEAFTSNSFEVKAFKFFPKDRKMALLQLLSVEEAVLALIKMHNHQLSESNHLRVSFSKS 579          

HSP 2 Score: 124.79 bits (312), Expect = 7.482e-30
Identity = 85/280 (30.36%), Postives = 138/280 (49.29%), Query Frame = 3
Query:   99 NSFDNSHKKVKMEQGID-----EKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQL--DLRNNNSNI--DKLVQSANEKRKHYL-----------------------------INWANNT---GGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTE 815
            N+ D + KK K+E G        K S+VIH+RN+P E  +  V  L +PFG + N++ ++  NQA I+M +   A  M   +    P M G+ +++QFS H++L  D  +NNS    D  VQS        L                             +N   NT   GG + +LR+++++     ++  + ++IF R+G++++IV+FTKNN    L+++    S+  A+  L+G N+   C T+RID SK    L V+  +DK RD+    L   E
Sbjct:   21 NNQDLATKKAKLEPGTVLAGGIAKASKVIHLRNIPNESGEADVIALGIPFGRVTNVLVLKGKNQAFIEMADEISATSMVSCYTVTPPQMRGRMVYVQFSNHRELKTDQGHNNSTAHSDYSVQSPASGSPLPLSAAANATSNNANSSSDSNSAMGILQNTSAVNAGGNTNAAGGPNTVLRVIVESL-MYPVSLDILHQIFQRYGKVLKIVTFTKNNSFQALIQYPDANSAQHAKSLLDGQNIYNGCCTLRIDNSKLTA-LNVKYNNDKSRDFTNPALPPGE 298          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Zebrafish
Match: ptbp1a (polypyrimidine tract binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-050522-492])

HSP 1 Score: 340.117 bits (871), Expect = 2.465e-109
Identity = 206/539 (38.22%), Postives = 300/539 (55.66%), Query Frame = 3
Query:  111 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRN--NNSNIDKLVQSANEKRKHYL----INWANNTGGASEILRILIDNA--PNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTE------LQELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIEN-GNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMED-ANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            N  KK K +      PSRVIH+R +P ++++  V  L +PFG + N++ ++  NQA ++M     A  M  Y++   P++    +F+Q+S H++L   N  N       +Q+ N  +   +    I+ A   G  S +LR++++N   P   +   V ++IFS+FG +++I++FTKNNQ   LV+++  +++  A+L L+G N+   C T+RI FSK    L V+  +DK RDY    L   +       Q +     + P        + A G  Q F   Q + ++ Q G+     A   A+  +          A     G              SG+   GNSV+LV+NLN E   P  LF LFGVYGDVMRVK++FNKK  ALVQ ++  QA  A+ +L+   L+GK +   +SK   +QLP E   + GLTKDYSNS LHRFKKP SKNY NIFPPS+ +HLSNIPP+ +E DL  +   +G  VK FKF   D+KMAL++L SVE+AI  LI+FHN  L E +HLR+SFSK+
Sbjct:   57 NDSKKFKGDIRSPGIPSRVIHVRKLPNDINEAEVISLGLPFGKVTNLLMLKGKNQAFLEMNTEESAQTMVSYYSSVTPVIRNHPIFMQYSNHKELKTDNSPNQVRAQAALQAVNAVQTGGMSLAAIDGAG-MGSQSPVLRVIVENLFYP---VTLDVLHQIFSKFGTVLKIITFTKNNQFQALVQYSDGMTAQHAKLSLDGQNIYNACCTLRISFSKLTS-LNVKYNNDKSRDYTRPDLPTGDSQPSFDAQTMAAAALTAPGIISASPYAGAHGFPQAFAIQQAAGLSLQ-GMP----AGALASLSVPGAAAAAAAAAAAGRLGL-------------SGLTAAGNSVLLVSNLNPESVTPQCLFILFGVYGDVMRVKILFNKKENALVQMSDGTQAQLAMSHLNGQKLYGKALRATLSKHTTVQLPREGHEDQGLTKDYSNSPLHRFKKPGSKNYSNIFPPSSTLHLSNIPPSVTEDDLRGLFLSSGAVVKAFKFFQKDRKMALIQLASVEEAIESLIKFHNHDLGENHHLRVSFSKS 572          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Zebrafish
Match: ptbp3 (polypyrimidine tract binding protein 3 [Source:ZFIN;Acc:ZDB-GENE-091116-1])

HSP 1 Score: 335.495 bits (859), Expect = 2.501e-108
Identity = 200/527 (37.95%), Postives = 294/527 (55.79%), Query Frame = 3
Query:  156 PSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRN--NNSNIDKLVQSANEKRKHYL----INWANNTG---GASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVG---------RSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPME-DANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            PSRV+H+R VP EV +  V  L VPFG + N++ ++  NQA I+M     A+ M +Y+    P +  + ++IQ+S H++L   N  N       +Q+ N      +       A++ G   G S +LRI+++N     ++  V ++IFS+FG +++I++FTKNNQ   L+++A  +++H A++ L+G N+   C T+R++FSK    L V+  +DK RD+    L   + Q    P       A G            + A G  Q  ++ Q  AM    G    P             + M  R A           +  A+          +SV+LV+NLN +  +P  LF LFGVYGDV RVK++FNKK  AL+Q A+  QA  A+ +L+   L+GK + + +SK   +QLP E   + GLTKD+S S LHRFKKP SKN+QNIFPPSA +HLSNIPP+T++  L D+   +GY VK FKF   D+KMAL++L SVE+AI  LI  HN  L E +HLR+SFSK+
Sbjct:   19 PSRVLHVRKVPIEVSEAEVVSLGVPFGKVTNLLMLKGKNQAFIEMASEEAAMTMVNYYTTATPHVRNQPVYIQYSNHRELKTDNLPNQGRAQAALQAVNAVHTGNMSLSGTATASDGGMMPGQSPVLRIIVENL-YYPVSLEVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPMNAHHAKVALDGQNIYNGCCTLRVEFSKLTS-LNVKYNNDKSRDFTRLDLPSGDGQPTLDPTMQTAFGAPGIISSPYPGAAGFAPAIGFPQAGLSMQ--AMPGALGPLTIP------------SSAMTGRMAIH-------GMTPTAI----------HSVLLVSNLNPDSISPHELFILFGVYGDVHRVKILFNKKENALIQMADATQAQLAMSHLNGQRLYGKVIRVTISKHQTVQLPREGQEDQGLTKDFSGSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSTTDDFLKDLFASSGYTVKAFKFFQKDRKMALIQLGSVEEAIQALIHLHNHDLGENHHLRVSFSKS 512          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Zebrafish
Match: ptbp3 (polypyrimidine tract binding protein 3 [Source:ZFIN;Acc:ZDB-GENE-091116-1])

HSP 1 Score: 335.109 bits (858), Expect = 4.657e-108
Identity = 200/527 (37.95%), Postives = 294/527 (55.79%), Query Frame = 3
Query:  156 PSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRN--NNSNIDKLVQSANEKRKHYL----INWANNTG---GASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVG---------RSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPME-DANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            PSRV+H+R VP EV +  V  L VPFG + N++ ++  NQA I+M     A+ M +Y+    P +  + ++IQ+S H++L   N  N       +Q+ N      +       A++ G   G S +LRI+++N     ++  V ++IFS+FG +++I++FTKNNQ   L+++A  +++H A++ L+G N+   C T+R++FSK    L V+  +DK RD+    L   + Q    P       A G            + A G  Q  ++ Q  AM    G    P             + M  R A           +  A+          +SV+LV+NLN +  +P  LF LFGVYGDV RVK++FNKK  AL+Q A+  QA  A+ +L+   L+GK + + +SK   +QLP E   + GLTKD+S S LHRFKKP SKN+QNIFPPSA +HLSNIPP+T++  L D+   +GY VK FKF   D+KMAL++L SVE+AI  LI  HN  L E +HLR+SFSK+
Sbjct:   27 PSRVLHVRKVPIEVSEAEVVSLGVPFGKVTNLLMLKGKNQAFIEMASEEAAMTMVNYYTTATPHVRNQPVYIQYSNHRELKTDNLPNQGRAQAALQAVNAVHTGNMSLSGTATASDGGMMPGQSPVLRIIVENL-YYPVSLEVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPMNAHHAKVALDGQNIYNGCCTLRVEFSKLTS-LNVKYNNDKSRDFTRLDLPSGDGQPTLDPTMQTAFGAPGIISSPYPGAAGFAPAIGFPQAGLSMQ--AMPGALGPLTIP------------SSAMTGRMAIH-------GMTPTAI----------HSVLLVSNLNPDSISPHELFILFGVYGDVHRVKILFNKKENALIQMADATQAQLAMSHLNGQRLYGKVIRVTISKHQTVQLPREGQEDQGLTKDFSGSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSTTDDFLKDLFASSGYTVKAFKFFQKDRKMALIQLGSVEEAIQALIHLHNHDLGENHHLRVSFSKS 520          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Zebrafish
Match: ptbp3 (polypyrimidine tract binding protein 3 [Source:ZFIN;Acc:ZDB-GENE-091116-1])

HSP 1 Score: 335.109 bits (858), Expect = 4.657e-108
Identity = 200/527 (37.95%), Postives = 294/527 (55.79%), Query Frame = 3
Query:  156 PSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRN--NNSNIDKLVQSANEKRKHYL----INWANNTG---GASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVG---------RSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPME-DANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            PSRV+H+R VP EV +  V  L VPFG + N++ ++  NQA I+M     A+ M +Y+    P +  + ++IQ+S H++L   N  N       +Q+ N      +       A++ G   G S +LRI+++N     ++  V ++IFS+FG +++I++FTKNNQ   L+++A  +++H A++ L+G N+   C T+R++FSK    L V+  +DK RD+    L   + Q    P       A G            + A G  Q  ++ Q  AM    G    P             + M  R A           +  A+          +SV+LV+NLN +  +P  LF LFGVYGDV RVK++FNKK  AL+Q A+  QA  A+ +L+   L+GK + + +SK   +QLP E   + GLTKD+S S LHRFKKP SKN+QNIFPPSA +HLSNIPP+T++  L D+   +GY VK FKF   D+KMAL++L SVE+AI  LI  HN  L E +HLR+SFSK+
Sbjct:   27 PSRVLHVRKVPIEVSEAEVVSLGVPFGKVTNLLMLKGKNQAFIEMASEEAAMTMVNYYTTATPHVRNQPVYIQYSNHRELKTDNLPNQGRAQAALQAVNAVHTGNMSLSGTATASDGGMMPGQSPVLRIIVENL-YYPVSLEVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPMNAHHAKVALDGQNIYNGCCTLRVEFSKLTS-LNVKYNNDKSRDFTRLDLPSGDGQPTLDPTMQTAFGAPGIISSPYPGAAGFAPAIGFPQAGLSMQ--AMPGALGPLTIP------------SSAMTGRMAIH-------GMTPTAI----------HSVLLVSNLNPDSISPHELFILFGVYGDVHRVKILFNKKENALIQMADATQAQLAMSHLNGQRLYGKVIRVTISKHQTVQLPREGQEDQGLTKDFSGSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSTTDDFLKDLFASSGYTVKAFKFFQKDRKMALIQLGSVEEAIQALIHLHNHDLGENHHLRVSFSKS 520          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Zebrafish
Match: ptbp2b (polypyrimidine tract binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-060810-49])

HSP 1 Score: 323.939 bits (829), Expect = 1.162e-103
Identity = 204/558 (36.56%), Postives = 304/558 (54.48%), Query Frame = 3
Query:   69 YSYQMDDFSQNSFDNSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNN-NSNIDKLVQ--SANEKRKHYLINWANN---TGGASEILRILIDNA--PNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPN------------SGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMEDA-NHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            YS      + N  D+  KK+++E  +D  PSRVIHIR +P EV +T V  L +PFG + NI+ ++  NQA +++     A+ M +Y+    P +    +FIQ+S H++L   +  N     ++Q  SA ++      + A+    T   S +LRI+IDN   P   +   V  +IFS+FG +++I++FTKNNQ   L++F+  +++  A+L L+G N+   C T+RIDFSK    L V+  +DK RDY      R EL   +G         V  SM+ A   D   +    S M                             T+  S  GF S+    +  +              SG      V+LV+NLN E   P +LFTLFGVYGDV RVK+++NKK++AL+Q ++  QA  A+ +L+   ++GK + + +SK   +QLP E   + GLTKD+++S LHRFKKP SKN+QNIFPPSA +HLSNIP   +E DL  +   +G  VK FKF   D+KM+LL++ + E+AI  LI+ HN  +   + LR+SFSK+
Sbjct:   25 YSSPNSSVTANGSDS--KKLRVEDSMDSPPSRVIHIRKLPNEVSETEVIALGLPFGKVTNILMLKGKNQAFLELGTEEAAVTMVNYYTAVTPQVRNVPVFIQYSNHKELKTDSALNQRAQAVLQAVSAVQEGGSPSSDMASKSVLTPAPSPVLRIIIDNMFYP---VTLDVLQQIFSKFGTVMKIITFTKNNQFQALLQFSDPVNAQQAKLSLDGQNIYNSCCTLRIDFSKLVN-LNVKYNNDKSRDY-----TRPELPAGDGQP------PVDPSMAAALSKDSPSLLGTPSGMV----------------------------TSYSSGGGFPSSLGAISPLSAAAAAAAAAGRVALSGHSVPGGVLLVSNLNDEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMSDGNQAQLAMSHLNGQKMYGKIIRVTLSKHQTVQLPREGLDDQGLTKDFTSSPLHRFKKPGSKNFQNIFPPSATLHLSNIPDNVTEEDLRLLFSNSGGTVKAFKFF-QDRKMSLLQMATAEEAIQALIDLHNYDMGRGHRLRVSFSKS 536          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Xenopus
Match: htr4 (5-hydroxytryptamine (serotonin) receptor 4, G protein-coupled [Source:Xenbase;Acc:XB-GENE-993770])

