KH domain-containing protein

Overview
NameKH domain-containing protein
Smed IDSMED30023052
Length (bp)1145
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of KH domain-containing protein (SMED30023052) t-SNE clustered cells

Violin plots show distribution of expression levels for KH domain-containing protein (SMED30023052) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of KH domain-containing protein (SMED30023052) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for KH domain-containing protein (SMED30023052) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023052

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30023052h1SMcG0003445 dd_Smed_v4_10900_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023052h1SMcG0003445 dd_Smed_v4_10900_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of KH domain-containing protein vs. Ensembl Human
Match: QKI (QKI, KH domain containing RNA binding [Source:HGNC Symbol;Acc:HGNC:21100])

HSP 1 Score: 192.2 bits (487), Expect = 1.001e-57
Identity = 102/212 (48.11%), Postives = 139/212 (65.57%), Query Frame = 3
Query:   33 MNNELSSEKKIIYTSDYLQELFKDKKSIQ----LSGINFKHATNLLDKEIALVKENLF------KFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            M  E+ +++K   T DYL +L  DKK +       GI F H   LLD+EI+ V+++++        EK +  + ++    G IV  QEK+++PVKE P++NFVGRILGPRG TAKQLE +  CKIM+RG+GSMRD+ KEEQNR KPNWEHLNEDLHVLI + D +NR + K+    E +   +   +   E  D+LK+MQLMEL+ILN + R
Sbjct:    1 MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGI-FNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAV---GPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYR 205          
BLAST of KH domain-containing protein vs. Ensembl Human
Match: QKI (QKI, KH domain containing RNA binding [Source:HGNC Symbol;Acc:HGNC:21100])

HSP 1 Score: 192.2 bits (487), Expect = 1.001e-57
Identity = 102/212 (48.11%), Postives = 139/212 (65.57%), Query Frame = 3
Query:   33 MNNELSSEKKIIYTSDYLQELFKDKKSIQ----LSGINFKHATNLLDKEIALVKENLF------KFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            M  E+ +++K   T DYL +L  DKK +       GI F H   LLD+EI+ V+++++        EK +  + ++    G IV  QEK+++PVKE P++NFVGRILGPRG TAKQLE +  CKIM+RG+GSMRD+ KEEQNR KPNWEHLNEDLHVLI + D +NR + K+    E +   +   +   E  D+LK+MQLMEL+ILN + R
Sbjct:    1 MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGI-FNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAV---GPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYR 205          
BLAST of KH domain-containing protein vs. Ensembl Human
Match: QKI (QKI, KH domain containing RNA binding [Source:HGNC Symbol;Acc:HGNC:21100])

HSP 1 Score: 191.815 bits (486), Expect = 1.791e-57
Identity = 102/212 (48.11%), Postives = 139/212 (65.57%), Query Frame = 3
Query:   33 MNNELSSEKKIIYTSDYLQELFKDKKSIQ----LSGINFKHATNLLDKEIALVKENLF------KFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            M  E+ +++K   T DYL +L  DKK +       GI F H   LLD+EI+ V+++++        EK +  + ++    G IV  QEK+++PVKE P++NFVGRILGPRG TAKQLE +  CKIM+RG+GSMRD+ KEEQNR KPNWEHLNEDLHVLI + D +NR + K+    E +   +   +   E  D+LK+MQLMEL+ILN + R
Sbjct:    1 MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGI-FNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAV---GPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYR 205          
BLAST of KH domain-containing protein vs. Ensembl Human
Match: QKI (QKI, KH domain containing RNA binding [Source:HGNC Symbol;Acc:HGNC:21100])

HSP 1 Score: 191.43 bits (485), Expect = 1.982e-57
Identity = 102/212 (48.11%), Postives = 139/212 (65.57%), Query Frame = 3
Query:   33 MNNELSSEKKIIYTSDYLQELFKDKKSIQ----LSGINFKHATNLLDKEIALVKENLF------KFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            M  E+ +++K   T DYL +L  DKK +       GI F H   LLD+EI+ V+++++        EK +  + ++    G IV  QEK+++PVKE P++NFVGRILGPRG TAKQLE +  CKIM+RG+GSMRD+ KEEQNR KPNWEHLNEDLHVLI + D +NR + K+    E +   +   +   E  D+LK+MQLMEL+ILN + R
Sbjct:    1 MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGI-FNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAV---GPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYR 205          
BLAST of KH domain-containing protein vs. Ensembl Human
Match: QKI (QKI, KH domain containing RNA binding [Source:HGNC Symbol;Acc:HGNC:21100])

HSP 1 Score: 191.43 bits (485), Expect = 2.109e-57
Identity = 102/212 (48.11%), Postives = 139/212 (65.57%), Query Frame = 3
Query:   33 MNNELSSEKKIIYTSDYLQELFKDKKSIQ----LSGINFKHATNLLDKEIALVKENLF------KFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            M  E+ +++K   T DYL +L  DKK +       GI F H   LLD+EI+ V+++++        EK +  + ++    G IV  QEK+++PVKE P++NFVGRILGPRG TAKQLE +  CKIM+RG+GSMRD+ KEEQNR KPNWEHLNEDLHVLI + D +NR + K+    E +   +   +   E  D+LK+MQLMEL+ILN + R
Sbjct:    1 MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGI-FNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAV---GPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYR 205          
BLAST of KH domain-containing protein vs. Ensembl Celegans
Match: asd-2 (RNA-binding protein asd-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EFF1])

HSP 1 Score: 191.43 bits (485), Expect = 9.086e-58
Identity = 99/202 (49.01%), Postives = 132/202 (65.35%), Query Frame = 3
Query:   39 NELSSEKKIIYTSDYLQELFKDKKSIQLSGINFKHATNLLDKEIALVKENLFK--FEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            N +S+ ++  Y+++YL +L KDKK +      F H   L D+EI  V+  LF+  F K + P+ ++   EG      EK+F+P KE+P+YNFVGRILGPRG TAKQLEQ+  CKIM+RGRGSMRD+ KEE NR KPNWEHL+E+LHVLI   D ENR   K+    E +   +   +  PE  D LK+ QLMEL+I+N + R
Sbjct:   16 NGVSTSQQQQYSAEYLSQLLKDKKQLAAFPNVFHHLERLADEEINKVRVVLFQCEFSKESAPLPDA---EGDSTVHTEKVFVPAKEHPDYNFVGRILGPRGMTAKQLEQETGCKIMVRGRGSMRDKKKEELNRGKPNWEHLSEELHVLIQCEDTENRAKVKLMRAVEEVRKLL---VPAPEGEDDLKRKQLMELAIINGTYR 211          
BLAST of KH domain-containing protein vs. Ensembl Celegans
Match: asd-2 (RNA-binding protein asd-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EFF1])

HSP 1 Score: 191.815 bits (486), Expect = 5.099e-57
Identity = 99/202 (49.01%), Postives = 132/202 (65.35%), Query Frame = 3
Query:   39 NELSSEKKIIYTSDYLQELFKDKKSIQLSGINFKHATNLLDKEIALVKENLFK--FEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            N +S+ ++  Y+++YL +L KDKK +      F H   L D+EI  V+  LF+  F K + P+ ++   EG      EK+F+P KE+P+YNFVGRILGPRG TAKQLEQ+  CKIM+RGRGSMRD+ KEE NR KPNWEHL+E+LHVLI   D ENR   K+    E +   +   +  PE  D LK+ QLMEL+I+N + R
Sbjct:   16 NGVSTSQQQQYSAEYLSQLLKDKKQLAAFPNVFHHLERLADEEINKVRVVLFQCEFSKESAPLPDA---EGDSTVHTEKVFVPAKEHPDYNFVGRILGPRGMTAKQLEQETGCKIMVRGRGSMRDKKKEELNRGKPNWEHLSEELHVLIQCEDTENRAKVKLMRAVEEVRKLL---VPAPEGEDDLKRKQLMELAIINGTYR 211          
BLAST of KH domain-containing protein vs. Ensembl Celegans
Match: asd-2 (RNA-binding protein asd-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EFF1])