HSP 1 Score: 329.331 bits (843), Expect = 1.300e-105
Identity = 197/534 (36.89%), Postives = 301/534 (56.37%), Query Frame = 3
Query:  111 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDK----------LVQSANEKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMEDA-NHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            N +KK K +  ++  PSRV+HIR +P EV +T V  L +PFG + NI+ ++  NQA +++     A  M +Y+    P +  + ++IQ+S H++L     +S +++           VQ++N        N    +   S +LRI+IDN     +   V ++IFS+FG +++I++FTKNNQ   L+++   +++  A+L L+G N+   C T+RIDFSK    L V+  +DK RDY      R +L   +G     P  A                    +A A +T +   P A                   + +     +  S+  M   ++G   GN+V+LV+NLN E  +P +LFTLFGVYGDV RVK+++NKK++AL+Q A+  Q+  A+ +L+   ++GK + + +SK   +QLP E   + GLTKD+SNS LHRFKKP SKN+QNIFPPSA +HLSNIP   +E DL  +    G  VK FKF   D KMALL++++VE+AI  LI+ HN  + + +HLR+SFSK+
Sbjct:   42 NDNKKFKGDDKMEAAPSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAASTMVNYYTTITPHLRNQPIYIQYSNHKEL---KTDSALNQRAQAVLQAVTAVQTSNSSVTSTAANENTVSSAQSPVLRIIIDNM-YYPVTLDVLHQIFSKFGTVLKIITFTKNNQFQALLQYGDPVNAQQAKLALDGQNIYNACCTLRIDFSKLVN-LNVKYNNDKSRDY-----TRPDLPSGDGQPALDPAIA--------------------AAFAKETSLLAVPGALSPLG------------IPNAAAAAAAAAASRVGMHGVSTG---GNTVLLVSNLNEEMVSPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMSHLNGQKMYGKIIRVTLSKHQTVQLPREGLDDQGLTKDFSNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPQNITEDDLRTLFTNTGGNVKAFKFF-QDHKMALLQMSTVEEAIQALIDLHNYNIGDNHHLRVSFSKS 529          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Xenopus
Match: taco1 (translational activator of mitochondrially encoded cytochrome c oxidase I [Source:Xenbase;Acc:XB-GENE-986962])

HSP 1 Score: 327.02 bits (837), Expect = 6.455e-105
Identity = 195/535 (36.45%), Postives = 294/535 (54.95%), Query Frame = 3
Query:  111 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRN--NNSNIDKLVQSANEKRKHYLINWANNTG------GASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWG---FGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMED-ANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            N  KK K ++     PSRV+HIR +P +V ++ +  L +PFG + N++ ++  +QA ++M     A+ M +Y+    P +  + ++IQ+S H++L   N  N +     +Q+ N  +   L   +   G      G S +LRI+++N     +   V ++IFS+FG +I+I++FTKNNQ   L+++A  +++H A++ L+G N+   C T+RI+FSK    L V+  +DK RD+                            + +  G+ Q  +   ++A     G+  +P A  A  +      Q           G     ++     M  P      G+SV+LV+NLN +   P  LF LFGVYGDV RVK++FNKK  ALVQ  +  QA  A+ +L+   L G+ + + +SK   +QLP E   + GLTKDY+NS LHRFKKP SKN+QNIFPPSA +HLSNIPP  ++ DL  +    G  VK FKF   D+KMAL++L SVE+AI  LIE HN  L E +HLR+SFSK+
Sbjct:   12 NDSKKFKGDRS-PCSPSRVLHIRKIPNDVTESEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVSMVNYYTPVPPHVRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVNTLQSGGLTLTSVPGGEGLVLSGQSPVLRIIVENL-FYPVTLEVLHQIFSKFGTVIKIITFTKNNQFQALLQYADPMNAHHAKVALDGQNIYNACCTLRIEFSKLTS-LNVKYNNDKSRDFTR--------------------------LDLPTGDGQPSLDTTMAAAFGAPGIISSPYAGAAGFAPAIGFPQAGLSVPGVPGLGPLALTTSAITGRMAIPGMTAIPGHSVLLVSNLNPDAILPHGLFILFGVYGDVQRVKILFNKKENALVQMTDATQAQLAMSHLNGQRLHGRVLRITLSKHQSVQLPREGHEDQGLTKDYTNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPLVTDEDLKRLFASTGCSVKGFKFFQKDRKMALIQLGSVEEAILALIELHNHDLGENHHLRVSFSKS 517          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Xenopus
Match: taco1 (translational activator of mitochondrially encoded cytochrome c oxidase I [Source:Xenbase;Acc:XB-GENE-986962])

HSP 1 Score: 327.02 bits (837), Expect = 9.564e-105
Identity = 195/535 (36.45%), Postives = 294/535 (54.95%), Query Frame = 3
Query:  111 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRN--NNSNIDKLVQSANEKRKHYLINWANNTG------GASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWG---FGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMED-ANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            N  KK K ++     PSRV+HIR +P +V ++ +  L +PFG + N++ ++  +QA ++M     A+ M +Y+    P +  + ++IQ+S H++L   N  N +     +Q+ N  +   L   +   G      G S +LRI+++N     +   V ++IFS+FG +I+I++FTKNNQ   L+++A  +++H A++ L+G N+   C T+RI+FSK    L V+  +DK RD+                            + +  G+ Q  +   ++A     G+  +P A  A  +      Q           G     ++     M  P      G+SV+LV+NLN +   P  LF LFGVYGDV RVK++FNKK  ALVQ  +  QA  A+ +L+   L G+ + + +SK   +QLP E   + GLTKDY+NS LHRFKKP SKN+QNIFPPSA +HLSNIPP  ++ DL  +    G  VK FKF   D+KMAL++L SVE+AI  LIE HN  L E +HLR+SFSK+
Sbjct:   23 NDSKKFKGDRS-PCSPSRVLHIRKIPNDVTESEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVSMVNYYTPVPPHVRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVNTLQSGGLTLTSVPGGEGLVLSGQSPVLRIIVENL-FYPVTLEVLHQIFSKFGTVIKIITFTKNNQFQALLQYADPMNAHHAKVALDGQNIYNACCTLRIEFSKLTS-LNVKYNNDKSRDFTR--------------------------LDLPTGDGQPSLDTTMAAAFGAPGIISSPYAGAAGFAPAIGFPQAGLSVPGVPGLGPLALTTSAITGRMAIPGMTAIPGHSVLLVSNLNPDAILPHGLFILFGVYGDVQRVKILFNKKENALVQMTDATQAQLAMSHLNGQRLHGRVLRITLSKHQSVQLPREGHEDQGLTKDYTNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPLVTDEDLKRLFASTGCSVKGFKFFQKDRKMALIQLGSVEEAILALIELHNHDLGENHHLRVSFSKS 528          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Xenopus
Match: taco1 (translational activator of mitochondrially encoded cytochrome c oxidase I [Source:Xenbase;Acc:XB-GENE-986962])

HSP 1 Score: 327.405 bits (838), Expect = 9.851e-105
Identity = 197/547 (36.01%), Postives = 294/547 (53.75%), Query Frame = 3
Query:  105 FDNSHKKVKMEQGIDEK----------PSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRN--NNSNIDKLVQSANEKRKHYLINWANNTG------GASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWG---FGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMED-ANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            F  SH       G D K          PSRV+HIR +P +V ++ +  L +PFG + N++ ++  +QA ++M     A+ M +Y+    P +  + ++IQ+S H++L   N  N +     +Q+ N  +   L   +   G      G S +LRI+++N     +   V ++IFS+FG +I+I++FTKNNQ   L+++A  +++H A++ L+G N+   C T+RI+FSK    L V+  +DK RD+                            + +  G+ Q  +   ++A     G+  +P A  A  +      Q           G     ++     M  P      G+SV+LV+NLN +   P  LF LFGVYGDV RVK++FNKK  ALVQ  +  QA  A+ +L+   L G+ + + +SK   +QLP E   + GLTKDY+NS LHRFKKP SKN+QNIFPPSA +HLSNIPP  ++ DL  +    G  VK FKF   D+KMAL++L SVE+AI  LIE HN  L E +HLR+SFSK+
Sbjct:   26 FTMSHSTPATANGNDSKKFKGDRSPCSPSRVLHIRKIPNDVTESEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVSMVNYYTPVPPHVRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVNTLQSGGLTLTSVPGGEGLVLSGQSPVLRIIVENL-FYPVTLEVLHQIFSKFGTVIKIITFTKNNQFQALLQYADPMNAHHAKVALDGQNIYNACCTLRIEFSKLTS-LNVKYNNDKSRDFTR--------------------------LDLPTGDGQPSLDTTMAAAFGAPGIISSPYAGAAGFAPAIGFPQAGLSVPGVPGLGPLALTTSAITGRMAIPGMTAIPGHSVLLVSNLNPDAILPHGLFILFGVYGDVQRVKILFNKKENALVQMTDATQAQLAMSHLNGQRLHGRVLRITLSKHQSVQLPREGHEDQGLTKDYTNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPLVTDEDLKRLFASTGCSVKGFKFFQKDRKMALIQLGSVEEAILALIELHNHDLGENHHLRVSFSKS 544          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Xenopus
Match: taco1 (translational activator of mitochondrially encoded cytochrome c oxidase I [Source:Xenbase;Acc:XB-GENE-986962])

HSP 1 Score: 326.25 bits (835), Expect = 1.811e-104
Identity = 195/535 (36.45%), Postives = 294/535 (54.95%), Query Frame = 3
Query:  111 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRN--NNSNIDKLVQSANEKRKHYLINWANNTG------GASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWG---FGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMED-ANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            N  KK K ++     PSRV+HIR +P +V ++ +  L +PFG + N++ ++  +QA ++M     A+ M +Y+    P +  + ++IQ+S H++L   N  N +     +Q+ N  +   L   +   G      G S +LRI+++N     +   V ++IFS+FG +I+I++FTKNNQ   L+++A  +++H A++ L+G N+   C T+RI+FSK    L V+  +DK RD+                            + +  G+ Q  +   ++A     G+  +P A  A  +      Q           G     ++     M  P      G+SV+LV+NLN +   P  LF LFGVYGDV RVK++FNKK  ALVQ  +  QA  A+ +L+   L G+ + + +SK   +QLP E   + GLTKDY+NS LHRFKKP SKN+QNIFPPSA +HLSNIPP  ++ DL  +    G  VK FKF   D+KMAL++L SVE+AI  LIE HN  L E +HLR+SFSK+
Sbjct:   21 NDSKKFKGDRS-PCSPSRVLHIRKIPNDVTESEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVSMVNYYTPVPPHVRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVNTLQSGGLTLTSVPGGEGLVLSGQSPVLRIIVENL-FYPVTLEVLHQIFSKFGTVIKIITFTKNNQFQALLQYADPMNAHHAKVALDGQNIYNACCTLRIEFSKLTS-LNVKYNNDKSRDFTR--------------------------LDLPTGDGQPSLDTTMAAAFGAPGIISSPYAGAAGFAPAIGFPQAGLSVPGVPGLGPLALTTSAITGRMAIPGMTAIPGHSVLLVSNLNPDAILPHGLFILFGVYGDVQRVKILFNKKENALVQMTDATQAQLAMSHLNGQRLHGRVLRITLSKHQSVQLPREGHEDQGLTKDYTNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPLVTDEDLKRLFASTGCSVKGFKFFQKDRKMALIQLGSVEEAILALIELHNHDLGENHHLRVSFSKS 526          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Mouse
Match: Ptbp2 (polypyrimidine tract binding protein 2 [Source:MGI Symbol;Acc:MGI:1860489])

HSP 1 Score: 346.665 bits (888), Expect = 2.099e-112
Identity = 204/531 (38.42%), Postives = 298/531 (56.12%), Query Frame = 3
Query:  111 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLV-------QSANEKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMEDAN-HGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            N  KK K E  +D  PSRV+HIR +P EV +T V  L +PFG + NI+ ++  NQA +++     AI M +Y++   P +  + ++IQ+S H++L   N  +   ++V       Q+AN       ++ +  T   S +LRI+IDN     +   V ++IFS+FG +++I++FTKNNQ   L+++   +++  A+L L+G N+   C T+RIDFSK    L V+  +DK RDY      R +L   +G     P  A                    +A A +T +   P A    A   AA              G  +                GN+V+LV+NLN E   P +LFTLFGVYGDV RVK+++NKK++AL+Q A+  Q+  A+ +L+   ++GK + + +SK   +QLP E  +  GLTKD+ NS LHRFKKP SKN+QNIFPPSA +HLSNIPP+ +E DL  +    G  VK FKF   D KMALL++ +VE+AI  LI+ HN  L E +HLR+SFSK+
Sbjct:   42 NDSKKFKGEDKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAAITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQVVLQAVTAVQTANTPLSGTTVSESAVTPAQSPVLRIIIDNM-YYPVTLDVLHQIFSKFGAVLKIITFTKNNQFQALLQYGDPVNAQQAKLALDGQNIYNACCTLRIDFSKLVN-LNVKYNNDKSRDY-----TRPDLPSGDGQPALDPAIA--------------------AAFAKETSLLAVPGALSPLAIPNAAAAAAAAAAGRVGMPGVSAG---------------GNTVLLVSNLNEEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMNHLNGQKMYGKIIRVTLSKHQTVQLPREGLDDQGLTKDFGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVAEEDLRTLFANTGGTVKAFKFFQRDHKMALLQMATVEEAIQALIDLHNYNLGENHHLRVSFSKS 530          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Mouse
Match: Ptbp3 (polypyrimidine tract binding protein 3 [Source:MGI Symbol;Acc:MGI:1923334])

HSP 1 Score: 345.125 bits (884), Expect = 5.649e-112
Identity = 207/533 (38.84%), Postives = 290/533 (54.41%), Query Frame = 3
Query:  111 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRN--------NNSNIDKLVQSANEKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQ-ELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPME-DANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            N +KK K ++     PSRV+H+R +P +V +  V  L +PFG + N++ ++  +QA ++M     A+ M +Y+    P +  + ++IQ+S H++L   N                VQS N        N      G S +LRI+I+N     +   V ++IFS+FG +++I++FTKNNQ   L+++A  +++  A++ L+G N+   C T+RIDFSK    L V+  +DK RD+    L   + Q  LE P  +   F     MS        F  A     A+   V   P A                           S+     M  P +    GNSV+LVTNLN +   P  LF LFGVYGDV RVK+MFNKK  ALVQ A+  QA  A+ +L    L+GK +   +SK   +QLP E   + GLTKD+SNS LHRFKKP SKN+QNIFPPSA +HLSNIPP+ +  DL ++   AG  VK FKF   D+KMAL++L SVE+AI  LIE HN  L E +HLR+SFSK+
Sbjct:   14 NDNKKFKGDRP-PCSPSRVLHLRKIPCDVTEAEVISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMINYYTPVTPHLRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVSAVQSGNLSLPGATANEGTLLPGQSPVLRIIIENL-FYPVTLEVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVNAQYAKMALDGQNIYNACCTLRIDFSKLTS-LNVKYNNDKSRDFTRLDLPTGDGQPSLEPPMAA--AFGAPGIMSSPYAGAAGFAPAIAFPQAAGLSVPAVPGAL--------------------GPLTLTSSAVSGRMAIPGASGMPGNSVLLVTNLNPDFITPHGLFILFGVYGDVHRVKIMFNKKENALVQMADASQAQLAMNHLSGQRLYGKVLRATLSKHQAVQLPREGQEDQGLTKDFSNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVTMDDLKNLFTEAGCSVKAFKFFQKDRKMALIQLGSVEEAIQALIELHNHDLGENHHLRVSFSKS 521          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Mouse
Match: Ptbp3 (polypyrimidine tract binding protein 3 [Source:MGI Symbol;Acc:MGI:1923334])