HSP 1 Score: 191.815 bits (486), Expect = 1.365e-56
Identity = 99/202 (49.01%), Postives = 132/202 (65.35%), Query Frame = 3
Query:   39 NELSSEKKIIYTSDYLQELFKDKKSIQLSGINFKHATNLLDKEIALVKENLFK--FEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            N +S+ ++  Y+++YL +L KDKK +      F H   L D+EI  V+  LF+  F K + P+ ++   EG      EK+F+P KE+P+YNFVGRILGPRG TAKQLEQ+  CKIM+RGRGSMRD+ KEE NR KPNWEHL+E+LHVLI   D ENR   K+    E +   +   +  PE  D LK+ QLMEL+I+N + R
Sbjct:   58 NGVSTSQQQQYSAEYLSQLLKDKKQLAAFPNVFHHLERLADEEINKVRVVLFQCEFSKESAPLPDA---EGDSTVHTEKVFVPAKEHPDYNFVGRILGPRGMTAKQLEQETGCKIMVRGRGSMRDKKKEELNRGKPNWEHLSEELHVLIQCEDTENRAKVKLMRAVEEVRKLL---VPAPEGEDDLKRKQLMELAIINGTYR 253          
BLAST of KH domain-containing protein vs. Ensembl Celegans
Match: asd-2 (RNA-binding protein asd-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EFF1])

HSP 1 Score: 192.586 bits (488), Expect = 1.663e-56
Identity = 99/202 (49.01%), Postives = 132/202 (65.35%), Query Frame = 3
Query:   39 NELSSEKKIIYTSDYLQELFKDKKSIQLSGINFKHATNLLDKEIALVKENLFK--FEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            N +S+ ++  Y+++YL +L KDKK +      F H   L D+EI  V+  LF+  F K + P+ ++   EG      EK+F+P KE+P+YNFVGRILGPRG TAKQLEQ+  CKIM+RGRGSMRD+ KEE NR KPNWEHL+E+LHVLI   D ENR   K+    E +   +   +  PE  D LK+ QLMEL+I+N + R
Sbjct:   88 NGVSTSQQQQYSAEYLSQLLKDKKQLAAFPNVFHHLERLADEEINKVRVVLFQCEFSKESAPLPDA---EGDSTVHTEKVFVPAKEHPDYNFVGRILGPRGMTAKQLEQETGCKIMVRGRGSMRDKKKEELNRGKPNWEHLSEELHVLIQCEDTENRAKVKLMRAVEEVRKLL---VPAPEGEDDLKRKQLMELAIINGTYR 283          
BLAST of KH domain-containing protein vs. Ensembl Celegans
Match: gld-1 (Female germline-specific tumor suppressor gld-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17339])

HSP 1 Score: 176.022 bits (445), Expect = 1.630e-50
Identity = 90/189 (47.62%), Postives = 120/189 (63.49%), Query Frame = 3
Query:   72 TSDYLQELFKDKKSIQLSGINFKHATNLLDKEIALVKENLFKFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            T +YL +L K+KK + L    F +   LLD EI  V+  LF+ E   + +   +   G ++S  EKI++P  E P+YNFVGRILGPRG TAKQLEQ   CKIM+RG+GSMRD++KE  +R K NWEHL +DLHVL+   D ENRV  K+    E +   +   +  PE  D LK+ QLMEL+I+N + R
Sbjct:  146 TVEYLADLVKEKKHLTLFPHMFSNVERLLDDEIGRVRVALFQTEFPRVELPEPA---GDMISITEKIYVPKNEYPDYNFVGRILGPRGMTAKQLEQDTGCKIMVRGKGSMRDKSKESAHRGKANWEHLEDDLHVLVQCEDTENRVHIKLQAALEQVKKLL---IPAPEGTDELKRKQLMELAIINGTYR 328          
BLAST of KH domain-containing protein vs. Ensembl Fly
Match: how (gene:FBgn0264491 transcript:FBtr0084178)

HSP 1 Score: 186.808 bits (473), Expect = 2.111e-55
Identity = 95/193 (49.22%), Postives = 130/193 (67.36%), Query Frame = 3
Query:   75 SDYLQELFKDKKSIQLSGINFKHATNLLDKEIALVKENLF-----KFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            +DYL +L KD+K +      F H   LLD+EIA V+ +LF     K E  T+P       EG +V+  EK+++PV+E+P++NFVGRILGPRG TAKQLEQ+  CKIM+RG+GSMRD+ KE+ NR KPNWEHL++DLHVLI + D ENR   K+    +A++   +  +   E  D LK+ QLMEL+I+N + R
Sbjct:   76 ADYLAQLLKDRKQLAAFPNVFTHVERLLDEEIARVRASLFQINGVKKEPLTLPEP-----EGSVVTMNEKVYVPVREHPDFNFVGRILGPRGMTAKQLEQETGCKIMVRGKGSMRDKKKEDANRGKPNWEHLSDDLHVLITVEDTENRATVKL---AQAVAEVQKLLVPQAEGEDELKKRQLMELAIINGTYR 260          
BLAST of KH domain-containing protein vs. Ensembl Fly
Match: how (gene:FBgn0264491 transcript:FBtr0100514)

HSP 1 Score: 187.193 bits (474), Expect = 2.292e-55
Identity = 95/193 (49.22%), Postives = 130/193 (67.36%), Query Frame = 3
Query:   75 SDYLQELFKDKKSIQLSGINFKHATNLLDKEIALVKENLF-----KFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            +DYL +L KD+K +      F H   LLD+EIA V+ +LF     K E  T+P       EG +V+  EK+++PV+E+P++NFVGRILGPRG TAKQLEQ+  CKIM+RG+GSMRD+ KE+ NR KPNWEHL++DLHVLI + D ENR   K+    +A++   +  +   E  D LK+ QLMEL+I+N + R
Sbjct:   76 ADYLAQLLKDRKQLAAFPNVFTHVERLLDEEIARVRASLFQINGVKKEPLTLPEP-----EGSVVTMNEKVYVPVREHPDFNFVGRILGPRGMTAKQLEQETGCKIMVRGKGSMRDKKKEDANRGKPNWEHLSDDLHVLITVEDTENRATVKL---AQAVAEVQKLLVPQAEGEDELKKRQLMELAIINGTYR 260          
BLAST of KH domain-containing protein vs. Ensembl Fly
Match: how (gene:FBgn0264491 transcript:FBtr0084177)

HSP 1 Score: 187.193 bits (474), Expect = 3.708e-55
Identity = 95/193 (49.22%), Postives = 130/193 (67.36%), Query Frame = 3
Query:   75 SDYLQELFKDKKSIQLSGINFKHATNLLDKEIALVKENLF-----KFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            +DYL +L KD+K +      F H   LLD+EIA V+ +LF     K E  T+P       EG +V+  EK+++PV+E+P++NFVGRILGPRG TAKQLEQ+  CKIM+RG+GSMRD+ KE+ NR KPNWEHL++DLHVLI + D ENR   K+    +A++   +  +   E  D LK+ QLMEL+I+N + R
Sbjct:   76 ADYLAQLLKDRKQLAAFPNVFTHVERLLDEEIARVRASLFQINGVKKEPLTLPEP-----EGSVVTMNEKVYVPVREHPDFNFVGRILGPRGMTAKQLEQETGCKIMVRGKGSMRDKKKEDANRGKPNWEHLSDDLHVLITVEDTENRATVKL---AQAVAEVQKLLVPQAEGEDELKKRQLMELAIINGTYR 260          
BLAST of KH domain-containing protein vs. Ensembl Fly
Match: how (gene:FBgn0264491 transcript:FBtr0301401)

HSP 1 Score: 187.193 bits (474), Expect = 3.708e-55
Identity = 95/193 (49.22%), Postives = 130/193 (67.36%), Query Frame = 3
Query:   75 SDYLQELFKDKKSIQLSGINFKHATNLLDKEIALVKENLF-----KFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            +DYL +L KD+K +      F H   LLD+EIA V+ +LF     K E  T+P       EG +V+  EK+++PV+E+P++NFVGRILGPRG TAKQLEQ+  CKIM+RG+GSMRD+ KE+ NR KPNWEHL++DLHVLI + D ENR   K+    +A++   +  +   E  D LK+ QLMEL+I+N + R
Sbjct:   76 ADYLAQLLKDRKQLAAFPNVFTHVERLLDEEIARVRASLFQINGVKKEPLTLPEP-----EGSVVTMNEKVYVPVREHPDFNFVGRILGPRGMTAKQLEQETGCKIMVRGKGSMRDKKKEDANRGKPNWEHLSDDLHVLITVEDTENRATVKL---AQAVAEVQKLLVPQAEGEDELKKRQLMELAIINGTYR 260          
BLAST of KH domain-containing protein vs. Ensembl Fly
Match: how (gene:FBgn0264491 transcript:FBtr0301402)

HSP 1 Score: 187.193 bits (474), Expect = 3.899e-55
Identity = 95/193 (49.22%), Postives = 130/193 (67.36%), Query Frame = 3
Query:   75 SDYLQELFKDKKSIQLSGINFKHATNLLDKEIALVKENLF-----KFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            +DYL +L KD+K +      F H   LLD+EIA V+ +LF     K E  T+P       EG +V+  EK+++PV+E+P++NFVGRILGPRG TAKQLEQ+  CKIM+RG+GSMRD+ KE+ NR KPNWEHL++DLHVLI + D ENR   K+    +A++   +  +   E  D LK+ QLMEL+I+N + R
Sbjct:   76 ADYLAQLLKDRKQLAAFPNVFTHVERLLDEEIARVRASLFQINGVKKEPLTLPEP-----EGSVVTMNEKVYVPVREHPDFNFVGRILGPRGMTAKQLEQETGCKIMVRGKGSMRDKKKEDANRGKPNWEHLSDDLHVLITVEDTENRATVKL---AQAVAEVQKLLVPQAEGEDELKKRQLMELAIINGTYR 260          
BLAST of KH domain-containing protein vs. Ensembl Zebrafish
Match: qki2 (QKI, KH domain containing, RNA binding 2 [Source:NCBI gene;Acc:393815])

HSP 1 Score: 189.504 bits (480), Expect = 7.203e-57
Identity = 101/212 (47.64%), Postives = 137/212 (64.62%), Query Frame = 3
Query:   33 MNNELSSEKKIIYTSDYLQELFKDKKSIQ----LSGINFKHATNLLDKEIALVKENLF------KFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            M  E+ +++K   T DYL +L  DKK +       GI F H   LLD+EI  V+++++        +K T  + ++    G I   QEK+++PVKE P++NFVGRILGPRG TAKQLE +  CKIM+RG+GSMRD+ KEEQNR KPNWEHLNEDLHVLI + D +NR + K+    E +   +   +   E  D+LK+MQLMEL+ILN + R
Sbjct:    1 MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGI-FNHLERLLDEEIGRVRKDMYNDTLNGSTDKRTSELPDAV---GPIAQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDSQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYR 205          
BLAST of KH domain-containing protein vs. Ensembl Zebrafish
Match: qki2 (QKI, KH domain containing, RNA binding 2 [Source:NCBI gene;Acc:393815])

HSP 1 Score: 189.119 bits (479), Expect = 8.613e-57
Identity = 101/212 (47.64%), Postives = 137/212 (64.62%), Query Frame = 3
Query:   33 MNNELSSEKKIIYTSDYLQELFKDKKSIQ----LSGINFKHATNLLDKEIALVKENLF------KFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            M  E+ +++K   T DYL +L  DKK +       GI F H   LLD+EI  V+++++        +K T  + ++    G I   QEK+++PVKE P++NFVGRILGPRG TAKQLE +  CKIM+RG+GSMRD+ KEEQNR KPNWEHLNEDLHVLI + D +NR + K+    E +   +   +   E  D+LK+MQLMEL+ILN + R
Sbjct:    1 MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGI-FNHLERLLDEEIGRVRKDMYNDTLNGSTDKRTSELPDAV---GPIAQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDSQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYR 205          
BLAST of KH domain-containing protein vs. Ensembl Zebrafish
Match: qkib (QKI, KH domain containing, RNA binding b [Source:ZFIN;Acc:ZDB-GENE-081028-54])

HSP 1 Score: 189.504 bits (480), Expect = 1.700e-56
Identity = 103/213 (48.36%), Postives = 143/213 (67.14%), Query Frame = 3
Query:   33 MNNELSSEKKIIYTSDYLQELFKDKKSIQ----LSGINFKHATNLLDKEIALVKENLF------KFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKM-NTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            M  E+ +++K   T DYL +L  DKK +       GI F H   LLD+EI+ V+++++        EK +  + ++    G IV  QEK+++PVKE P++NFVGRILGPRG TAKQLE +  CKIM+RG+GSMRD+ KEEQNR KPNWEHLNEDLHVLI + D +NR + K+   ++E +  F++   +  E  D+LK+MQLMEL+ILN + R
Sbjct:    1 MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGI-FNHLERLLDEEISRVRKDMYNDTLNGSTEKRSSELPDAV---GPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVLVIFLR---DFAEGEDSLKKMQLMELAILNGTYR 206          
BLAST of KH domain-containing protein vs. Ensembl Zebrafish
Match: qkib (QKI, KH domain containing, RNA binding b [Source:ZFIN;Acc:ZDB-GENE-081028-54])

HSP 1 Score: 186.422 bits (472), Expect = 1.285e-55
Identity = 103/213 (48.36%), Postives = 139/213 (65.26%), Query Frame = 3
Query:   33 MNNELSSEKKIIYTSDYLQELFKDKKSIQ----LSGINFKHATNLLDKEIALVKENLF------KFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKM-NTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            M  E+ +++K   T DYL +L  DKK +       GI F H   LLD+EI+ V+++++        EK +  + ++    G IV  QEK+++PVKE P++NFVGRILGPRG TAKQLE +  CKIM+RG+GSMRD+ KEEQNR KPNWEHLNEDLHVLI + D +NR + K+   ++EA            E  D+LK+MQLMEL+ILN + R
Sbjct:    1 MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGI-FNHLERLLDEEISRVRKDMYNDTLNGSTEKRSSELPDAV---GPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEA------------EGEDSLKKMQLMELAILNGTYR 197          
BLAST of KH domain-containing protein vs. Ensembl Zebrafish
Match: qkib (QKI, KH domain containing, RNA binding b [Source:ZFIN;Acc:ZDB-GENE-081028-54])

HSP 1 Score: 186.422 bits (472), Expect = 1.558e-55
Identity = 103/213 (48.36%), Postives = 139/213 (65.26%), Query Frame = 3
Query:   33 MNNELSSEKKIIYTSDYLQELFKDKKSIQ----LSGINFKHATNLLDKEIALVKENLF------KFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKM-NTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            M  E+ +++K   T DYL +L  DKK +       GI F H   LLD+EI+ V+++++        EK +  + ++    G IV  QEK+++PVKE P++NFVGRILGPRG TAKQLE +  CKIM+RG+GSMRD+ KEEQNR KPNWEHLNEDLHVLI + D +NR + K+   ++EA            E  D+LK+MQLMEL+ILN + R
Sbjct:    1 MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGI-FNHLERLLDEEISRVRKDMYNDTLNGSTEKRSSELPDAV---GPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEA------------EGEDSLKKMQLMELAILNGTYR 197          
BLAST of KH domain-containing protein vs. Ensembl Xenopus
Match: spsb3 (splA/ryanodine receptor domain and SOCS box containing 3 [Source:Xenbase;Acc:XB-GENE-971062])

HSP 1 Score: 190.274 bits (482), Expect = 5.815e-57
Identity = 103/213 (48.36%), Postives = 138/213 (64.79%), Query Frame = 3
Query:   33 MNNELSSEKKIIYTSDYLQELFKDKKSIQ----LSGINFKHATNLLDKEIALVKENLFKF-------EKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            M  E+ +++K   T DYL +L  DKK +       GI F H   LLD+EI+ V+++++         EK T  + +     G IV  QEK+++PVKE P++NFVGRILGPRG TAKQLE +  CKIM+RG+GSMRD+ KEEQNR KPNWEHLNEDLHVLI + D +NR + K+    E +   +   +   E  D+LK+MQLMEL+ILN + R
Sbjct:    1 MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGI-FTHLERLLDEEISRVRKDMYNDTLNGSNNEKRTSELPDGI---GPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYR 206          
BLAST of KH domain-containing protein vs. Ensembl Xenopus
Match: spsb3 (splA/ryanodine receptor domain and SOCS box containing 3 [Source:Xenbase;Acc:XB-GENE-971062])