HSP 1 Score: 344.739 bits (883), Expect = 7.209e-112
Identity = 207/533 (38.84%), Postives = 290/533 (54.41%), Query Frame = 3
Query:  111 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRN--------NNSNIDKLVQSANEKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQ-ELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPME-DANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            N +KK K ++     PSRV+H+R +P +V +  V  L +PFG + N++ ++  +QA ++M     A+ M +Y+    P +  + ++IQ+S H++L   N                VQS N        N      G S +LRI+I+N     +   V ++IFS+FG +++I++FTKNNQ   L+++A  +++  A++ L+G N+   C T+RIDFSK    L V+  +DK RD+    L   + Q  LE P  +   F     MS        F  A     A+   V   P A                           S+     M  P +    GNSV+LVTNLN +   P  LF LFGVYGDV RVK+MFNKK  ALVQ A+  QA  A+ +L    L+GK +   +SK   +QLP E   + GLTKD+SNS LHRFKKP SKN+QNIFPPSA +HLSNIPP+ +  DL ++   AG  VK FKF   D+KMAL++L SVE+AI  LIE HN  L E +HLR+SFSK+
Sbjct:   11 NDNKKFKGDRP-PCSPSRVLHLRKIPCDVTEAEVISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMINYYTPVTPHLRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVSAVQSGNLSLPGATANEGTLLPGQSPVLRIIIENL-FYPVTLEVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVNAQYAKMALDGQNIYNACCTLRIDFSKLTS-LNVKYNNDKSRDFTRLDLPTGDGQPSLEPPMAA--AFGAPGIMSSPYAGAAGFAPAIAFPQAAGLSVPAVPGAL--------------------GPLTLTSSAVSGRMAIPGASGMPGNSVLLVTNLNPDFITPHGLFILFGVYGDVHRVKIMFNKKENALVQMADASQAQLAMNHLSGQRLYGKVLRATLSKHQAVQLPREGQEDQGLTKDFSNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVTMDDLKNLFTEAGCSVKAFKFFQKDRKMALIQLGSVEEAIQALIELHNHDLGENHHLRVSFSKS 518          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Mouse
Match: Ptbp3 (polypyrimidine tract binding protein 3 [Source:MGI Symbol;Acc:MGI:1923334])

HSP 1 Score: 344.739 bits (883), Expect = 7.209e-112
Identity = 207/533 (38.84%), Postives = 290/533 (54.41%), Query Frame = 3
Query:  111 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRN--------NNSNIDKLVQSANEKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQ-ELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPME-DANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            N +KK K ++     PSRV+H+R +P +V +  V  L +PFG + N++ ++  +QA ++M     A+ M +Y+    P +  + ++IQ+S H++L   N                VQS N        N      G S +LRI+I+N     +   V ++IFS+FG +++I++FTKNNQ   L+++A  +++  A++ L+G N+   C T+RIDFSK    L V+  +DK RD+    L   + Q  LE P  +   F     MS        F  A     A+   V   P A                           S+     M  P +    GNSV+LVTNLN +   P  LF LFGVYGDV RVK+MFNKK  ALVQ A+  QA  A+ +L    L+GK +   +SK   +QLP E   + GLTKD+SNS LHRFKKP SKN+QNIFPPSA +HLSNIPP+ +  DL ++   AG  VK FKF   D+KMAL++L SVE+AI  LIE HN  L E +HLR+SFSK+
Sbjct:   11 NDNKKFKGDRP-PCSPSRVLHLRKIPCDVTEAEVISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMINYYTPVTPHLRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVSAVQSGNLSLPGATANEGTLLPGQSPVLRIIIENL-FYPVTLEVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVNAQYAKMALDGQNIYNACCTLRIDFSKLTS-LNVKYNNDKSRDFTRLDLPTGDGQPSLEPPMAA--AFGAPGIMSSPYAGAAGFAPAIAFPQAAGLSVPAVPGAL--------------------GPLTLTSSAVSGRMAIPGASGMPGNSVLLVTNLNPDFITPHGLFILFGVYGDVHRVKIMFNKKENALVQMADASQAQLAMNHLSGQRLYGKVLRATLSKHQAVQLPREGQEDQGLTKDFSNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVTMDDLKNLFTEAGCSVKAFKFFQKDRKMALIQLGSVEEAIQALIELHNHDLGENHHLRVSFSKS 518          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Mouse
Match: Ptbp3 (polypyrimidine tract binding protein 3 [Source:MGI Symbol;Acc:MGI:1923334])

HSP 1 Score: 344.739 bits (883), Expect = 1.954e-111
Identity = 207/533 (38.84%), Postives = 290/533 (54.41%), Query Frame = 3
Query:  111 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRN--------NNSNIDKLVQSANEKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQ-ELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPME-DANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            N +KK K ++     PSRV+H+R +P +V +  V  L +PFG + N++ ++  +QA ++M     A+ M +Y+    P +  + ++IQ+S H++L   N                VQS N        N      G S +LRI+I+N     +   V ++IFS+FG +++I++FTKNNQ   L+++A  +++  A++ L+G N+   C T+RIDFSK    L V+  +DK RD+    L   + Q  LE P  +   F     MS        F  A     A+   V   P A                           S+     M  P +    GNSV+LVTNLN +   P  LF LFGVYGDV RVK+MFNKK  ALVQ A+  QA  A+ +L    L+GK +   +SK   +QLP E   + GLTKD+SNS LHRFKKP SKN+QNIFPPSA +HLSNIPP+ +  DL ++   AG  VK FKF   D+KMAL++L SVE+AI  LIE HN  L E +HLR+SFSK+
Sbjct:   42 NDNKKFKGDRP-PCSPSRVLHLRKIPCDVTEAEVISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMINYYTPVTPHLRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVSAVQSGNLSLPGATANEGTLLPGQSPVLRIIIENL-FYPVTLEVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVNAQYAKMALDGQNIYNACCTLRIDFSKLTS-LNVKYNNDKSRDFTRLDLPTGDGQPSLEPPMAA--AFGAPGIMSSPYAGAAGFAPAIAFPQAAGLSVPAVPGAL--------------------GPLTLTSSAVSGRMAIPGASGMPGNSVLLVTNLNPDFITPHGLFILFGVYGDVHRVKIMFNKKENALVQMADASQAQLAMNHLSGQRLYGKVLRATLSKHQAVQLPREGQEDQGLTKDFSNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVTMDDLKNLFTEAGCSVKAFKFFQKDRKMALIQLGSVEEAIQALIELHNHDLGENHHLRVSFSKS 549          
BLAST of Polypyrimidine tract-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q8BHD7|PTBP3_MOUSE (Polypyrimidine tract-binding protein 3 OS=Mus musculus OX=10090 GN=Ptbp3 PE=1 SV=1)

HSP 1 Score: 345.125 bits (884), Expect = 3.952e-111
Identity = 207/533 (38.84%), Postives = 290/533 (54.41%), Query Frame = 3
Query:  111 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRN--------NNSNIDKLVQSANEKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQ-ELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPME-DANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            N +KK K ++     PSRV+H+R +P +V +  V  L +PFG + N++ ++  +QA ++M     A+ M +Y+    P +  + ++IQ+S H++L   N                VQS N        N      G S +LRI+I+N     +   V ++IFS+FG +++I++FTKNNQ   L+++A  +++  A++ L+G N+   C T+RIDFSK    L V+  +DK RD+    L   + Q  LE P  +   F     MS        F  A     A+   V   P A                           S+     M  P +    GNSV+LVTNLN +   P  LF LFGVYGDV RVK+MFNKK  ALVQ A+  QA  A+ +L    L+GK +   +SK   +QLP E   + GLTKD+SNS LHRFKKP SKN+QNIFPPSA +HLSNIPP+ +  DL ++   AG  VK FKF   D+KMAL++L SVE+AI  LIE HN  L E +HLR+SFSK+
Sbjct:   14 NDNKKFKGDRP-PCSPSRVLHLRKIPCDVTEAEVISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMINYYTPVTPHLRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVSAVQSGNLSLPGATANEGTLLPGQSPVLRIIIENL-FYPVTLEVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVNAQYAKMALDGQNIYNACCTLRIDFSKLTS-LNVKYNNDKSRDFTRLDLPTGDGQPSLEPPMAA--AFGAPGIMSSPYAGAAGFAPAIAFPQAAGLSVPAVPGAL--------------------GPLTLTSSAVSGRMAIPGASGMPGNSVLLVTNLNPDFITPHGLFILFGVYGDVHRVKIMFNKKENALVQMADASQAQLAMNHLSGQRLYGKVLRATLSKHQAVQLPREGQEDQGLTKDFSNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVTMDDLKNLFTEAGCSVKAFKFFQKDRKMALIQLGSVEEAIQALIELHNHDLGENHHLRVSFSKS 521          
BLAST of Polypyrimidine tract-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q9Z118|PTBP3_RAT (Polypyrimidine tract-binding protein 3 OS=Rattus norvegicus OX=10116 GN=Ptbp3 PE=2 SV=1)

HSP 1 Score: 344.354 bits (882), Expect = 9.636e-111
Identity = 207/533 (38.84%), Postives = 290/533 (54.41%), Query Frame = 3
Query:  111 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRN--------NNSNIDKLVQSANEKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQ-ELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPME-DANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            N +KK K ++     PSRV+H+R +P +V +  V  L +PFG + N++ ++  +QA ++M     A+ M +Y+    P +  + ++IQ+S H++L   N                VQS N        N      G S +LRI+I+N     +   V ++IFS+FG +++I++FTKNNQ   L+++A  +++  A++ L+G N+   C T+RIDFSK    L V+  +DK RD+    L   + Q  LE P  +   F     MS        F  A     A+   V   P A                           S+     M  P +    GNSV+LVTNLN +   P  LF LFGVYGDV RVK+MFNKK  ALVQ A+  QA  A+ +L    L+GK +   +SK   +QLP E   + GLTKD+SNS LHRFKKP SKN+QNIFPPSA +HLSNIPP+ +  DL ++   AG  VK FKF   D+KMAL++L SVE+AI  LIE HN  L E +HLR+SFSK+
Sbjct:   14 NDNKKFKGDRP-PCSPSRVLHLRKIPCDVTEAEVISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMINYYTPVTPHLRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVSAVQSGNLSLPGATSNEGTLLPGQSPVLRIIIENL-FYPVTLEVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVNAQYAKMALDGQNIYNACCTLRIDFSKLTS-LNVKYNNDKSRDFTRLDLPTGDGQPSLEPPMAA--AFGAPGIMSSPYAGAAGFAPAIAFPQAAGLSVSAVPGAL--------------------GPLTLTSSAVSGRMAIPGASGIPGNSVLLVTNLNPDFITPHGLFILFGVYGDVHRVKIMFNKKENALVQMADASQAQIAMNHLSGQRLYGKVLRATLSKHQAVQLPREGQEDQGLTKDFSNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVTMDDLKNLFTEAGCSVKAFKFFQKDRKMALIQLGSVEEAIQALIELHNHDLGENHHLRVSFSKS 521          
BLAST of Polypyrimidine tract-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q66H20|PTBP2_RAT (Polypyrimidine tract-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ptbp2 PE=1 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 3.040e-110
Identity = 204/531 (38.42%), Postives = 298/531 (56.12%), Query Frame = 3
Query:  111 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLV-------QSANEKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMEDAN-HGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            N  KK K E  +D  PSRV+HIR +P EV +T V  L +PFG + NI+ ++  NQA +++     AI M +Y++   P +  + ++IQ+S H++L   N  +   ++V       Q+AN       ++ +  T   S +LRI+IDN     +   V ++IFS+FG +++I++FTKNNQ   L+++   +++  A+L L+G N+   C T+RIDFSK    L V+  +DK RDY      R +L   +G     P  A                    +A A +T +   P A    A   AA              G  +                GN+V+LV+NLN E   P +LFTLFGVYGDV RVK+++NKK++AL+Q A+  Q+  A+ +L+   ++GK + + +SK   +QLP E  +  GLTKD+ NS LHRFKKP SKN+QNIFPPSA +HLSNIPP+ +E DL  +    G  VK FKF   D KMALL++ +VE+AI  LI+ HN  L E +HLR+SFSK+
Sbjct:   42 NDSKKFKGEDKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAAITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQVVLQAVTAVQTANTPLSGTTVSESAVTPAQSPVLRIIIDNM-YYPVTLDVLHQIFSKFGAVLKIITFTKNNQFQALLQYGDPVNAQQAKLALDGQNIYNACCTLRIDFSKLVN-LNVKYNNDKSRDY-----TRPDLPSGDGQPALDPAIA--------------------AAFAKETSLLAVPGALSPLAIPNAAAAAAAAAAGRVGMPGVSAG---------------GNTVLLVSNLNEEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMNHLNGQKMYGKIIRVTLSKHQTVQLPREGLDDQGLTKDFGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVAEEDLRTLFANTGGTVKAFKFF-QDHKMALLQMATVEEAIQALIDLHNYNLGENHHLRVSFSKS 529          
BLAST of Polypyrimidine tract-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q91Z31|PTBP2_MOUSE (Polypyrimidine tract-binding protein 2 OS=Mus musculus OX=10090 GN=Ptbp2 PE=1 SV=2)

HSP 1 Score: 343.199 bits (879), Expect = 3.040e-110
Identity = 204/531 (38.42%), Postives = 298/531 (56.12%), Query Frame = 3
Query:  111 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLV-------QSANEKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMEDAN-HGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            N  KK K E  +D  PSRV+HIR +P EV +T V  L +PFG + NI+ ++  NQA +++     AI M +Y++   P +  + ++IQ+S H++L   N  +   ++V       Q+AN       ++ +  T   S +LRI+IDN     +   V ++IFS+FG +++I++FTKNNQ   L+++   +++  A+L L+G N+   C T+RIDFSK    L V+  +DK RDY      R +L   +G     P  A                    +A A +T +   P A    A   AA              G  +                GN+V+LV+NLN E   P +LFTLFGVYGDV RVK+++NKK++AL+Q A+  Q+  A+ +L+   ++GK + + +SK   +QLP E  +  GLTKD+ NS LHRFKKP SKN+QNIFPPSA +HLSNIPP+ +E DL  +    G  VK FKF   D KMALL++ +VE+AI  LI+ HN  L E +HLR+SFSK+
Sbjct:   42 NDSKKFKGEDKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAAITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQVVLQAVTAVQTANTPLSGTTVSESAVTPAQSPVLRIIIDNM-YYPVTLDVLHQIFSKFGAVLKIITFTKNNQFQALLQYGDPVNAQQAKLALDGQNIYNACCTLRIDFSKLVN-LNVKYNNDKSRDY-----TRPDLPSGDGQPALDPAIA--------------------AAFAKETSLLAVPGALSPLAIPNAAAAAAAAAAGRVGMPGVSAG---------------GNTVLLVSNLNEEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMNHLNGQKMYGKIIRVTLSKHQTVQLPREGLDDQGLTKDFGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVAEEDLRTLFANTGGTVKAFKFF-QDHKMALLQMATVEEAIQALIDLHNYNLGENHHLRVSFSKS 529          
BLAST of Polypyrimidine tract-binding protein 1 vs. UniProt/SwissProt
Match: sp|O95758|PTBP3_HUMAN (Polypyrimidine tract-binding protein 3 OS=Homo sapiens OX=9606 GN=PTBP3 PE=1 SV=2)