HSP 1 Score: 182.185 bits (461), Expect = 3.677e-53
Identity = 104/228 (45.61%), Postives = 139/228 (60.96%), Query Frame = 3
Query:   33 MNNELSSEKKIIYTSDYLQELFKDKKSIQ----LSGINFKHATNLLDKEIALVKENLFKF-------EKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQ---------------NKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            M  E+ +++K   T DYL +L  DKK +       GI F H   LLD+EI+ V+++++         EK T  + +     G IV  QEK+++PVKE P++NFVGRILGPRG TAKQLE +  CKIM+RG+GSMRD+               NKEEQNR KPNWEHLNEDLHVLI + D +NR + K+    E +   +   +   E  D+LK+MQLMEL+ILN + R
Sbjct:   25 MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGI-FTHLERLLDEEISRVRKDMYNDTLNGSNNEKRTSELPDGI---GPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKAVTNILECSILALNKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYR 245          
BLAST of KH domain-containing protein vs. Ensembl Xenopus
Match: spsb3 (splA/ryanodine receptor domain and SOCS box containing 3 [Source:Xenbase;Acc:XB-GENE-971062])

HSP 1 Score: 181.8 bits (460), Expect = 4.581e-53
Identity = 104/228 (45.61%), Postives = 139/228 (60.96%), Query Frame = 3
Query:   33 MNNELSSEKKIIYTSDYLQELFKDKKSIQ----LSGINFKHATNLLDKEIALVKENLFKF-------EKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQ---------------NKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            M  E+ +++K   T DYL +L  DKK +       GI F H   LLD+EI+ V+++++         EK T  + +     G IV  QEK+++PVKE P++NFVGRILGPRG TAKQLE +  CKIM+RG+GSMRD+               NKEEQNR KPNWEHLNEDLHVLI + D +NR + K+    E +   +   +   E  D+LK+MQLMEL+ILN + R
Sbjct:   25 MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGI-FTHLERLLDEEISRVRKDMYNDTLNGSNNEKRTSELPDGI---GPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKAVTNILECSILALNKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYR 245          
BLAST of KH domain-containing protein vs. Ensembl Xenopus
Match: spsb3 (splA/ryanodine receptor domain and SOCS box containing 3 [Source:Xenbase;Acc:XB-GENE-971062])

HSP 1 Score: 170.244 bits (430), Expect = 1.994e-49
Identity = 89/184 (48.37%), Postives = 119/184 (64.67%), Query Frame = 3
Query:   33 MNNELSSEKKIIYTSDYLQELFKDKKSIQ----LSGINFKHATNLLDKEIALVKENLFKF-------EKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFI 551
            M  E+ +++K   T DYL +L  DKK +       GI F H   LLD+EI+ V+++++         EK T  + +     G IV  QEK+++PVKE P++NFVGRILGPRG TAKQLE +  CKIM+RG+GSMRD+ KEEQNR KPNWEHLNEDLHVLI + D +NR + K+    E +   +
Sbjct:    1 MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGI-FTHLERLLDEEISRVRKDMYNDTLNGSNNEKRTSELPDGI---GPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLL 180          
BLAST of KH domain-containing protein vs. Ensembl Xenopus
Match: pdc (phosducin [Source:Xenbase;Acc:XB-GENE-983832])

HSP 1 Score: 110.923 bits (276), Expect = 8.540e-27
Identity = 73/192 (38.02%), Postives = 110/192 (57.29%), Query Frame = 3
Query:   75 SDYLQELFKDKKSIQLSGINFKHATNLLDKEIALVKE--NLFKFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNR--NKPNWEHLNEDLHVLINI----SDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILN 626
            + YL EL  +K S+  S   F HA +LL KEI  +K+  +  K E+ T  +D  S +  ++   +E+I +PVK  P +NFVG+ILGP+G T K+L+++   KI + G+GSMRD+ KEE+ R    P + HLN DLHV I +     +   R+   M  +K+ +     E  +  + +D + Q Q MELS LN
Sbjct:    5 TKYLPELMAEKDSLDPS---FTHAMSLLGKEIERLKKGGDAKKDEEDTY-LDLFSHKNMKL---KERILIPVKLYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYSHLNMDLHVFIEVFGPPCESYTRMAHAMEEVKKFLVPLTPESFSYQDMMDDICQEQFMELSYLN 189          
BLAST of KH domain-containing protein vs. Ensembl Mouse
Match: Qk (quaking [Source:MGI Symbol;Acc:MGI:97837])

HSP 1 Score: 192.2 bits (487), Expect = 6.871e-58
Identity = 102/212 (48.11%), Postives = 139/212 (65.57%), Query Frame = 3
Query:   33 MNNELSSEKKIIYTSDYLQELFKDKKSIQ----LSGINFKHATNLLDKEIALVKENLF------KFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            M  E+ +++K   T DYL +L  DKK +       GI F H   LLD+EI+ V+++++        EK +  + ++    G IV  QEK+++PVKE P++NFVGRILGPRG TAKQLE +  CKIM+RG+GSMRD+ KEEQNR KPNWEHLNEDLHVLI + D +NR + K+    E +   +   +   E  D+LK+MQLMEL+ILN + R
Sbjct:    1 MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGI-FNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAV---GPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYR 205          
BLAST of KH domain-containing protein vs. Ensembl Mouse
Match: Qk (quaking [Source:MGI Symbol;Acc:MGI:97837])

HSP 1 Score: 192.2 bits (487), Expect = 6.871e-58
Identity = 102/212 (48.11%), Postives = 139/212 (65.57%), Query Frame = 3
Query:   33 MNNELSSEKKIIYTSDYLQELFKDKKSIQ----LSGINFKHATNLLDKEIALVKENLF------KFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            M  E+ +++K   T DYL +L  DKK +       GI F H   LLD+EI+ V+++++        EK +  + ++    G IV  QEK+++PVKE P++NFVGRILGPRG TAKQLE +  CKIM+RG+GSMRD+ KEEQNR KPNWEHLNEDLHVLI + D +NR + K+    E +   +   +   E  D+LK+MQLMEL+ILN + R
Sbjct:    1 MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGI-FNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAV---GPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYR 205          
BLAST of KH domain-containing protein vs. Ensembl Mouse
Match: Qk (quaking [Source:MGI Symbol;Acc:MGI:97837])

HSP 1 Score: 191.815 bits (486), Expect = 1.230e-57
Identity = 102/212 (48.11%), Postives = 139/212 (65.57%), Query Frame = 3
Query:   33 MNNELSSEKKIIYTSDYLQELFKDKKSIQ----LSGINFKHATNLLDKEIALVKENLF------KFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            M  E+ +++K   T DYL +L  DKK +       GI F H   LLD+EI+ V+++++        EK +  + ++    G IV  QEK+++PVKE P++NFVGRILGPRG TAKQLE +  CKIM+RG+GSMRD+ KEEQNR KPNWEHLNEDLHVLI + D +NR + K+    E +   +   +   E  D+LK+MQLMEL+ILN + R
Sbjct:    1 MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGI-FNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAV---GPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYR 205          
BLAST of KH domain-containing protein vs. Ensembl Mouse
Match: Qk (quaking [Source:MGI Symbol;Acc:MGI:97837])

HSP 1 Score: 191.815 bits (486), Expect = 1.670e-57
Identity = 102/212 (48.11%), Postives = 139/212 (65.57%), Query Frame = 3
Query:   33 MNNELSSEKKIIYTSDYLQELFKDKKSIQ----LSGINFKHATNLLDKEIALVKENLF------KFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            M  E+ +++K   T DYL +L  DKK +       GI F H   LLD+EI+ V+++++        EK +  + ++    G IV  QEK+++PVKE P++NFVGRILGPRG TAKQLE +  CKIM+RG+GSMRD+ KEEQNR KPNWEHLNEDLHVLI + D +NR + K+    E +   +   +   E  D+LK+MQLMEL+ILN + R
Sbjct:    1 MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGI-FNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAV---GPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYR 205          
BLAST of KH domain-containing protein vs. Ensembl Mouse
Match: Khdrbs1 (KH domain containing, RNA binding, signal transduction associated 1 [Source:MGI Symbol;Acc:MGI:893579])

HSP 1 Score: 106.686 bits (265), Expect = 5.107e-25
Identity = 67/184 (36.41%), Postives = 101/184 (54.89%), Query Frame = 3
Query:   81 YLQELFKDKKSIQLSGINFKHATNLLDKEIALVKENLFKFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNR--NKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILN 626
            YL EL  +K S+  S   F HA  LL  EI  +++   K +     +D  S +  ++   +E++ +PVK+ P +NFVG+ILGP+G T K+L+++   KI + G+GSMRD+ KEE+ R    P + HLN DLHV I +          M    E +  F+      P+ +D + Q Q +ELS LN
Sbjct:  103 YLPELMAEKDSLDPS---FTHAMQLLSVEIEKIQKGESKKDDEENYLDLFSHKNMKL---KERVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFL-----VPDMMDDICQEQFLELSYLN 275          
BLAST of KH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5W9D5|QKI_PIG (Protein quaking OS=Sus scrofa OX=9823 GN=QKI PE=2 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 1.168e-56
Identity = 102/212 (48.11%), Postives = 139/212 (65.57%), Query Frame = 3
Query:   33 MNNELSSEKKIIYTSDYLQELFKDKKSIQ----LSGINFKHATNLLDKEIALVKENLF------KFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            M  E+ +++K   T DYL +L  DKK +       GI F H   LLD+EI+ V+++++        EK +  + ++    G IV  QEK+++PVKE P++NFVGRILGPRG TAKQLE +  CKIM+RG+GSMRD+ KEEQNR KPNWEHLNEDLHVLI + D +NR + K+    E +   +   +   E  D+LK+MQLMEL+ILN + R
Sbjct:    1 MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGI-FNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAV---GPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYR 205          
BLAST of KH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9QYS9|QKI_MOUSE (Protein quaking OS=Mus musculus OX=10090 GN=Qki PE=1 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 1.168e-56
Identity = 102/212 (48.11%), Postives = 139/212 (65.57%), Query Frame = 3
Query:   33 MNNELSSEKKIIYTSDYLQELFKDKKSIQ----LSGINFKHATNLLDKEIALVKENLF------KFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            M  E+ +++K   T DYL +L  DKK +       GI F H   LLD+EI+ V+++++        EK +  + ++    G IV  QEK+++PVKE P++NFVGRILGPRG TAKQLE +  CKIM+RG+GSMRD+ KEEQNR KPNWEHLNEDLHVLI + D +NR + K+    E +   +   +   E  D+LK+MQLMEL+ILN + R
Sbjct:    1 MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGI-FNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAV---GPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYR 205          
BLAST of KH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96PU8|QKI_HUMAN (Protein quaking OS=Homo sapiens OX=9606 GN=QKI PE=1 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 1.168e-56
Identity = 102/212 (48.11%), Postives = 139/212 (65.57%), Query Frame = 3
Query:   33 MNNELSSEKKIIYTSDYLQELFKDKKSIQ----LSGINFKHATNLLDKEIALVKENLF------KFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            M  E+ +++K   T DYL +L  DKK +       GI F H   LLD+EI+ V+++++        EK +  + ++    G IV  QEK+++PVKE P++NFVGRILGPRG TAKQLE +  CKIM+RG+GSMRD+ KEEQNR KPNWEHLNEDLHVLI + D +NR + K+    E +   +   +   E  D+LK+MQLMEL+ILN + R
Sbjct:    1 MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGI-FNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAV---GPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYR 205          
BLAST of KH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5W9D6|QKI_HORSE (Protein quaking OS=Equus caballus OX=9796 GN=QKI PE=2 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 1.168e-56
Identity = 102/212 (48.11%), Postives = 139/212 (65.57%), Query Frame = 3
Query:   33 MNNELSSEKKIIYTSDYLQELFKDKKSIQ----LSGINFKHATNLLDKEIALVKENLF------KFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            M  E+ +++K   T DYL +L  DKK +       GI F H   LLD+EI+ V+++++        EK +  + ++    G IV  QEK+++PVKE P++NFVGRILGPRG TAKQLE +  CKIM+RG+GSMRD+ KEEQNR KPNWEHLNEDLHVLI + D +NR + K+    E +   +   +   E  D+LK+MQLMEL+ILN + R
Sbjct:    1 MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGI-FNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAV---GPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYR 205          
BLAST of KH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7JJZ8|QKI_FELCA (Protein quaking OS=Felis catus OX=9685 GN=QKI PE=2 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 1.168e-56
Identity = 102/212 (48.11%), Postives = 139/212 (65.57%), Query Frame = 3
Query:   33 MNNELSSEKKIIYTSDYLQELFKDKKSIQ----LSGINFKHATNLLDKEIALVKENLF------KFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            M  E+ +++K   T DYL +L  DKK +       GI F H   LLD+EI+ V+++++        EK +  + ++    G IV  QEK+++PVKE P++NFVGRILGPRG TAKQLE +  CKIM+RG+GSMRD+ KEEQNR KPNWEHLNEDLHVLI + D +NR + K+    E +   +   +   E  D+LK+MQLMEL+ILN + R
Sbjct:    1 MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGI-FNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAV---GPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYR 205          
BLAST of KH domain-containing protein vs. TrEMBL
Match: A0A267GEY4 (KH domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000586g2 PE=4 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 4.192e-68
Identity = 113/222 (50.90%), Postives = 148/222 (66.67%), Query Frame = 3
Query:   72 TSDYLQELFKDKKSIQLSGINFKHATNLLDKEIALVKENLFKFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDRMXXXXXXXXXXXXXSAAGYPLPPLMNSNILKLP 737
            T +YLQEL KDKK++Q     F H   +L+ EI  V+  LF F       D+    EG IV+ QEK+F+PVK+NP+YNFVGR+LGPRG TAKQLE  LDCKIM+RG+GSMRD+ KE+QNR KPNWEHL E+LHVLI + D++NR + K     E I +F+++ +  PES D LKQMQLME+++LNE++R         +L     AG PL      + L+LP
Sbjct:   44 TPEYLQELLKDKKNLQSLPNLFNHLDKILETEITRVRSQLFHFNGAKRASDDLPEGEGPIVTVQEKVFIPVKDNPSYNFVGRLLGPRGMTAKQLETDLDCKIMVRGKGSMRDKKKEDQNRGKPNWEHLAEELHVLICVEDHQNRAEMKAKRAAEEIKAFLEQAVKMPESEDRLKQMQLMEVAVLNETNR-------APSLMPAGHAGLPLSAAAAPHFLRLP 258          
BLAST of KH domain-containing protein vs. TrEMBL
Match: A0A267ES68 (KH domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000586g1 PE=4 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 3.294e-67
Identity = 113/222 (50.90%), Postives = 148/222 (66.67%), Query Frame = 3
Query:   72 TSDYLQELFKDKKSIQLSGINFKHATNLLDKEIALVKENLFKFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDRMXXXXXXXXXXXXXSAAGYPLPPLMNSNILKLP 737
            T +YLQEL KDKK++Q     F H   +L+ EI  V+  LF F       D+    EG IV+ QEK+F+PVK+NP+YNFVGR+LGPRG TAKQLE  LDCKIM+RG+GSMRD+ KE+QNR KPNWEHL E+LHVLI + D++NR + K     E I +F+++ +  PES D LKQMQLME+++LNE++R         +L     AG PL      + L+LP
Sbjct:   44 TPEYLQELLKDKKNLQSLPNLFNHLDKILETEITRVRSQLFHFNGAKRASDDLPEGEGPIVTVQEKVFIPVKDNPSYNFVGRLLGPRGMTAKQLETDLDCKIMVRGKGSMRDKKKEDQNRGKPNWEHLAEELHVLICVEDHQNRAEMKAKRAAEEIKAFLEQAVKMPESEDRLKQMQLMEVAVLNETNR-------APSLMPAGHAGLPLSAAAAPHFLRLP 258          
BLAST of KH domain-containing protein vs. TrEMBL
Match: A0A267G2J6 (KH domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000586g4 PE=4 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 5.041e-67
Identity = 113/222 (50.90%), Postives = 148/222 (66.67%), Query Frame = 3
Query:   72 TSDYLQELFKDKKSIQLSGINFKHATNLLDKEIALVKENLFKFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDRMXXXXXXXXXXXXXSAAGYPLPPLMNSNILKLP 737
            T +YLQEL KDKK++Q     F H   +L+ EI  V+  LF F       D+    EG IV+ QEK+F+PVK+NP+YNFVGR+LGPRG TAKQLE  LDCKIM+RG+GSMRD+ KE+QNR KPNWEHL E+LHVLI + D++NR + K     E I +F+++ +  PES D LKQMQLME+++LNE++R         +L     AG PL      + L+LP
Sbjct:   62 TPEYLQELLKDKKNLQSLPNLFNHLDKILETEITRVRSQLFHFNGAKRASDDLPEGEGPIVTVQEKVFIPVKDNPSYNFVGRLLGPRGMTAKQLETDLDCKIMVRGKGSMRDKKKEDQNRGKPNWEHLAEELHVLICVEDHQNRAEMKAKRAAEEIKAFLEQAVKMPESEDRLKQMQLMEVAVLNETNR-------APSLMPAGHAGLPLSAAAAPHFLRLP 276          
BLAST of KH domain-containing protein vs. TrEMBL
Match: A0A068WWQ6 (Protein quaking OS=Echinococcus granulosus OX=6210 GN=EgrG_000054370 PE=4 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 1.381e-66
Identity = 106/191 (55.50%), Postives = 144/191 (75.39%), Query Frame = 3
Query:   72 TSDYLQELFKDKKSIQLSGINFKHATNLLDKEIALVKENLFKFEKTTIPIDNSSIRE--GRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            T +YLQEL  DKK +Q    +FKH   +L+KEIA V+E LF  +  +I + N+ + +  G+IV+ Q K+++PVKENP YNFVGR+LGPRG TAKQ+EQ L CKIM+RG+GSMRD+ KE+QNR KPNWEHL EDLHVL+++ DYE+R + ++     AI+ F+++GL TPE  D LKQ QLMEL++LN+ +R
Sbjct:   35 TPEYLQELLMDKKQLQSMPNSFKHVELILEKEIAQVRERLF-HKNGSIQMSNTDLPDPSGQIVTLQRKVYIPVKENPTYNFVGRLLGPRGLTAKQMEQDLGCKIMVRGKGSMRDKRKEDQNRGKPNWEHLQEDLHVLVSVEDYESRAELRLQRAVNAITIFLEQGLRTPEDKDLLKQTQLMELAVLNDKER 224          
BLAST of KH domain-containing protein vs. TrEMBL
Match: A0A087VXC9 (Protein quaking OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000055900 PE=4 SV=1)