HSP 1 Score: 342.813 bits (878), Expect = 6.734e-110
Identity = 202/537 (37.62%), Postives = 295/537 (54.93%), Query Frame = 3
Query:  111 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRN----NNSNIDKLVQSANEKRKHYLINWANNTG----GASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFG-----SNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMED-ANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            N  KK K ++     PSRV+H+R +P +V +  +  L +PFG + N++ ++  +QA ++M     A+ M +Y+    P +  + ++IQ+S H++L   N      +       SA +     L    +N G    G S +LRI+I+N     +   V ++IFS+FG +++I++FTKNNQ   L+++A  +++H A++ L+G N+   C T+RIDFSK    L V+  +DK RD+                            + +  G+ Q  +   ++A     G+  +P A  A  +      Q    +        G     S+     M  P +    GNSV+LVTNLN +   P  LF LFGVYGDV RVK+MFNKK  ALVQ A+  QA  A+ +L    L+GK +   +SK   +QLP E   + GLTKD+SNS LHRFKKP SKN+QNIFPPSA +HLSNIPP+ +  DL ++   AG  VK FKF   D+KMAL++L SVE+AI  LIE HN  L E +HLR+SFSK+
Sbjct:   43 NDSKKFKRDRP-PCSPSRVLHLRKIPCDVTEAEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMVNYYTPITPHLRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVSAVQSGSLALSGGPSNEGTVLPGQSPVLRIIIENL-FYPVTLEVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVNAHYAKMALDGQNIYNACCTLRIDFSKLTS-LNVKYNNDKSRDFTR--------------------------LDLPTGDGQPSLEPPMAAAFGAPGIISSPYAGAAGFAPAIGFPQATGLSVPAVPGALGPLTITSSAVTGRMAIPGASGIPGNSVLLVTNLNPDLITPHGLFILFGVYGDVHRVKIMFNKKENALVQMADANQAQLAMNHLSGQRLYGKVLRATLSKHQAVQLPREGQEDQGLTKDFSNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVTVDDLKNLFIEAGCSVKAFKFFQKDRKMALIQLGSVEEAIQALIELHNHDLGENHHLRVSFSKS 550          
BLAST of Polypyrimidine tract-binding protein 1 vs. TrEMBL
Match: A0A183B4Q9 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS14195 PE=4 SV=1)

HSP 1 Score: 456.833 bits (1174), Expect = 5.110e-151
Identity = 260/599 (43.41%), Postives = 365/599 (60.93%), Query Frame = 3
Query:  111 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLVQSANEKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMA------RGNDQQF--------------------------------MTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQ-------------------------------MNHRTADQSNWG-FGSN------QSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMEDANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            N +KK +ME  ++  PS+V+HIRN+P +  +  +A+L +PFG ++N+V  +K  QALI+M+ L  AI M  Y+ +Y   + G++L +QFSKHQ L+L + N+NI   +++AN   +  L     N G  + +LR+L+DN     INH + +KIF R+G+I+RI+++ KNNQ+HGL+EF + + + VA L LNG N+   C ++R++FSKN GPL+V+ ++DK RDY+ +PL   EL  L   +Y+      G S   A       G  Q F                                +TAQL+A+A Q+G+ LTPAA  A AS MA   Q                               M+H T    N G  GS+       +  A   PN+   NG +V++V+NL+ E+  PDALFTLFGVYGDV RVK+MFNKK+TALVQFA+ QQA+TA++ L    LWGK M + VS+ NV+QLP ED+++GLTKDYS S LHRF+KPNSKNY NI+PPS V+HLSNIPPT SE D+  +    G+EV  F+F+  DKKMAL++L+S++ AI  LIE HN +L+E +HLRISFSK+
Sbjct:   14 NENKKSRMEY-VETVPSKVVHIRNMPNDASEQEIALLGIPFGLLENMVLSKKAGQALIEMQSLESAIHMVSYYREYQVTLRGRNLVMQFSKHQHLELHSENTNIGDAIKNANCIVQQDL--CGANCGIPNTVLRVLVDNIMGQQINHTILHKIFYRYGKILRIITYLKNNQYHGLIEFENHIHAFVAMLHLNGQNIYTGCCSLRVEFSKNRGPLEVRHENDKCRDYINNPLTEEELINLR--RYTSGSMTSGTSGGGAPHGGNPTGMVQHFQGAVVPGMTPQGLHLPVGMIAPPSTSNAGINDLTAQLAALAQQSGLALTPAAVAATASFMAMTAQNNAVGAQSVPSTPNLAALLAAIQGGTVQNPMMSHLTG--GNPGPLGSHALSQHGTAPGARPPPNN---NGGTVLIVSNLHEERVYPDALFTLFGVYGDVTRVKIMFNKKDTALVQFADPQQALTALQFLSGQRLWGKTMKIAVSRHNVVQLPREDSDNGLTKDYSTSLLHRFRKPNSKNYMNIYPPSHVLHLSNIPPTISEEDIRLLFAAKGFEVTGFRFMQKDKKMALVQLDSIDTAIQALIELHNTQLTENSHLRISFSKS 602          
BLAST of Polypyrimidine tract-binding protein 1 vs. TrEMBL
Match: G4VQG0 (Putative polypyrimidine tract binding protein OS=Schistosoma mansoni OX=6183 GN=Smp_036590.1 PE=4 SV=1)

HSP 1 Score: 444.121 bits (1141), Expect = 3.810e-146
Identity = 246/591 (41.62%), Postives = 362/591 (61.25%), Query Frame = 3
Query:  111 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLVQSANEKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYS------------------------------FPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWG-------------------------------FGSNQSQNAMFNPNSGIE-----NGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMEDANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKAGA 1685
            N +KK ++E  ++  PS+V+HIRN+P +  +  +A+L +PFG ++N+V  +K NQAL++M+ L  AI M  Y+ +Y   + G++L +Q+SKHQ L+L + NS+I   +Q+AN   +  L     N+G  + +LR+++DN     INH + +KIF R+G+I+RIV++ KNNQ+HGLVEF + + + VA L LNG N+   C ++R+ FSKN GPL+V+++SD+ RDY+ +PL   EL  L  P                                  P+  +    + + G ++  +TAQL+A+A Q+G+ LTPAA  A AS MA  +Q N     QS  G                                GS Q+  +      G+      NG++V++V+NLN ++  PDALFTLFGVYGDV RVK+MFNKK+TAL+QF +  QA+TA++ L+   LW K M + VS+ N++QLP ED  +GLTKDY+NS LHRF+KPNSKN+QNI+PPS V+HLSNIPP+ +E D+  +    G+EV  F+F+  D KMAL++L +V+ AI  LIE HN +L+E +HLRISFSK+  
Sbjct:   14 NENKKSRIEY-VETVPSKVVHIRNMPDDATEHEIALLGIPFGLLENMVLSKKANQALLEMQCLESAIMMVSYYREYQVTLRGRNLVMQYSKHQHLELHSENSSIGNAIQNANCIVQQDL--SGANSGMPTTVLRVVVDNIMGQQINHTILHKIFYRYGKILRIVTYLKNNQYHGLVEFGNHIHAFVAMLHLNGQNIYTGCCSLRVQFSKNRGPLEVRQESDRCRDYLNNPLTEEELMSLRRPTAGSERHHNSNPGHVSSNFQNSVVTNMAHQGIHLPVGMIAPPNTSSMGINE--LTAQLAALAQQSGLALTPAAVAATASFMALTSQ-NSGPGTQSMSGTPNLSTILAALQGGAVQTGVLPHMSGGNASVMGSVQTPVSSHVTPVGVRSPPNNNGSTVLIVSNLNEDRVYPDALFTLFGVYGDVTRVKIMFNKKDTALIQFNDPHQALTALQFLNGQRLWDKPMKIAVSRHNIVQLPKEDTENGLTKDYTNSLLHRFRKPNSKNFQNIYPPSHVLHLSNIPPSVTENDIRVLFATKGFEVTGFRFM-KDNKMALVQLETVDLAIQSLIELHNSQLTENSHLRISFSKSAV 597          
BLAST of Polypyrimidine tract-binding protein 1 vs. TrEMBL
Match: A0A3Q0KEH4 (Putative polypyrimidine tract binding protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 444.506 bits (1142), Expect = 4.792e-146
Identity = 246/591 (41.62%), Postives = 362/591 (61.25%), Query Frame = 3
Query:  111 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLVQSANEKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYS------------------------------FPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWG-------------------------------FGSNQSQNAMFNPNSGIE-----NGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMEDANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKAGA 1685
            N +KK ++E  ++  PS+V+HIRN+P +  +  +A+L +PFG ++N+V  +K NQAL++M+ L  AI M  Y+ +Y   + G++L +Q+SKHQ L+L + NS+I   +Q+AN   +  L     N+G  + +LR+++DN     INH + +KIF R+G+I+RIV++ KNNQ+HGLVEF + + + VA L LNG N+   C ++R+ FSKN GPL+V+++SD+ RDY+ +PL   EL  L  P                                  P+  +    + + G ++  +TAQL+A+A Q+G+ LTPAA  A AS MA  +Q N     QS  G                                GS Q+  +      G+      NG++V++V+NLN ++  PDALFTLFGVYGDV RVK+MFNKK+TAL+QF +  QA+TA++ L+   LW K M + VS+ N++QLP ED  +GLTKDY+NS LHRF+KPNSKN+QNI+PPS V+HLSNIPP+ +E D+  +    G+EV  F+F+  D KMAL++L +V+ AI  LIE HN +L+E +HLRISFSK+  
Sbjct:   37 NENKKSRIEY-VETVPSKVVHIRNMPDDATEHEIALLGIPFGLLENMVLSKKANQALLEMQCLESAIMMVSYYREYQVTLRGRNLVMQYSKHQHLELHSENSSIGNAIQNANCIVQQDL--SGANSGMPTTVLRVVVDNIMGQQINHTILHKIFYRYGKILRIVTYLKNNQYHGLVEFGNHIHAFVAMLHLNGQNIYTGCCSLRVQFSKNRGPLEVRQESDRCRDYLNNPLTEEELMSLRRPTAGSERHHNSNPGHVSSNFQNSVVTNMAHQGIHLPVGMIAPPNTSSMGINE--LTAQLAALAQQSGLALTPAAVAATASFMALTSQ-NSGPGTQSMSGTPNLSTILAALQGGAVQTGVLPHMSGGNASVMGSVQTPVSSHVTPVGVRSPPNNNGSTVLIVSNLNEDRVYPDALFTLFGVYGDVTRVKIMFNKKDTALIQFNDPHQALTALQFLNGQRLWDKPMKIAVSRHNIVQLPKEDTENGLTKDYTNSLLHRFRKPNSKNFQNIYPPSHVLHLSNIPPSVTENDIRVLFATKGFEVTGFRFM-KDNKMALVQLETVDLAIQSLIELHNSQLTENSHLRISFSKSAV 620          
BLAST of Polypyrimidine tract-binding protein 1 vs. TrEMBL
Match: A0A5K4ECD7 (Putative polypyrimidine tract binding protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 443.736 bits (1140), Expect = 9.187e-146
Identity = 246/591 (41.62%), Postives = 362/591 (61.25%), Query Frame = 3
Query:  111 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLVQSANEKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYS------------------------------FPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWG-------------------------------FGSNQSQNAMFNPNSGIE-----NGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMEDANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKAGA 1685
            N +KK ++E  ++  PS+V+HIRN+P +  +  +A+L +PFG ++N+V  +K NQAL++M+ L  AI M  Y+ +Y   + G++L +Q+SKHQ L+L + NS+I   +Q+AN   +  L     N+G  + +LR+++DN     INH + +KIF R+G+I+RIV++ KNNQ+HGLVEF + + + VA L LNG N+   C ++R+ FSKN GPL+V+++SD+ RDY+ +PL   EL  L  P                                  P+  +    + + G ++  +TAQL+A+A Q+G+ LTPAA  A AS MA  +Q N     QS  G                                GS Q+  +      G+      NG++V++V+NLN ++  PDALFTLFGVYGDV RVK+MFNKK+TAL+QF +  QA+TA++ L+   LW K M + VS+ N++QLP ED  +GLTKDY+NS LHRF+KPNSKN+QNI+PPS V+HLSNIPP+ +E D+  +    G+EV  F+F+  D KMAL++L +V+ AI  LIE HN +L+E +HLRISFSK+  
Sbjct:   28 NENKKSRIEY-VETVPSKVVHIRNMPDDATEHEIALLGIPFGLLENMVLSKKANQALLEMQCLESAIMMVSYYREYQVTLRGRNLVMQYSKHQHLELHSENSSIGNAIQNANCIVQQDL--SGANSGMPTTVLRVVVDNIMGQQINHTILHKIFYRYGKILRIVTYLKNNQYHGLVEFGNHIHAFVAMLHLNGQNIYTGCCSLRVQFSKNRGPLEVRQESDRCRDYLNNPLTEEELMSLRRPTAGSERHHNSNPGHVSSNFQNSVVTNMAHQGIHLPVGMIAPPNTSSMGINE--LTAQLAALAQQSGLALTPAAVAATASFMALTSQ-NSGPGTQSMSGTPNLSTILAALQGGAVQTGVLPHMSGGNASVMGSVQTPVSSHVTPVGVRSPPNNNGSTVLIVSNLNEDRVYPDALFTLFGVYGDVTRVKIMFNKKDTALIQFNDPHQALTALQFLNGQRLWDKPMKIAVSRHNIVQLPKEDTENGLTKDYTNSLLHRFRKPNSKNFQNIYPPSHVLHLSNIPPSVTENDIRVLFATKGFEVTGFRFM-KDNKMALVQLETVDLAIQSLIELHNSQLTENSHLRISFSKSAV 611          
BLAST of Polypyrimidine tract-binding protein 1 vs. TrEMBL
Match: A0A5J4P405 (Polypyrimidine tract-binding protein 1 (Fragment) OS=Paragonimus westermani OX=34504 GN=DEA37_0012445 PE=4 SV=1)

HSP 1 Score: 434.491 bits (1116), Expect = 4.529e-142
Identity = 249/590 (42.20%), Postives = 358/590 (60.68%), Query Frame = 3
Query:  120 KKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLVQSANEKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQL----------------------QLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELE---------GPQYSFPLFAVGRSMS-------------MARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSN-WGFGSNQSQNAMFNPNSGIEN------------------------GNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMEDANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKAG 1682
            KK +M+  I   PS V+H+RN+P +V++  +A+LA+PFG I N+V  +KNNQ+LI+M  L +AIE+  Y+ +Y  L++GK++ +QFS H  L+L + NS +D  V++AN   +  L      +G  + +LRI+I+N     INH++ YKIF RFG+I+R++ F + NQ+  ++EF + + + VA L                       LNG N+   C ++R++FS+  GPL+V+R++DK RDY  SPL   EL             G    FP   +G+++S              A       + AQL+ +A Q+G+ L+PAAA A AS MA   Q    T   S   G  +  S  A+ NP S I +                        G++V++V+N+N EK  PDALFT+FGVYGDV RVK+MFNKK+TALVQFA+ QQA+TA+  ++   LWGK + + VS+ NV+Q+P ED + GLTKDY+NS LHRF+KPNSKN+QNI+PP+ V+HLSNIPP  +E ++  + +  GYEV  FKF+  DK+MAL++L SV+ AI  LIE HN +LSE +HLRISFSK G
Sbjct:   33 KKSRMDH-ITGLPSCVVHVRNMPSDVNENEIALLAIPFGIIKNMVLSKKNNQSLIEMEVLEDAIELVSYYEKYPVLLHGKNIILQFSTHTYLELTSENSLVDNAVKNANRIVQQDL--SGAQSGNPNSVLRIVIENIMGQQINHVILYKIFHRFGKILRVLIFLRQNQYQCMLEFQNHIQAFVAMLVSTRWYLCIASCCGCSVLCAFSHLNGQNIYTGCCSLRVEFSRTRGPLEVRRENDKCRDYTISPLMEEELNSPSSASATVNPMGTVGGFPGNVIGQNLSAVNPGANVSGLGTTAAAPGINELAAQLTLLAQQSGMALSPAAATATASFMALTAQGAAGTCLASPPSGAATLLSGAALGNPPSAIMSLPTQAQFLPAIQQTIPGLAQAANAGSTVLIVSNMNEEKVYPDALFTIFGVYGDVNRVKIMFNKKDTALVQFADAQQAVTALYFMNGQPLWGKPLKIAVSRFNVVQMPKEDTDVGLTKDYANSPLHRFRKPNSKNFQNIYPPNHVLHLSNIPPNITEEEIRSLFQSKGYEVSGFKFMQKDKRMALVQLGSVDLAIQALIELHNCQLSENSHLRISFSKMG 619          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Cavefish
Match: ptbp1b (polypyrimidine tract binding protein 1 [Source:NCBI gene;Acc:103035814])

HSP 1 Score: 341.273 bits (874), Expect = 3.658e-110
Identity = 201/535 (37.57%), Postives = 297/535 (55.51%), Query Frame = 3
Query:  111 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRN--NNSNIDKLVQSANEKRKHYL-INWANNTG--GASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQE------LEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMED-ANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            N  KK K +      PSRVIH+R +P ++++  V  L +PFG + N++ ++  NQA ++M     A  M  Y++   P++    +F+Q+S H++L   N  N       +Q+ N  +   + I   + +G  G S +LR++++N     +   V ++IFS+FG ++++++FTKNNQ   L++FA  L++  A+L L+G N+   C T+RI FSK    L V+  +DK RDY    L   + Q       + G  ++ P        + A      F   Q + + +  GV          A    A        A     GF +             +  G+ V+LV+NLN E+  P  LF LFGVYGDV+RVK+MFNKK  ALVQ ++  QA  A+ +L+   L+G+ + + +SK   +QLP E   + GLTKDYSNS LHRFKKP SKNY NIFPPS+ +HLSNIPP+  E DL  +   +G  VK FKF   D+KMAL+++ SVE+AI  LIEFHN  L E +HLR+SFSK+
Sbjct:   43 NDSKKFKGDIRSPGIPSRVIHVRKLPSDINEAEVISLGLPFGKVTNLLMLKGKNQAFLEMNTEEAAQTMVSYYSSVTPVIRNHPIFMQYSNHKELKTDNSPNQVRAQAALQAVNAVQTGSMAIAGVDPSGVTGPSPVLRVIVENL-FYPVTLDVLHQIFSKFGTVLKVITFTKNNQFQALLQFADGLTAQHAKLALDGQNIYNACCTLRISFSKLTS-LNVKYNNDKSRDYTRPDLPTGDSQPAIEHHAMAGAAFATPGIISAAPYAGAHAFPPAFAFQQAAGL-TMPGVP--------GALASLAIPGAAAAAAAAGRLGFPT-------------LSGGHCVMLVSNLNPERVTPQCLFILFGVYGDVIRVKIMFNKKENALVQMSDGTQAQLAMSHLNGQKLYGRALRITLSKHTTVQLPREGHEDQGLTKDYSNSPLHRFKKPGSKNYSNIFPPSSTLHLSNIPPSVVEDDLKMLFSTSGALVKNFKFFQKDRKMALIQMGSVEEAIESLIEFHNHDLGENHHLRVSFSKS 553          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Cavefish
Match: ptbp1b (polypyrimidine tract binding protein 1 [Source:NCBI gene;Acc:103035814])

HSP 1 Score: 340.887 bits (873), Expect = 6.416e-110
Identity = 201/535 (37.57%), Postives = 297/535 (55.51%), Query Frame = 3
Query:  111 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRN--NNSNIDKLVQSANEKRKHYL-INWANNTG--GASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQE------LEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMED-ANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            N  KK K +      PSRVIH+R +P ++++  V  L +PFG + N++ ++  NQA ++M     A  M  Y++   P++    +F+Q+S H++L   N  N       +Q+ N  +   + I   + +G  G S +LR++++N     +   V ++IFS+FG ++++++FTKNNQ   L++FA  L++  A+L L+G N+   C T+RI FSK    L V+  +DK RDY    L   + Q       + G  ++ P        + A      F   Q + + +  GV          A    A        A     GF +             +  G+ V+LV+NLN E+  P  LF LFGVYGDV+RVK+MFNKK  ALVQ ++  QA  A+ +L+   L+G+ + + +SK   +QLP E   + GLTKDYSNS LHRFKKP SKNY NIFPPS+ +HLSNIPP+  E DL  +   +G  VK FKF   D+KMAL+++ SVE+AI  LIEFHN  L E +HLR+SFSK+
Sbjct:   54 NDSKKFKGDIRSPGIPSRVIHVRKLPSDINEAEVISLGLPFGKVTNLLMLKGKNQAFLEMNTEEAAQTMVSYYSSVTPVIRNHPIFMQYSNHKELKTDNSPNQVRAQAALQAVNAVQTGSMAIAGVDPSGVTGPSPVLRVIVENL-FYPVTLDVLHQIFSKFGTVLKVITFTKNNQFQALLQFADGLTAQHAKLALDGQNIYNACCTLRISFSKLTS-LNVKYNNDKSRDYTRPDLPTGDSQPAIEHHAMAGAAFATPGIISAAPYAGAHAFPPAFAFQQAAGL-TMPGVP--------GALASLAIPGAAAAAAAAGRLGFPT-------------LSGGHCVMLVSNLNPERVTPQCLFILFGVYGDVIRVKIMFNKKENALVQMSDGTQAQLAMSHLNGQKLYGRALRITLSKHTTVQLPREGHEDQGLTKDYSNSPLHRFKKPGSKNYSNIFPPSSTLHLSNIPPSVVEDDLKMLFSTSGALVKNFKFFQKDRKMALIQMGSVEEAIESLIEFHNHDLGENHHLRVSFSKS 564          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Cavefish
Match: ptbp2b (polypyrimidine tract-binding protein 2-like [Source:NCBI gene;Acc:103030091])

HSP 1 Score: 329.331 bits (843), Expect = 1.076e-105
Identity = 203/531 (38.23%), Postives = 312/531 (58.76%), Query Frame = 3
Query:  120 KKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNN-NSNIDKLVQSANEKRKHYLINWANNTGG-------ASEILRILIDNA--PNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMEDA-NHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            KK+++E  +D  PSRVIHIR +P EV +T V  L +PFG + NI+ ++  NQA +++     A+ M +Y+    P +    +FIQ+S H++L   +  N     ++Q+ +  ++    + +++T G        S +LRI+IDN   P   +   V  +IFS+FG +++I++FTKNNQ   L++F+  +++  A+L L+G N+   C T+RIDFSK    L V+  +DK RDY      R EL   +G         V  SM+ A   D        S + S +G+  + ++A A  S + A + ++   A  +  G      + A+    SG   G  V+L +NLN E   P +LFTLFGVYGDV RVK+++NKK++AL+Q A+  QA  A+ +L+   ++GK + + +SK   +QLP E   + GLTKD++NS LHRFKKP SKN+QNIFPPSA +HLSN+    +E DL  +   +G  VK FKF   D+KMALL++++VE+AI  LI+ HN  +   + LR+SFSK+
Sbjct:   40 KKLRVEDSMDSPPSRVIHIRKLPNEVSETEVIALGLPFGKVTNILMLKGKNQAFLELGTEEAAVTMVNYYTAVTPQVRNVPVFIQYSNHKELKTDSALNQRAQAVLQAVSAVQEGG--SPSSDTAGDSILSPAPSPVLRIIIDNMFYP---VTLDVLQQIFSKFGTVMKIITFTKNNQFQALLQFSDPVNAQQAKLSLDGQNIYNSCCTLRIDFSKLVN-LNVKYNNDKSRDY-----TRPELPAGDGQP------PVDPSMAAALSKDST------SLLGSPSGMVTSYSSAGAYPSSLGAISPLSAAAAAAAAAG------RVAL----SGHSGGGGVLLASNLNDEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQAQLAMSHLNGQKMYGKIIRVTLSKHQTVQLPREGLDDQGLTKDFTNSPLHRFKKPGSKNFQNIFPPSATLHLSNVRDDVTEEDLRLLFSNSGGTVKAFKFF-QDRKMALLQMSTVEEAIQALIDLHNYDMGRGHRLRVSFSKS 536          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Cavefish
Match: ptbp2a (polypyrimidine tract-binding protein 2 [Source:NCBI gene;Acc:103025597])

HSP 1 Score: 324.324 bits (830), Expect = 1.952e-104
Identity = 203/537 (37.80%), Postives = 301/537 (56.05%), Query Frame = 3
Query:   81 MDDFSQNSFDNSHKKVKMEQGI-DEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLVQSANEKRKHYLINWANNTGGASEILRILIDNA--PNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMEDAN-HGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            + D + N  D+  KK+++E  + D  PSRV+HIR +P EV +T V  L +PFG + NI+ ++  NQA +++     AI M +Y++   P +    +FIQ+S H++L   N           AN+       +    T  +S +LRI+IDN   P   +   V  +IFS+FG +++I++FTKNNQ   L+++    S+  A++ L+G N+   C T+RID+SK    L V+  +DK RDY      R EL   +G        AV  SM+ A   D   +   LS +++                   A      R A   + G             NSG      V+LV+NLN E   P +LFTLFGVYGDV RVK+++NKK++AL+Q A+  QA  A+ +L+   ++ K + + +SK   +QLP +  +  GLTKD++NS LHRFKKP SKN+QNIFPPSA +HLSNIP   +E DL  +   +G  VK FKF   D+KMAL++L++VE+AI  LI+ HN  + + +HLR+SFSK+
Sbjct:   12 ISDGTSNGSDS--KKLRVEDRVGDAPPSRVLHIRKLPNEVSETEVIALGLPFGKVTNILTLKGKNQAFLELSTEEAAITMVNYYSAVTPHVRNVPVFIQYSNHKELKTDN-----------ANQSTPSSGSSDGTLTSPSSPVLRIIIDNMFYP---VTLDVLQQIFSKFGTVMKIITFTKNNQFQALLQYNDAGSAQQAKVALDGQNIYNACCTLRIDYSKLVN-LNVKYNNDKSRDY-----TRPELPAGDGQP------AVDPSMAAAFSKDSNSLLGALSPLSAAA-----------------AAAAAAGRVALSGHSG-------------NSG------VLLVSNLNEEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADLNQAQLAMSHLNGQKMYSKIIRVTMSKHQTVQLPRDGLDDQGLTKDFTNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPQDITEDDLRVLFTNSGGTVKAFKFF-QDRKMALIQLSTVEEAIQCLIDLHNYNMGDNHHLRVSFSKS 483          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Cavefish
Match: ptbp2b (polypyrimidine tract-binding protein 2-like [Source:NCBI gene;Acc:103030091])

HSP 1 Score: 325.094 bits (832), Expect = 2.184e-104
Identity = 197/531 (37.10%), Postives = 298/531 (56.12%), Query Frame = 3
Query:  120 KKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNN-NSNIDKLVQSANEKRKHYLINWANNTGG-------ASEILRILIDNA--PNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMEDA-NHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            KK+++E  +D  PSRVIHIR +P EV +T V  L +PFG + NI+ ++  NQA +++     A+ M +Y+    P +    +FIQ+S H++L   +  N     ++Q+ +  ++    + +++T G        S +LRI+IDN   P   +   V  +IFS+FG +++I++FTKNNQ   L++F+  +++  A+L L+G N+   C T+RIDFSK    L V+  +DK RDY      R EL   +G         V  SM+ A   D   +   +S +++                   A      R A                    SG   G  V+L +NLN E   P +LFTLFGVYGDV RVK+++NKK++AL+Q A+  QA  A+ +L+   ++GK + + +SK   +QLP E   + GLTKD++NS LHRFKKP SKN+QNIFPPSA +HLSN+    +E DL  +   +G  VK FKF   D+KMALL++++VE+AI  LI+ HN  +   + LR+SFSK+
Sbjct:   40 KKLRVEDSMDSPPSRVIHIRKLPNEVSETEVIALGLPFGKVTNILMLKGKNQAFLELGTEEAAVTMVNYYTAVTPQVRNVPVFIQYSNHKELKTDSALNQRAQAVLQAVSAVQEGG--SPSSDTAGDSILSPAPSPVLRIIIDNMFYP---VTLDVLQQIFSKFGTVMKIITFTKNNQFQALLQFSDPVNAQQAKLSLDGQNIYNSCCTLRIDFSKLVN-LNVKYNNDKSRDY-----TRPELPAGDGQP------PVDPSMAAALSKDSTSLLGAISPLSAAA-----------------AAAAAAGRVA-------------------LSGHSGGGGVLLASNLNDEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQAQLAMSHLNGQKMYGKIIRVTLSKHQTVQLPREGLDDQGLTKDFTNSPLHRFKKPGSKNFQNIFPPSATLHLSNVRDDVTEEDLRLLFSNSGGTVKAFKFF-QDRKMALLQMSTVEEAIQALIDLHNYDMGRGHRLRVSFSKS 516          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008413.1 (pep scaffold:Pmarinus_7.0:GL478562:177533:180128:-1 gene:ENSPMAG00000007617.1 transcript:ENSPMAT00000008413.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 116.701 bits (291), Expect = 6.858e-31
Identity = 57/130 (43.85%), Postives = 83/130 (63.85%), Query Frame = 3
Query: 1290 LWGKQMHLHVSKTNVIQLPMEDANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            ++GK + +  S+   +QLP  D +  LT D+S+S LHRF++  +KN+ +IFPPS  +HLSNIP +  E DL  +    G  VK  KF   D KMAL+++ S+E+AI  L E HN +L +   LR+SFSK+
Sbjct:   30 MYGKPIRVTSSRYQTVQLP-RDGSDSLTCDFSDSPLHRFRRMGAKNFHHIFPPSVTLHLSNIPSSVLEDDLKTLFESNGCVVKALKFFATDHKMALVQMESLEEAIQTLAELHNHELEKNRLLRVSFSKS 158          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006507.1 (pep scaffold:Pmarinus_7.0:GL480554:3468:10153:1 gene:ENSPMAG00000005883.1 transcript:ENSPMAT00000006507.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 118.242 bits (295), Expect = 3.948e-30
Identity = 74/255 (29.02%), Postives = 137/255 (53.73%), Query Frame = 3
Query:  147 DEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLVQSANEKRKHYLI-------NWANNTGGASEILRILIDNAPNLI--INHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLF-AVGRSMSM 881
            DE PS+V+HIR +P+   +  V  LA+PFG + NI+ ++  +QA ++M     A+    +++   P++  + +++Q+S ++ L   N+     +      +K +  ++          N+    S IL I+++   NL+  I   V + +FS++G +++I+ F KN+Q+  L++FA   ++H A+  L+G N+   C T+R+ FS+    L V+  ++K RD     L R +L   EG Q  FPL  A G+  S+
Sbjct:   22 DELPSKVLHIRKLPENATEAEVVTLALPFGRVTNILMLKGKSQAFLEMASEEAAVAAVTFYSTDPPVLRNQPVYVQYSTYKSLKTDNSAYQAARSHARREQKAQAAMMVANGSDSEETNSAAPQSPILHIIVE---NLLYPITLEVLHHVFSKYGTVLKIIIFNKNSQYQALMQFADASNAHQAKTMLDGQNIYNGCCTLRVGFSRLTN-LNVKYNNEKSRD-----LTRPDLPAGEG-QGPFPLMRAQGKETSL 266          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Sea Lamprey
Match: HNRNPLL (heterogeneous nuclear ribonucleoprotein L like [Source:HGNC Symbol;Acc:HGNC:25127])