HSP 1 Score: 226.868 bits (577), Expect = 3.222e-66
Identity = 106/191 (55.50%), Postives = 144/191 (75.39%), Query Frame = 3
Query:   72 TSDYLQELFKDKKSIQLSGINFKHATNLLDKEIALVKENLFKFEKTTIPIDNSSIRE--GRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            T +YLQEL  DKK +Q    +FKH   +L+KEIA V+E LF  +  +I + N+ + +  G+IV+ Q K+++PVKENP YNFVGR+LGPRG TAKQ+EQ L CKIM+RG+GSMRD+ KE+QNR KPNWEHL EDLHVL+++ DYE+R + ++     AI+ F+++GL TPE  D LKQ QLMEL++LN+ +R
Sbjct:   35 TPEYLQELLMDKKQLQSMPNSFKHVELILEKEIAQVRERLF-HKNGSIQMSNTDLPDPSGQIVTLQRKVYIPVKENPTYNFVGRLLGPRGLTAKQMEQDLGCKIMVRGKGSMRDKRKEDQNRGKPNWEHLQEDLHVLVSVEDYESRAELRLQRAVNAITIFLEQGLRTPEDKDLLKQTQLMELAVLNDKER 224          
BLAST of KH domain-containing protein vs. Ensembl Cavefish
Match: qki2 (protein quaking-B [Source:NCBI gene;Acc:103029551])

HSP 1 Score: 187.963 bits (476), Expect = 1.953e-56
Identity = 101/212 (47.64%), Postives = 137/212 (64.62%), Query Frame = 3
Query:   33 MNNELSSEKKIIYTSDYLQELFKDKKSIQ----LSGINFKHATNLLDKEIALVKENLF------KFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            M  E+ +++K   T DYL +L  DKK +       GI F H   LLD+EI  V+++++        +K T  + ++    G I   QEK+++PVKE P++NFVGRILGPRG TAKQLE +  CKIM+RG+GSMRD+ KEEQNR KPNWEHLNEDLHVLI + D +NR + K+    E +   +   +   E  D+LK+MQLMEL+ILN + R
Sbjct:    1 MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGI-FNHLERLLDEEIGRVRKDMYNDTLNGSTDKRTSELPDAV---GPIAQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDSQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYR 205          
BLAST of KH domain-containing protein vs. Ensembl Cavefish
Match: qki2 (protein quaking-B [Source:NCBI gene;Acc:103029551])

HSP 1 Score: 187.963 bits (476), Expect = 2.360e-56
Identity = 101/212 (47.64%), Postives = 137/212 (64.62%), Query Frame = 3
Query:   33 MNNELSSEKKIIYTSDYLQELFKDKKSIQ----LSGINFKHATNLLDKEIALVKENLF------KFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            M  E+ +++K   T DYL +L  DKK +       GI F H   LLD+EI  V+++++        +K T  + ++    G I   QEK+++PVKE P++NFVGRILGPRG TAKQLE +  CKIM+RG+GSMRD+ KEEQNR KPNWEHLNEDLHVLI + D +NR + K+    E +   +   +   E  D+LK+MQLMEL+ILN + R
Sbjct:    1 MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGI-FNHLERLLDEEIGRVRKDMYNDTLNGSTDKRTSELPDAV---GPIAQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDSQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYR 205          
BLAST of KH domain-containing protein vs. Ensembl Cavefish
Match: qki2 (protein quaking-B [Source:NCBI gene;Acc:103029551])

HSP 1 Score: 188.348 bits (477), Expect = 3.273e-56
Identity = 101/212 (47.64%), Postives = 137/212 (64.62%), Query Frame = 3
Query:   33 MNNELSSEKKIIYTSDYLQELFKDKKSIQ----LSGINFKHATNLLDKEIALVKENLF------KFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            M  E+ +++K   T DYL +L  DKK +       GI F H   LLD+EI  V+++++        +K T  + ++    G I   QEK+++PVKE P++NFVGRILGPRG TAKQLE +  CKIM+RG+GSMRD+ KEEQNR KPNWEHLNEDLHVLI + D +NR + K+    E +   +   +   E  D+LK+MQLMEL+ILN + R
Sbjct:    1 MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGI-FNHLERLLDEEIGRVRKDMYNDTLNGSTDKRTSELPDAV---GPIAQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDSQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYR 205          
BLAST of KH domain-containing protein vs. Ensembl Cavefish
Match: qkib (QKI, KH domain containing, RNA binding b [Source:ZFIN;Acc:ZDB-GENE-081028-54])

HSP 1 Score: 182.57 bits (462), Expect = 2.566e-54
Identity = 98/212 (46.23%), Postives = 137/212 (64.62%), Query Frame = 3
Query:   33 MNNELSSEKKIIYTSDYLQELFKDKKSIQ----LSGINFKHATNLLDKEIALVKENLF------KFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            M  E+ +++K   + DYL +L  DKK +       GI F H   LLD+EI+ V+++++        EK +  + ++    G IV  QEK+++PVKE P++NFVGRILGPRG TAKQLE +  CKIM+RG+GSMRD+ K   NR KPNWEHLNEDLHVLI + D +NR + K+    E ++  +   +   E  D+LK+MQLMEL+ILN + R
Sbjct:    1 MVGEMEAKEKPKPSPDYLMQLMNDKKLMSSLPNFCGI-FNHLERLLDEEISRVRKDMYNDTLNGSTEKRSSELPDAV---GPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKVRANRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVNKLL---VPAAEGEDSLKKMQLMELAILNGTYR 205          
BLAST of KH domain-containing protein vs. Ensembl Cavefish
Match: qkia (QKI, KH domain containing, RNA binding a [Source:NCBI gene;Acc:30471])