HSP 1 Score: 116.701 bits (291), Expect = 1.996e-28
Identity = 117/468 (25.00%), Postives = 184/468 (39.32%), Query Frame = 3
Query:  156 PSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLVQSANEKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSK--NPGPLQVQRQSDKVRDYMESPLNRTELQELEGP------QYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNS----------GIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVI----QLPMEDANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSE 1493
            PS V+HIR +    D++ V      FG + ++V +    QAL++   L +A             + G+  +  FS  Q++  +                        A++    + IL + ++NA   I    V + I S +G + RIV F KN     L  F S  S+  A+  LNGA++   C T++I+++K   P  L V R   +  DY            LEGP      Q   P   +G   S  RG   Q  T                            C Q        S   FG+ +    M  P +          G    N V++V N+N    N   LF L  +YG+V ++K + +K    ++Q A+      A+ NL+   L+G+++ L VSK   I       +ED +    +D+  S  +RF      +   I PPSA++H  + PP  SE
Sbjct:   10 PSPVVHIRGLASSADESQVMEALQEFGTVRHVVMMPHRRQALVEFERLEDARACVAGTAGDPVYVGGQPAYCNFSTSQRISRKGGTP--------------------ADDVARTNHILLLTVNNALYPITTE-VIHTICSPYGVVQRIVIFKKNGVQ-ALRTFDSIPSAQQAKSSLNGADIYSGCCTLKIEYAKERKPARLNVYRNDSETWDYT-----------LEGPCVPNGQQKKQPAL-LGDHPSTMRGYGNQQGT---------------------------YCPQNYSFNNYTSGSPFGNARPTTPMSGPGTCAPHNNPCPMGGSAANRVMMVYNMNPSVMNCSRLFNLVCLYGNVEKIKFLKSKPGVGMIQMADAASVDRAVANLNTAQLFGQKLSLSVSKQQEIVAGQAFELEDGSDSF-RDFVGSRHNRFSTHEQASKNRILPPSAILHFYSAPPEFSE 415          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006509.1 (pep scaffold:Pmarinus_7.0:GL480554:3489:6552:1 gene:ENSPMAG00000005883.1 transcript:ENSPMAT00000006509.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.1225 bits (222), Expect = 6.432e-21
Identity = 49/185 (26.49%), Postives = 101/185 (54.59%), Query Frame = 3
Query:  147 DEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLVQSANEKRKHYLI-------NWANNTGGASEILRILIDNAPNLI--INHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQ 674
            DE PS+V+HIR +P+   +  V  LA+PFG + NI+ ++  +QA ++M     A+    +++   P++  + +++Q+S ++ L   N+     +      +K +  ++          N+    S IL I+++   NL+  I   V + +FS++G +++I+ F KN+Q+  L++FA   ++H A+
Sbjct:   15 DELPSKVLHIRKLPENATEAEVVTLALPFGRVTNILMLKGKSQAFLEMASEEAAVAAVTFYSTDPPVLRNQPVYVQYSTYKSLKTDNSAYQAARSHARREQKAQAAMMVANGSDSEETNSAAPQSPILHIIVE---NLLYPITLEVLHHVFSKYGTVLKIIIFNKNSQYQALMQFADASNAHQAK 196          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Sea Lamprey
Match: HNRNPLL (heterogeneous nuclear ribonucleoprotein L like [Source:HGNC Symbol;Acc:HGNC:25127])

HSP 1 Score: 63.929 bits (154), Expect = 4.946e-11
Identity = 58/209 (27.75%), Postives = 98/209 (46.89%), Query Frame = 3
Query: 1098 GNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVI------QLPMEDANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIP-PTTSE--GDLSDMIRIA-GYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKN-----HLRISFSKA 1679
            GN V++V   +AE+ N D +F +  ++G+V +VK + +K   A+V+  +      A+ +L+   ++GK+++L VSK   I      +LP  D  +   KD++ S  +RF          I  P+ V+H  N P   T+E    L D + IA     K F    +     L+E  +  DA+  L   ++  L   N      L++ FS A
Sbjct:  313 GNKVLMVYGFDAERINCDRVFNILCLFGNVEKVKFLKSKPGAAMVEMGDPYAVDRAVSHLNMSQIFGKKINLCVSKQQSIVPGQAYELP--DGTNSY-KDFTGSRNNRFANAEKAAKNRIQQPTTVLHFFNAPMDITAEIFMQLCDEMSIARPLSFKAFSGKSDKSMSGLMEWENKNDAMEALACINHHSLKNANGPYPYTLKLCFSTA 518          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Nematostella
Match: EDO43995 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXA3])

HSP 1 Score: 220.32 bits (560), Expect = 2.351e-65
Identity = 108/194 (55.67%), Postives = 142/194 (73.20%), Query Frame = 3
Query: 1098 GNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMEDANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            G+ +VLV+NLN E  + DALFTLFG YGDV RVK++FNKK+TALVQFAN  QA TAI +L+   ++GK+M +  SK   + LP E  +  LTKDY NS LHRFKKP SKN+QNIFPPS  +HLSNIP + +E +L+ M    G +V  F+FLP D+KMA L + + E+AI  LI+ HN K+SE +HLR+SF+++
Sbjct:  276 GSPLVLVSNLNEEMISCDALFTLFGCYGDVQRVKILFNKKDTALVQFANVHQAQTAIGHLNGVRVFGKEMKVTNSKHTSVSLPKEGEDTNLTKDYMNSPLHRFKKPGSKNFQNIFPPSRTLHLSNIPESVTEEELTSMFEDCG-DVADFRFLPKDRKMAHLSMATTEEAIDALIKMHNYKISETHHLRVSFARS 468          

HSP 2 Score: 124.405 bits (311), Expect = 1.535e-30
Identity = 72/227 (31.72%), Postives = 123/227 (54.19%), Query Frame = 3
Query:  159 SRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLVQSANEKRKHYLI-NWANNTGGASE-------ILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTE 815
            S+V+H+RNV  E  D  +  L +P+G + N++ ++  NQA ++M+    A+ + + ++   P + G+ ++IQ+S HQ+L    N S     V+  +       I +  +  G A E       ILRI+++N    I    V  +IF+++G +++IV FT+NNQ   LV+F+ +  +  A+  L+G N+   C T+RID+SK    L V+  +DK RDY    L   E
Sbjct:    2 SKVLHLRNVAAEATDAEIIALGIPYGRVTNVLMLKGKNQAFLEMKTKENAMALMNSYSYIPPSIRGRQIYIQYSNHQELT--TNESQHSPGVRGLSSSHLGAGIGSLTSGLGIAGELPSVNGCILRIIVENMLYPITIE-VLNQIFTKYGTVLKIVIFTRNNQFQALVQFSQSTEARAAKCSLDGQNIYNGCCTLRIDYSKLK-TLSVKYNNDKTRDYTRPDLPSGE 224          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Nematostella
Match: EDO26232 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TCJ0])

HSP 1 Score: 142.895 bits (359), Expect = 2.046e-40
Identity = 70/140 (50.00%), Postives = 97/140 (69.29%), Query Frame = 3
Query: 1263 AIRNLDACFLWGKQMHLHVSKTNVIQLPMEDANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKAG 1682
            AI +L+   ++GK+M +  SK   + LP E  +  LTKDY NS LHRFKKP SKN+QNIFPPS  +HLSNIP + +E +L+ M    G +V  F+FLP D+KMA L + + E+AI  LI+ HN K+SE +HLR+SF+++ 
Sbjct:    1 AIGHLNGVRVFGKEMKVTNSKHTSVSLPKEGEDTNLTKDYMNSPLHRFKKPGSKNFQNIFPPSRTLHLSNIPESVTEEELTSMFEDCG-DVADFRFLPKDRKMAHLSMATTEEAIDALIKMHNYKISETHHLRVSFARSS 139          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Nematostella
Match: EDO35537 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLA1])

HSP 1 Score: 91.6633 bits (226), Expect = 2.580e-21
Identity = 71/213 (33.33%), Postives = 102/213 (47.89%), Query Frame = 3
Query:  156 PSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPL-MYGKHLFIQFSKHQQLDLRNNNSNIDKLVQSANEKRKHYLINWANNTGG-ASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDY 788
            PSRVIH R V     +T +  +  PFG I  +  + K  QAL++   L  AI +  Y +Q  PL + G+ +F+ +SK Q++                  KR   L   +N     AS IL + I N P   IN  + +KI S  G+++RIV F KN    GL      LS+  A   LNG ++   C T++ID+SK    L V +  D+  DY
Sbjct:    5 PSRVIHCRAVADGCKETDLIQVLQPFGTITYVTLLPKIRQALVEFESLESAIAVVTY-SQTSPLTVLGRQMFVNYSKSQEI------------------KRDKVLNGDSNGACAEASNILLLTIIN-PLHPINVKILHKICSPSGKVLRIVIFHKN----GL----QALSAERALAVLNGQDIYAGCCTLKIDYSKKAKKLNVFKNDDETWDY 189          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Nematostella
Match: EDO39119 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAW4])

HSP 1 Score: 80.4925 bits (197), Expect = 5.513e-16
Identity = 53/204 (25.98%), Postives = 93/204 (45.59%), Query Frame = 3
Query: 1038 GFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLP-----MEDANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGY----EVKKFKFLPNDKKMA-LLELNSVEDAIHVLI 1619
            G+G+   Q           +G +V++V  L+ +K N D LF L   YG+V+++K +  K  TA+ +   H    T + NL    L+ +Q+    SK + +  P     + D +    K + NS  +RF    + +   +F P  V+H  N P   +E  + +M ++ G      +K F    N +  + L+E  SV  A+  L+
Sbjct:  282 GYGAQPMQAPQMQTYRNHPSGGNVIMVYGLDKDKMNCDRLFNLLCCYGNVIKIKFLLGKPGTAMAELHEHVACNTVMENLSKMTLFDQQLEFSFSKQDYLVEPANVPNLPDGSPSF-KSFDNSKNNRFTSATASSKNRVFTPMKVLHFFNAPVDCTEEQIREMCQVCGVAPPKTIKMFSPSGNARTSSGLIEWESVTQALEALV 484          

HSP 2 Score: 65.4698 bits (158), Expect = 3.025e-11
Identity = 54/217 (24.88%), Postives = 96/217 (44.24%), Query Frame = 3
Query:  153 KPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVP-LMYGKHLFIQFSKHQQLDLRNNNSNIDKLVQSANEKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVE--FASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYME 794
            +PSRV+H+R V  E  +  +      +G I  I  + K  QAL++  E+  A  + +      P ++ G+  +  +SK +Q+  RN +      V+S  +  K  LI   N                P  ++   + + IFS+ G + RIV F K+     + E  F    ++  A+  LNGA++   C T++I+       L V++   +  DY +
Sbjct:   45 EPSRVVHVRGVADEAREQDLMQCLSQYGNISCITMMPKIRQALVEFEEIACANTLVNQTQMGNPVILCGRPAYANYSKSKQIS-RNVH------VRSETQPNKILLITIIN----------------PQYVVTTDILHTIFSKQGMVQRIVIFRKSGLQAMVEESRFDCVEAARHAKETLNGADIYTGCNTLKIESQGYAQQLNVRKNDSETYDYTQ 238          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Nematostella
Match: EDO35536 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLA0])

HSP 1 Score: 62.3882 bits (150), Expect = 3.781e-11
Identity = 51/185 (27.57%), Postives = 89/185 (48.11%), Query Frame = 3
Query: 1107 VVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSK-------TNVIQLPMEDANHGLTKDYSNSTLHRFKKPNSKNYQNIF---PPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVK---KFKFLPNDKKMA-LLELNSVEDAIHVLI 1619
            +++V  LN EK N + +F LF +YG+V++VK + NK    +VQ ++   +   IRNL    ++  ++++  SK       + V  LP    +     +++++  +RFK  N     ++    PP+ ++H  N PP  +   L D+   AG        F    N K  A LLE+  +  A+  LI
Sbjct:    1 MLMVYGLNHEKMNCERIFNLFCLYGNVIKVKFLTNKPGACMVQMSDKIASEMIIRNLSGATIFDNKINIMFSKHPFIADSSVVTALPDSSPS---AMNFADNRNNRFKYDNMPFLDSVVGYQPPTRMLHFFNAPPNCTVDQLRDVSTKAGALAPLKGTFFSKANTKSSAGLLEMPDIRSAMEALI 182          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Medaka
Match: ENSORLT00000042697.1 (polypyrimidine tract-binding protein 1 [Source:NCBI gene;Acc:101170752])

HSP 1 Score: 335.109 bits (858), Expect = 1.980e-108
Identity = 203/527 (38.52%), Postives = 290/527 (55.03%), Query Frame = 3
Query:  111 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLVQSANEKRKHYLINWANNTGGASEILRILIDNAPNLI--INHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGR-SMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMED-ANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            N  KK K +      PSRV+HIR +P ++ +T V  L +PFG + N++ ++  NQA ++M     A  M  Y++  +P++  + +F+QFS H+  +L+ +NS   +  Q+A        ++ A      S +LR++++N   L+  ++     +IFS+FG ++RI+ FTKNNQ   L+++A   S+  A++ L+G N+   C T+RI FSK    L V+  +DK RD+    L   + Q     Q     F  G  S S   G    F  A      S     LT                 +      +  GF               I  G+SVVLV+NLNAE+  P  LF LFGVYGDVMRVK++FNKK  ALVQ ++  QA  A+ +L+   L G+ + + +SK   +QLP E   + GLTKDYS+S LHRFKKP SKNY NIFPPSA +HLSNIPP+  E DL  +   +G  VK FKF   D KMAL+++ SVE+AI  LI+ HN  L E +HLR+SFSK+
Sbjct:    8 NDSKKFKGDLRGPNVPSRVLHIRKLPIDITETEVISLGLPFGDVTNLLMLKAKNQAFLEMNSEEAAQNMVGYYSTVMPIIRQQPVFVQFSNHK--ELKTDNSPNQERAQAALRALSSSHVDTAALVVAPSSVLRVVVEN---LLYPVSLDALCQIFSKFGTVLRIIVFTKNNQFQALLQYAEGASAQAAKVSLDGQNIYNGCCTLRISFSKLTT-LNVKYNNDKSRDFTRPDLPSGDGQPTMEHQAMATAFGPGIISASPYTGATHAFPPAFALQPVSSPYAGLT--------MSGLPGTLASLTLPAGARLGF-------------PAIPAGHSVVLVSNLNAERVTPHCLFILFGVYGDVMRVKILFNKKENALVQMSDSTQAQLAMSHLNGQRLHGRPLRITLSKHTSVQLPREGHEDQGLTKDYSSSPLHRFKKPGSKNYSNIFPPSATLHLSNIPPSVVEDDLKMLFSSSGAVVKAFKFFQKDHKMALIQMGSVEEAIECLIQLHNHDLGENHHLRVSFSKS 507          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Medaka
Match: ENSORLT00000036879.1 (polypyrimidine tract-binding protein 1 [Source:NCBI gene;Acc:101170752])

HSP 1 Score: 335.109 bits (858), Expect = 9.513e-108
Identity = 203/527 (38.52%), Postives = 292/527 (55.41%), Query Frame = 3
Query:  111 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLVQSANEKRKHYLINWANNTGGASEILRILIDNAPNLI--INHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGR-SMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMED-ANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            N  KK K +      PSRV+HIR +P ++ +T V  L +PFG + N++ ++  NQA ++M     A  M  Y++  +P++  + +F+QFS H++L  + +NS   +  Q+A        ++ A      S +LR++++N   L+  ++     +IFS+FG ++RI+ FTKNNQ   L+++A   S+  A++ L+G N+   C T+RI FSK    L V+  +DK RD+    L   + Q     Q     F  G  S S   G    F  A      S     LT +      + +             +  GF               I  G+SVVLV+NLNAE+  P  LF LFGVYGDVMRVK++FNKK  ALVQ ++  QA  A+ +L+   L G+ + + +SK   +QLP E   + GLTKDYS+S LHRFKKP SKNY NIFPPSA +HLSNIPP+  E DL  +   +G  VK FKF   D KMAL+++ SVE+AI  LI+ HN  L E +HLR+SFSK+
Sbjct:   61 NDSKKFKGDLRGPNVPSRVLHIRKLPIDITETEVISLGLPFGDVTNLLMLKAKNQAFLEMNSEEAAQNMVGYYSTVMPIIRQQPVFVQFSNHKEL--KTDNSPNQERAQAALRALSSSHVDTAALVVAPSSVLRVVVEN---LLYPVSLDALCQIFSKFGTVLRIIVFTKNNQFQALLQYAEGASAQAAKVSLDGQNIYNGCCTLRISFSKLTT-LNVKYNNDKSRDFTRPDLPSGDGQPTMEHQAMATAFGPGIISASPYTGATHAFPPAFALQPVSSPYAGLTMSGLPGTLASLTL--------PAGARLGF-------------PAIPAGHSVVLVSNLNAERVTPHCLFILFGVYGDVMRVKILFNKKENALVQMSDSTQAQLAMSHLNGQRLHGRPLRITLSKHTSVQLPREGHEDQGLTKDYSSSPLHRFKKPGSKNYSNIFPPSATLHLSNIPPSVVEDDLKMLFSSSGAVVKAFKFFQKDHKMALIQMGSVEEAIECLIQLHNHDLGENHHLRVSFSKS 560          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Medaka
Match: ptbp1 (polypyrimidine tract binding protein 1 [Source:NCBI gene;Acc:101165926])

HSP 1 Score: 330.102 bits (845), Expect = 3.224e-106
Identity = 203/538 (37.73%), Postives = 300/538 (55.76%), Query Frame = 3
Query:  111 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRN--NNSNIDKLVQSANEKRKHYLINWA-----NNTGGA---SEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQ-ELEGPQYSFPLFAVGRSMSMARGNDQQF---MTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMED-ANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            N  KK K +      PSRV+H+R +P ++++  V  L +PFG + N++ ++  NQA ++      A  M  Y++   P++    +++Q+S H++L   N  N       +Q+ N      + + A      + GGA   S +LR++++N     +   V ++IFS+FG +++I++FTKNNQ   L+++A  +++  A+L L+G N+   C T+RI FSK    L V+  +DK RDY    L   + Q  L+    +   F  G   +   G    F    T Q + ++ Q G+        A ASL    + M    A  +    G +           G   G++V+LV+NLN E   P  LF LFGVYGDVMRVK++FNKK  ALVQ ++  QA  ++ +L+   L G+ + + +SK   +QLP E   + GLTKDYSNS LHRFKKP SKNY NIFPPSA +HLSNIPP+  E DL  +    G  VK FKF   D+KMAL+++ SVE+AI  LIEFHN  L E +HLR+SFSK+
Sbjct:    7 NDSKKFKGDVRSPGVPSRVVHVRKLPNDINEAEVISLGLPFGKVTNLLMLKGKNQAFLEFGSEECAQTMVSYYSSVTPVIRNHPIYMQYSTHKELKTDNSPNQVRAQAALQAVNALHGSGMGSMAISAEAASMGGAASQSPVLRVIVENL-FYPVTLDVLHQIFSKFGTVLKIITFTKNNQFQALIQYADAMTAQHAKLSLDGQNIYNACCTLRISFSKLTS-LNVKYNNDKSRDYTRPDLPTADSQPSLDHQAMAAAAFGPGIISASPYGGAHAFPPTFTFQQAGLSMQ-GIP------SALASLGVGHSGMAAAAAAAAATRLGLS---------GLGATGGHNVLLVSNLNPESVTPHCLFILFGVYGDVMRVKILFNKKENALVQMSDGTQAQLSMSHLNGQRLHGRAIRVTLSKHTTVQLPREGHEDQGLTKDYSNSPLHRFKKPGSKNYSNIFPPSATLHLSNIPPSVMEDDLRRLFASTGATVKAFKFFQKDRKMALIQMGSVEEAIECLIEFHNHDLGENHHLRVSFSKS 526          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Medaka
Match: ptbp1 (polypyrimidine tract binding protein 1 [Source:NCBI gene;Acc:101165926])

HSP 1 Score: 330.487 bits (846), Expect = 1.013e-105
Identity = 203/538 (37.73%), Postives = 300/538 (55.76%), Query Frame = 3
Query:  111 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRN--NNSNIDKLVQSANEKRKHYLINWA-----NNTGGA---SEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQ-ELEGPQYSFPLFAVGRSMSMARGNDQQF---MTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMED-ANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            N  KK K +      PSRV+H+R +P ++++  V  L +PFG + N++ ++  NQA ++      A  M  Y++   P++    +++Q+S H++L   N  N       +Q+ N      + + A      + GGA   S +LR++++N     +   V ++IFS+FG +++I++FTKNNQ   L+++A  +++  A+L L+G N+   C T+RI FSK    L V+  +DK RDY    L   + Q  L+    +   F  G   +   G    F    T Q + ++ Q G+        A ASL    + M    A  +    G +           G   G++V+LV+NLN E   P  LF LFGVYGDVMRVK++FNKK  ALVQ ++  QA  ++ +L+   L G+ + + +SK   +QLP E   + GLTKDYSNS LHRFKKP SKNY NIFPPSA +HLSNIPP+  E DL  +    G  VK FKF   D+KMAL+++ SVE+AI  LIEFHN  L E +HLR+SFSK+
Sbjct:   56 NDSKKFKGDVRSPGVPSRVVHVRKLPNDINEAEVISLGLPFGKVTNLLMLKGKNQAFLEFGSEECAQTMVSYYSSVTPVIRNHPIYMQYSTHKELKTDNSPNQVRAQAALQAVNALHGSGMGSMAISAEAASMGGAASQSPVLRVIVENL-FYPVTLDVLHQIFSKFGTVLKIITFTKNNQFQALIQYADAMTAQHAKLSLDGQNIYNACCTLRISFSKLTS-LNVKYNNDKSRDYTRPDLPTADSQPSLDHQAMAAAAFGPGIISASPYGGAHAFPPTFTFQQAGLSMQ-GIP------SALASLGVGHSGMAAAAAAAAATRLGLS---------GLGATGGHNVLLVSNLNPESVTPHCLFILFGVYGDVMRVKILFNKKENALVQMSDGTQAQLSMSHLNGQRLHGRAIRVTLSKHTTVQLPREGHEDQGLTKDYSNSPLHRFKKPGSKNYSNIFPPSATLHLSNIPPSVMEDDLRRLFASTGATVKAFKFFQKDRKMALIQMGSVEEAIECLIEFHNHDLGENHHLRVSFSKS 575          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Medaka
Match: ENSORLT00000017576.2 (polypyrimidine tract-binding protein 1 [Source:NCBI gene;Acc:101170752])

HSP 1 Score: 316.62 bits (810), Expect = 7.945e-101
Identity = 198/548 (36.13%), Postives = 290/548 (52.92%), Query Frame = 3
Query:  111 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLVQSANEKRKHYLINWANNTGGASEILRILIDNAPNLI--INHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQEL--------------------EGPQYSFP-LFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALF-TLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMED-ANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            N  KK K +      PSRV+HIR +P ++ +T V  L +PFG + N++ ++  NQA ++M     A  M  Y++  +P++  + +F+QFS H++L  + +NS   +  Q+A        ++ A      S +LR++++N   L+  ++     +IFS+FG ++RI+ FTKNNQ   L+++A   S+  A++ L+G N+   C T+RI FSK    L V+  +DK RD+    L   + Q                       G  ++FP  FA+    S   G     +   L+++    G  L                            GF               I  G+SVVLV+NLNAE       F T + VYGDVMRVK++FNKK  ALVQ ++  QA  A+ +L+   L G+ + + +SK   +QLP E   + GLTKDYS+S LHRFKKP SKNY NIFPPSA +HLSNIPP+  E DL  +   +G  VK FKF   D KMAL+++ SVE+AI  LI+ HN  L E +HLR+SFSK+
Sbjct:   37 NDSKKFKGDLRGPNVPSRVLHIRKLPIDITETEVISLGLPFGDVTNLLMLKAKNQAFLEMNSEEAAQNMVGYYSTVMPIIRQQPVFVQFSNHKEL--KTDNSPNQERAQAALRALSSSHVDTAALVVAPSSVLRVVVEN---LLYPVSLDALCQIFSKFGTVLRIIVFTKNNQFQALLQYAEGASAQAAKVSLDGQNIYNGCCTLRISFSKLTT-LNVKYNNDKSRDFTRPDLPSGDGQPTMEHQAMATAFGPGIISASPYTGATHAFPPAFALQPVSSPYAGLTMSGLPGTLASLTLPAGARL----------------------------GF-------------PAIPAGHSVVLVSNLNAECGTIMKRFLTCWCVYGDVMRVKILFNKKENALVQMSDSTQAQLAMSHLNGQRLHGRPLRITLSKHTSVQLPREGHEDQGLTKDYSSSPLHRFKKPGSKNYSNIFPPSATLHLSNIPPSVVEDDLKMLFSSSGAVVKAFKFFQKDHKMALIQMGSVEEAIECLIQLHNHDLGENHHLRVSFSKS 537          
BLAST of Polypyrimidine tract-binding protein 1 vs. Planmine SMEST
Match: SMESG000018057.1 (SMESG000018057.1)

HSP 1 Score: 1142.49 bits (2954), Expect = 0.000e+0
Identity = 561/561 (100.00%), Postives = 561/561 (100.00%), Query Frame = 3
Query:    3 MASFNMAANGNAGINRKRREHEYSYQMDDFSQNSFDNSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLVQSANEKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMEDANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKAGA 1685
            MASFNMAANGNAGINRKRREHEYSYQMDDFSQNSFDNSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLVQSANEKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPAAAMAAASLMAACNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMEDANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKAGA
Sbjct:    1 MASFNMAANGNAGINRKRREHEYSYQMDDFSQNSFDNSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLVQSANEKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPAAAMAAASLMAACNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMEDANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKAGA 561          
BLAST of Polypyrimidine tract-binding protein 1 vs. Planmine SMEST
Match: SMESG000018057.1 (SMESG000018057.1)

HSP 1 Score: 1132.47 bits (2928), Expect = 0.000e+0
Identity = 556/556 (100.00%), Postives = 556/556 (100.00%), Query Frame = 3
Query:   18 MAANGNAGINRKRREHEYSYQMDDFSQNSFDNSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLVQSANEKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMEDANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKAGA 1685
            MAANGNAGINRKRREHEYSYQMDDFSQNSFDNSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLVQSANEKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPAAAMAAASLMAACNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMEDANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKAGA
Sbjct:    1 MAANGNAGINRKRREHEYSYQMDDFSQNSFDNSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLVQSANEKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGVELTPAAAMAAASLMAACNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMEDANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKAGA 556          
BLAST of Polypyrimidine tract-binding protein 1 vs. Planmine SMEST
Match: SMESG000018057.1 (SMESG000018057.1)

HSP 1 Score: 1082.4 bits (2798), Expect = 0.000e+0
Identity = 535/538 (99.44%), Postives = 535/538 (99.44%), Query Frame = 3
Query:   81 MDDFSQNSFDNSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLVQSANEKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQFM---TAQLSAMASQTGVELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMEDANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKAGA 1685
            MDDFSQNSFDNSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLVQSANEKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQFM   TAQLSAMASQTGVELTPAAAMAAASLMAACNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMEDANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKAGA
Sbjct:    1 MDDFSQNSFDNSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLVQSANEKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQFMSNITAQLSAMASQTGVELTPAAAMAAASLMAACNQMNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMEDANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKAGA 538          
BLAST of Polypyrimidine tract-binding protein 1 vs. Planmine SMEST
Match: SMESG000033951.1 (SMESG000033951.1)