HSP 1 Score: 171.4 bits (433), Expect = 1.195e-49
Identity = 96/211 (45.50%), Postives = 130/211 (61.61%), Query Frame = 3
Query:   30 IMNNELSSEKKIIYTSDYLQELFKDKKSIQ----LSGINFKHATNLLDKEIALVKENLFKFEKTTIPIDNSSIR----EGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            +M  E+  +++   + DYL +L  +KK +     L GI F H   LLD+EI  V+++++    + + +D   +      G IV  QEK+F+P      YNFVGRILGPRG TAKQLE +  CKIM+RG+ SMRD+ KEEQNR KPNWEHLNEDLHVLI + D + R + KM    E +   +   +   E  D LK+MQLMEL+ILN + R
Sbjct:    1 MMVGEMEVKERPRPSPDYLMQLLNEKKLMTSLPNLCGI-FTHLERLLDEEINRVRKDMYNDSVSGL-VDKHPMELPDAHGPIVHLQEKLFVP------YNFVGRILGPRGLTAKQLEAETGCKIMVRGKSSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDTQARAEIKMRRAVEEVKKLL---VPAAEGEDNLKKMQLMELAILNGTYR 200          
BLAST of KH domain-containing protein vs. Ensembl Sea Lamprey
Match: KHDRBS3 (KH RNA binding domain containing, signal transduction associated 3 [Source:HGNC Symbol;Acc:HGNC:18117])

HSP 1 Score: 96.6709 bits (239), Expect = 2.069e-23
Identity = 55/153 (35.95%), Postives = 91/153 (59.48%), Query Frame = 3
Query:  183 ENLFKFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNR--NKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESD 635
            EN +KF      ID  S R  +++   E++ +PV+++P +NF+G++LGPRG + K+L+++   K+ I G+GSMRD++KEE  R   +  + HLNEDLHVLI +    ++   +M    + +  ++      P+  D ++Q QL ELS L   D
Sbjct:   21 ENGWKF------IDVVSNRNVKLI---ERVIIPVRQHPKFNFIGKLLGPRGNSLKRLKEETGTKLSILGKGSMRDRDKEEDLRKSGEAKYAHLNEDLHVLIEVFAPPSQAYRRMGHALDEVKKYL-----VPDYNDEIRQQQLRELSFLKGED 159          
BLAST of KH domain-containing protein vs. Ensembl Sea Lamprey
Match: khdrbs1a (KH domain containing, RNA binding, signal transduction associated 1a [Source:ZFIN;Acc:ZDB-GENE-000210-25])

HSP 1 Score: 93.5893 bits (231), Expect = 1.731e-21
Identity = 63/191 (32.98%), Postives = 99/191 (51.83%), Query Frame = 3
Query:   75 SDYLQELFKDKKSIQLSGINFKHATNLLDKEIALVKENLFKFEKTTIPIDNSSIREGRIVSKQ-----EKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRN--KPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILN 626
            S Y+ EL  +K S+  S   F  A  LL  EI+ ++      +       N       I+ +Q     EK+ +P K++P +NFVG++LGP+G T K+L+ +   ++ I G+G M+D+ KEE+ RN  +  + HLNE+LHVLI +         +M    E +  F       P+  D + Q QLME++ LN
Sbjct:    5 SVYIPELVAEKDSLDPS---FVQAMRLLGAEISRLQNGGDDKKDDDKKYRN-------IIGEQNFKLAEKVLIPAKQHPKFNFVGKLLGPQGNTLKRLQVETGTRMAIMGKGCMKDRAKEEELRNSGEAKYVHLNEELHVLIEVYAPLPEAYSRMGHALEEVKKFF-----NPDYNDEICQEQLMEMTYLN 180          
BLAST of KH domain-containing protein vs. Ensembl Sea Lamprey
Match: khdrbs2 (KH domain containing, RNA binding, signal transduction associated 2 [Source:NCBI gene;Acc:768147])

HSP 1 Score: 87.4261 bits (215), Expect = 1.327e-19
Identity = 46/130 (35.38%), Postives = 79/130 (60.77%), Query Frame = 3
Query:  264 EKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKP--NWEHLNEDLHVLINI----SDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESD 635
            E++ +P K++P +NFVG++LGPRG + K+++++   K+ I G+GSMRD+  EE+ R      + HL+E+LHVLI +    S+  +R+   ++ +K+ +          P+  D ++Q QL ELS L   D
Sbjct:   39 ERVIIPAKQHPKFNFVGKLLGPRGNSLKRMQEETGTKMSILGKGSMRDKALEEEMRKSGENKYAHLSEELHVLIEVFAPPSEAYSRMGHALDEVKKYL---------VPDYNDEIRQEQLRELSFLKGED 159          
BLAST of KH domain-containing protein vs. Ensembl Sea Lamprey
Match: sf1 (splicing factor 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2492])

HSP 1 Score: 84.7297 bits (208), Expect = 3.665e-18
Identity = 50/127 (39.37%), Postives = 80/127 (62.99%), Query Frame = 3
Query:  264 EKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNED--LHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            E+I +P  E+P+ NF+G I+GPRG T K++E++ + KIMIRG+GS+    KE +  +KP      ED  LH L+  S  +N V + ++ IK    + +++G+  PE  + L++MQL EL+ LN + R
Sbjct:  208 ERIMIPQDEHPDINFIGLIIGPRGNTLKKIEKECNAKIMIRGKGSV----KEGKIGHKPGQPLPGEDEPLHALVTASTQDN-VRKAVDQIK----NILKQGIEVPEGQNELRRMQLRELARLNGTLR 325          
BLAST of KH domain-containing protein vs. Ensembl Yeast
Match: MSL5 (Component of commitment complex; which defines first step in splicing pathway; essential protein that interacts with Mud2p and Prp40p, forming a bridge between the intron ends; also involved in nuclear retention of pre-mRNA; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000004106])

HSP 1 Score: 82.4185 bits (202), Expect = 1.228e-17
Identity = 57/169 (33.73%), Postives = 94/169 (55.62%), Query Frame = 3
Query:  138 KHATNLLDKEIALVKENLFKFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRN--KPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            ++   L D+ I LV E   K     +P D+      R    Q+K ++PV + P+ NFVG +LGPRG T ++L++  +CKI IRGRGS+    KE +N +   P   +  + LH LI I+D E+++ + +   +    + + + + +PE  + LK+ QL EL+ LN + R
Sbjct:  113 RYRKKLEDERIKLV-EIALKTIPYFVPPDDYK----RPTKFQDKYYIPVDQYPDVNFVGLLLGPRGRTLRKLQEDSNCKIAIRGRGSV----KEGKNASDLPPGAMNFEDPLHCLI-IADSEDKIQKGIKVCQ----NIVIKAVTSPEGQNDLKRGQLRELAELNGTLR 267          
BLAST of KH domain-containing protein vs. Ensembl Nematostella
Match: EDO30297 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T170])

HSP 1 Score: 136.346 bits (342), Expect = 1.362e-38
Identity = 70/175 (40.00%), Postives = 105/175 (60.00%), Query Frame = 3
Query:  135 FKHATNLLDKEIALVKENLFKFEKTTIPIDNSSIRE-------GRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            F HA  LLD+EI  V+  LF      +    +SI +       G  V   EK++ PVKE P +NFVGR++GPRG T +++E    CK+++RG+GSM+D+  EE+ R +PN+EHL+EDLHVLI+  D E R   ++    E + S ++      E  D +K+ QL +L++LN + R
Sbjct:    5 FLHAERLLDQEINKVRNELFHGATNGVDNGTTSIADLSLPAPSGPRVKLVEKVYAPVKEFPKFNFVGRVIGPRGMTLREIESTTGCKLLVRGKGSMKDKKLEEEKRGQPNYEHLDEDLHVLISCEDTEERCHTRLEKAVERVQSLLR---PVEEGEDEIKKKQLKDLALLNGTLR 176          
BLAST of KH domain-containing protein vs. Ensembl Nematostella
Match: EDO44127 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWI4])

HSP 1 Score: 104.375 bits (259), Expect = 9.900e-27
Identity = 65/185 (35.14%), Postives = 98/185 (52.97%), Query Frame = 3
Query:   78 DYLQELFKDKKSIQLSGINFKHATNLLDKEIALVKENLFKFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNR--NKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILN 626
            +YLQ+L  +K+S+  S   F H   LL               K   P +   +   + V   EK+F+PVK++P +NFVG++LGPRG T K+L+     K+ I G+GSMRD+ KEE+ R    P + HL E+LHVLI +     +   ++    E I  ++      PE  D + Q Q+ E++ILN
Sbjct:    6 NYLQDLLAEKESLDPS---FIHCMRLLTSG------------KRPFPTEEGKLY--KPVKLSEKVFIPVKDHPKFNFVGKLLGPRGNTFKRLQNSTGTKMSILGKGSMRDKEKEEELRATEDPKYAHLGEELHVLIEVEAPPGQAHARLGIAIEEIKKYL-----IPEMNDEIHQEQMREMAILN 168          
BLAST of KH domain-containing protein vs. Ensembl Nematostella
Match: EDO28641 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5W9])