HSP 1 Score: 362.459 bits (929), Expect = 2.225e-117
Identity = 207/541 (38.26%), Postives = 313/541 (57.86%), Query Frame = 3
Query:  111 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLVQSAN---EKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGV------ELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFN------PNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPM--EDANHGL-TKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            N  KK K+E   + +PS+V+HIRN+     ++ +++LAVPFG I ++V+ +K NQAL+++ + +EA  M DY+ +Y P   G+ + +Q+SKH  L+L+  NSNID  V +AN   EK +  +  W++       ILR++I+N  N  INHLV  K+F RFG+++RI+ FTKN Q   LVE  +++S+HV+ L LNG +L  DC  ++I+FSKN   LQ+QRQ+DK RDY  SPL   E       Q+S   F   ++ S++    QQ+ +     +  QT V      +  P             +               S+ + N ++       P+S     +S++LV+NLN EK N D++FTLFGVYGDV +V +       ALV    + QA TA R+L+   L+GK +  ++    ++   +   + N  +  K ++N+ LHRFKKPNSKN+ NI+PPS+V+HLSNIP +  E DL  +    G++    +    DKKMAL ++ S+EDAI  LI  HN KL++ +HLR+SFSKA
Sbjct:  107 NESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDE-------QFSL-HFLDWQAKSVSTVPPQQYPSLSTVPLL-QTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKA 638          
BLAST of Polypyrimidine tract-binding protein 1 vs. Planmine SMEST
Match: SMESG000033951.1 (SMESG000033951.1)

HSP 1 Score: 362.073 bits (928), Expect = 2.762e-117
Identity = 207/541 (38.26%), Postives = 313/541 (57.86%), Query Frame = 3
Query:  111 NSHKKVKMEQGIDEKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLVQSAN---EKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQFMTAQLSAMASQTGV------ELTPXXXXXXXXXXXXCNQMNHRTADQSNWGFGSNQSQNAMFN------PNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPM--EDANHGL-TKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 1679
            N  KK K+E   + +PS+V+HIRN+     ++ +++LAVPFG I ++V+ +K NQAL+++ + +EA  M DY+ +Y P   G+ + +Q+SKH  L+L+  NSNID  V +AN   EK +  +  W++       ILR++I+N  N  INHLV  K+F RFG+++RI+ FTKN Q   LVE  +++S+HV+ L LNG +L  DC  ++I+FSKN   LQ+QRQ+DK RDY  SPL   E       Q+S   F   ++ S++    QQ+ +     +  QT V      +  P             +               S+ + N ++       P+S     +S++LV+NLN EK N D++FTLFGVYGDV +V +       ALV    + QA TA R+L+   L+GK +  ++    ++   +   + N  +  K ++N+ LHRFKKPNSKN+ NI+PPS+V+HLSNIP +  E DL  +    G++    +    DKKMAL ++ S+EDAI  LI  HN KL++ +HLR+SFSKA
Sbjct:  109 NESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNSNIDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDE-------QFSL-HFLDWQAKSVSTVPPQQYPSLSTVPLL-QTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTELNSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHDNGFQCSSLRIFQKDKKMALAKMTSLEDAISALISLHNWKLTDSSHLRVSFSKA 640          
The following BLAST results are available for this feature:
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTBP27.066e-11238.61polypyrimidine tract binding protein 2 [Source:HGN... [more]
PTBP29.931e-11239.17polypyrimidine tract binding protein 2 [Source:HGN... [more]
PTBP34.776e-11137.62polypyrimidine tract binding protein 3 [Source:HGN... [more]
PTBP37.461e-11137.62polypyrimidine tract binding protein 3 [Source:HGN... [more]
PTBP31.402e-11037.62polypyrimidine tract binding protein 3 [Source:HGN... [more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptb-11.812e-8936.15PTB (HnRNP) homolog; Putative RNA-binding protein ... [more]
ptb-12.729e-7940.25PTB (HnRNP) homolog; Putative RNA-binding protein ... [more]
ptb-12.729e-7940.25PTB (HnRNP) homolog; Putative RNA-binding protein ... [more]
hrpl-11.678e-922.42Heterogeneous nuclear RibonucleoProtein (HnRNP) L ... [more]
hrpl-13.962e-922.27Heterogeneous nuclear RibonucleoProtein (HnRNP) L ... [more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
heph1.632e-10637.87gene:FBgn0011224 transcript:FBtr0346192[more]
heph1.656e-10437.87gene:FBgn0011224 transcript:FBtr0306692[more]
heph7.782e-10437.87gene:FBgn0011224 transcript:FBtr0306693[more]
heph2.141e-7058.85gene:FBgn0011224 transcript:FBtr0300265[more]
heph1.102e-6958.85gene:FBgn0011224 transcript:FBtr0300268[more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptbp1a2.465e-10938.22polypyrimidine tract binding protein 1a [Source:ZF... [more]
ptbp32.501e-10837.95polypyrimidine tract binding protein 3 [Source:ZFI... [more]
ptbp34.657e-10837.95polypyrimidine tract binding protein 3 [Source:ZFI... [more]
ptbp34.657e-10837.95polypyrimidine tract binding protein 3 [Source:ZFI... [more]
ptbp2b1.162e-10336.56polypyrimidine tract binding protein 2b [Source:ZF... [more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
htr41.300e-10536.895-hydroxytryptamine (serotonin) receptor 4, G prot... [more]
taco16.455e-10536.45translational activator of mitochondrially encoded... [more]
taco19.564e-10536.45translational activator of mitochondrially encoded... [more]
taco19.851e-10536.01translational activator of mitochondrially encoded... [more]
taco11.811e-10436.45translational activator of mitochondrially encoded... [more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptbp22.099e-11238.42polypyrimidine tract binding protein 2 [Source:MGI... [more]
Ptbp35.649e-11238.84polypyrimidine tract binding protein 3 [Source:MGI... [more]
Ptbp37.209e-11238.84polypyrimidine tract binding protein 3 [Source:MGI... [more]
Ptbp37.209e-11238.84polypyrimidine tract binding protein 3 [Source:MGI... [more]
Ptbp31.954e-11138.84polypyrimidine tract binding protein 3 [Source:MGI... [more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BHD7|PTBP3_MOUSE3.952e-11138.84Polypyrimidine tract-binding protein 3 OS=Mus musc... [more]
sp|Q9Z118|PTBP3_RAT9.636e-11138.84Polypyrimidine tract-binding protein 3 OS=Rattus n... [more]
sp|Q66H20|PTBP2_RAT3.040e-11038.42Polypyrimidine tract-binding protein 2 OS=Rattus n... [more]
sp|Q91Z31|PTBP2_MOUSE3.040e-11038.42Polypyrimidine tract-binding protein 2 OS=Mus musc... [more]
sp|O95758|PTBP3_HUMAN6.734e-11037.62Polypyrimidine tract-binding protein 3 OS=Homo sap... [more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183B4Q95.110e-15143.41Uncharacterized protein OS=Echinostoma caproni OX=... [more]
G4VQG03.810e-14641.62Putative polypyrimidine tract binding protein OS=S... [more]
A0A3Q0KEH44.792e-14641.62Putative polypyrimidine tract binding protein OS=S... [more]
A0A5K4ECD79.187e-14641.62Putative polypyrimidine tract binding protein OS=S... [more]
A0A5J4P4054.529e-14242.20Polypyrimidine tract-binding protein 1 (Fragment) ... [more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptbp1b3.658e-11037.57polypyrimidine tract binding protein 1 [Source:NCB... [more]
ptbp1b6.416e-11037.57polypyrimidine tract binding protein 1 [Source:NCB... [more]
ptbp2b1.076e-10538.23polypyrimidine tract-binding protein 2-like [Sourc... [more]
ptbp2a1.952e-10437.80polypyrimidine tract-binding protein 2 [Source:NCB... [more]
ptbp2b2.184e-10437.10polypyrimidine tract-binding protein 2-like [Sourc... [more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008413.16.858e-3143.85pep scaffold:Pmarinus_7.0:GL478562:177533:180128:-... [more]
ENSPMAT00000006507.13.948e-3029.02pep scaffold:Pmarinus_7.0:GL480554:3468:10153:1 ge... [more]
HNRNPLL1.996e-2825.00heterogeneous nuclear ribonucleoprotein L like [So... [more]
ENSPMAT00000006509.16.432e-2126.49pep scaffold:Pmarinus_7.0:GL480554:3489:6552:1 gen... [more]
HNRNPLL4.946e-1127.75heterogeneous nuclear ribonucleoprotein L like [So... [more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO439952.351e-6555.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO262322.046e-4050.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355372.580e-2133.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391195.513e-1625.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355363.781e-1127.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000042697.11.980e-10838.52polypyrimidine tract-binding protein 1 [Source:NCB... [more]
ENSORLT00000036879.19.513e-10838.52polypyrimidine tract-binding protein 1 [Source:NCB... [more]
ptbp13.224e-10637.73polypyrimidine tract binding protein 1 [Source:NCB... [more]
ptbp11.013e-10537.73polypyrimidine tract binding protein 1 [Source:NCB... [more]
ENSORLT00000017576.27.945e-10136.13polypyrimidine tract-binding protein 1 [Source:NCB... [more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018057.10.000e+0100.00SMESG000018057.1[more]
SMESG000018057.10.000e+0100.00SMESG000018057.1[more]
SMESG000018057.10.000e+099.44SMESG000018057.1[more]
SMESG000033951.12.225e-11738.26SMESG000033951.1[more]
SMESG000033951.12.762e-11738.26SMESG000033951.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023057 ID=SMED30023057|Name=Polypyrimidine tract-binding protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1738bp
ATATGGCTTCTTTTAACATGGCTGCTAACGGCAATGCTGGAATTAATCGT
AAAAGACGAGAGCATGAATATTCTTACCAAATGGATGATTTCTCTCAAAA
TAGTTTCGATAATTCTCATAAAAAAGTTAAAATGGAACAAGGAATCGATG
AAAAGCCATCACGTGTCATTCATATTCGCAATGTACCGCAAGAAGTTGAC
GATACTTCTGTTGCAATGCTCGCTGTACCTTTTGGATATATTGACAACAT
TGTATTCGTTCGCAAAAATAATCAAGCATTAATTCAAATGCGAGAATTAA
ATGAAGCAATTGAAATGGCAGATTATTTCAATCAATATGTTCCACTTATG
TACGGGAAACATTTGTTCATACAATTTTCAAAACATCAGCAACTTGATTT
GAGAAACAACAATTCTAATATCGACAAGCTTGTTCAGAGTGCAAATGAAA
AGCGTAAACATTACCTTATAAATTGGGCTAATAACACTGGTGGAGCTAGT
GAAATATTAAGAATTCTCATTGACAATGCTCCTAATTTGATTATAAATCA
TTTGGTTTTTTATAAGATTTTCAGTCGTTTTGGTCAAATAATTCGCATTG
TATCATTTACAAAAAATAATCAACATCACGGATTAGTTGAATTCGCTAGT
ACATTGTCTTCGCATGTAGCTCAGCTACAATTAAATGGTGCTAATTTGCT
TGGCGATTGCGGAACTATGAGAATTGATTTTTCCAAAAATCCTGGACCTC
TGCAAGTTCAGCGTCAAAGTGATAAGGTCCGTGATTACATGGAAAGCCCT
CTCAACAGAACTGAACTACAAGAGTTAGAAGGACCACAATATAGCTTTCC
CTTATTCGCGGTTGGAAGATCCATGTCCATGGCACGTGGAAATGATCAAC
AATTTATGACTGCCCAGTTGTCAGCAATGGCCAGCCAAACAGGTGTCGAA
TTAACTCCCGCGGCTGCAATGGCAGCAGCAAGTTTAATGGCTGCCTGTAA
TCAAATGAATCATCGTACAGCAGATCAATCTAACTGGGGATTTGGATCCA
ATCAATCTCAAAATGCTATGTTTAATCCTAATAGTGGAATTGAAAATGGA
AATTCTGTAGTTCTAGTTACAAATTTAAATGCCGAGAAATCAAATCCAGA
TGCACTTTTTACACTTTTTGGCGTTTATGGCGACGTGATGCGAGTGAAAG
TTATGTTTAACAAAAAGAATACCGCTTTGGTTCAATTTGCCAACCATCAG
CAAGCAATGACGGCAATTCGAAATCTTGATGCCTGTTTTCTCTGGGGCAA
GCAAATGCATTTACATGTGTCCAAAACTAATGTTATCCAATTACCTATGG
AAGATGCTAATCACGGATTGACTAAGGATTATTCTAATTCAACTTTGCAT
AGATTTAAAAAACCGAATTCCAAAAATTATCAAAATATATTCCCTCCCAG
TGCAGTTGTGCATTTGAGTAACATTCCTCCGACCACAAGTGAAGGAGATT
TATCTGATATGATTCGAATTGCTGGCTATGAGGTTAAAAAATTCAAATTC
CTACCGAATGATAAAAAGATGGCTCTTCTTGAATTAAACTCCGTGGAAGA
TGCAATTCATGTTTTAATTGAATTTCACAATCGAAAATTATCTGAAAAAA
ATCATCTTCGAATTAGTTTTAGCAAAGCTGGAGCATTTTAATTATTGTTG
TTTATAATAAAGTATTTAAAATTGCTTTATATTTATAC
back to top

protein sequence of SMED30023057-orf-1

>SMED30023057-orf-1 ID=SMED30023057-orf-1|Name=SMED30023057-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=563bp
MASFNMAANGNAGINRKRREHEYSYQMDDFSQNSFDNSHKKVKMEQGIDE
KPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELN
EAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLVQSANEK
RKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIV
SFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPL
QVQRQSDKVRDYMESPLNRTELQELEGPQYSFPLFAVGRSMSMARGNDQQ
FMTAQLSAMASQTGVELTPAAAMAAASLMAACNQMNHRTADQSNWGFGSN
QSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKV
MFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPME
DANHGLTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDL
SDMIRIAGYEVKKFKFLPNDKKMALLELNSVEDAIHVLIEFHNRKLSEKN
HLRISFSKAGAF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR006536HnRNP-L/PTB
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006397mRNA processing
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 485..555
e-value: 0.012
score: 23.8
coord: 369..438
e-value: 5.5E-10
score: 49.2
coord: 55..124
e-value: 0.057
score: 17.7
coord: 170..242
e-value: 0.24
score: 12.0
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 187..234
e-value: 4.0E-5
score: 23.3
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 368..442
score: 12.953
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 169..246
score: 9.081
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 165..271
e-value: 3.4E-19
score: 70.8
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 473..559
e-value: 7.4E-15
score: 56.7
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 365..461
e-value: 3.9E-24
score: 86.7
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 36..154
e-value: 7.7E-21
score: 76.2
IPR006536HnRNP-L/PTBTIGRFAMTIGR01649TIGR01649coord: 52..559
e-value: 4.6E-125
score: 416.3
NoneNo IPR availablePFAMPF13893RRM_5coord: 68..132
e-value: 0.0028
score: 17.2
coord: 362..463
e-value: 8.1E-28
score: 96.5
coord: 510..560
e-value: 0.39
score: 10.3
NoneNo IPR availablePANTHERPTHR15592:SF27HEPHAESTUS, ISOFORM Ycoord: 30..559
NoneNo IPR availablePANTHERPTHR15592MATRIN 3/NUCLEAR PROTEIN 220-RELATEDcoord: 30..559
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 47..139
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 360..449
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 471..558
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 167..267