HSP 1 Score: 84.7297 bits (208), Expect = 6.233e-20
Identity = 49/137 (35.77%), Postives = 71/137 (51.82%), Query Frame = 3
Query:   72 TSDYLQELFKDKKSIQLSGINFKHATNLLDK-----------------EIALVKENLFKFEKTTIPIDNSSIRE-------GRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQ 410
            TS+YL EL  DK ++      F HA  LLD+                 EI  V+  LF      +    +SI +       G  V   EK++ PVKE P +NFVGR++GPRG T +++E    CK+++RG+GSM+D+
Sbjct:    6 TSEYLNELLNDKTTVSKMPKIFLHAERLLDQGHSWDKDVFLRINFPFTEINKVRNELFHGATNGVDNGTTSIADLSLPAPSGPRVKLVEKVYAPVKEFPKFNFVGRVIGPRGMTLREIESTTGCKLLVRGKGSMKDK 142          
BLAST of KH domain-containing protein vs. Ensembl Nematostella
Match: EDO45484 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSV9])

HSP 1 Score: 63.1586 bits (152), Expect = 2.060e-11
Identity = 32/81 (39.51%), Postives = 53/81 (65.43%), Query Frame = 3
Query:  249 IVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLN----EDLHVLI 479
            ++  Q+K+ +P  ENP  NF+G ++GPRG T K +E++ + KIMIRG+GS++D    +Q R + + + +N    E LH L+
Sbjct:  177 LIKIQDKVMIPQDENPEVNFIGLLIGPRGNTLKNMEKETNAKIMIRGKGSIKDG---KQGRGR-DMQLMNSGEDEPLHALV 253          
BLAST of KH domain-containing protein vs. Ensembl Nematostella
Match: EDO26937 (pep supercontig:ASM20922v1:NEMVEscaffold_5067:6022:6774:-1 gene:NEMVEDRAFT_v1g152583 transcript:EDO26937 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 1.166e-9
Identity = 28/73 (38.36%), Postives = 44/73 (60.27%), Query Frame = 3
Query:  420 EQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            E+ R +PN+EHL+EDLHVLI+  D E R   ++    E + S ++      E  D +K+ QL +L++LN + R
Sbjct:    2 EEKRGQPNYEHLDEDLHVLISCEDTEERCHTRLEKAVERVQSLLRP---VEEGEDEIKKKQLKDLALLNGTLR 71          
BLAST of KH domain-containing protein vs. Ensembl Medaka
Match: qkia (protein quaking-A [Source:NCBI gene;Acc:101158568])

HSP 1 Score: 182.57 bits (462), Expect = 5.384e-54
Identity = 100/211 (47.39%), Postives = 134/211 (63.51%), Query Frame = 3
Query:   30 IMNNELSSEKKIIYTSDYLQELFKDKKSIQ----LSGINFKHATNLLDKEIALVKENLFKFEKTTIPIDNSSIR----EGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            +M  E+  +++   + DYL +L  +KK +     L GI F H   LLD+EI  V+++++      + +D   +      G IV  QEK+F+PVKE P+YNFVGRILGPRG TAKQLE +  CKIM+RG+ SMRD+ KEEQNR KPNWEHLNEDLHVLI + D + R + KM    E +   +   +   E  D LK+MQLMEL+ILN + R
Sbjct:    1 MMVGEVEVKERPRPSPDYLMQLLNEKKLMTSLPNLCGI-FTHLERLLDEEINRVRKDMYSDTVNGL-VDKHPLELPEPMGPIVHLQEKLFVPVKEYPDYNFVGRILGPRGLTAKQLEAETGCKIMVRGKSSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDTQTRAEIKMKRAVEEVKKLL---VPAAEGEDNLKKMQLMELAILNGTYR 206          
BLAST of KH domain-containing protein vs. Ensembl Medaka
Match: qkia (protein quaking-A [Source:NCBI gene;Acc:101158568])

HSP 1 Score: 182.185 bits (461), Expect = 6.619e-54
Identity = 100/211 (47.39%), Postives = 134/211 (63.51%), Query Frame = 3
Query:   30 IMNNELSSEKKIIYTSDYLQELFKDKKSIQ----LSGINFKHATNLLDKEIALVKENLFKFEKTTIPIDNSSIR----EGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            +M  E+  +++   + DYL +L  +KK +     L GI F H   LLD+EI  V+++++      + +D   +      G IV  QEK+F+PVKE P+YNFVGRILGPRG TAKQLE +  CKIM+RG+ SMRD+ KEEQNR KPNWEHLNEDLHVLI + D + R + KM    E +   +   +   E  D LK+MQLMEL+ILN + R
Sbjct:    1 MMVGEVEVKERPRPSPDYLMQLLNEKKLMTSLPNLCGI-FTHLERLLDEEINRVRKDMYSDTVNGL-VDKHPLELPEPMGPIVHLQEKLFVPVKEYPDYNFVGRILGPRGLTAKQLEAETGCKIMVRGKSSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDTQTRAEIKMKRAVEEVKKLL---VPAAEGEDNLKKMQLMELAILNGTYR 206          
BLAST of KH domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000045137.1 (protein quaking-B-like [Source:NCBI gene;Acc:101161529])

HSP 1 Score: 177.178 bits (448), Expect = 2.495e-52
Identity = 95/196 (48.47%), Postives = 125/196 (63.78%), Query Frame = 3
Query:   78 DYLQELFKDKKSIQ----LSGINFKHATNLLDKEIALVKENLFKFEKTTIPIDNSSIRE-----GRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            DYL +L  D+K +      SGI F H   LLD+EI  V+++++         +   + E     G +   QEK+++PVKE P++NFVGRILGPRG TAKQLE +  CKIM+RG+GSMRD+ KEE NR KPNWEHLNEDLHVLI + D  NR   K+   + AI+   +  +   E  D LK+MQLMEL+ILN + R
Sbjct:   16 DYLMQLMNDRKVMSSLPNFSGI-FTHLERLLDEEIGRVRKDMYNDTLNGGMFNGRDMEELPEAIGPVAQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEMNRGKPNWEHLNEDLHVLITVEDTHNRAKIKL---QRAINEVKKLLVPAAEGEDNLKKMQLMELAILNGTYR 207          
BLAST of KH domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000044982.1 (protein quaking-B-like [Source:NCBI gene;Acc:101161529])

HSP 1 Score: 177.178 bits (448), Expect = 3.052e-52
Identity = 95/196 (48.47%), Postives = 125/196 (63.78%), Query Frame = 3
Query:   78 DYLQELFKDKKSIQ----LSGINFKHATNLLDKEIALVKENLFKFEKTTIPIDNSSIRE-----GRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            DYL +L  D+K +      SGI F H   LLD+EI  V+++++         +   + E     G +   QEK+++PVKE P++NFVGRILGPRG TAKQLE +  CKIM+RG+GSMRD+ KEE NR KPNWEHLNEDLHVLI + D  NR   K+   + AI+   +  +   E  D LK+MQLMEL+ILN + R
Sbjct:   16 DYLMQLMNDRKVMSSLPNFSGI-FTHLERLLDEEIGRVRKDMYNDTLNGGMFNGRDMEELPEAIGPVAQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEMNRGKPNWEHLNEDLHVLITVEDTHNRAKIKL---QRAINEVKKLLVPAAEGEDNLKKMQLMELAILNGTYR 207          
BLAST of KH domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000031315.1 (protein quaking-B-like [Source:NCBI gene;Acc:101161529])

HSP 1 Score: 176.792 bits (447), Expect = 3.562e-52
Identity = 95/196 (48.47%), Postives = 125/196 (63.78%), Query Frame = 3
Query:   78 DYLQELFKDKKSIQ----LSGINFKHATNLLDKEIALVKENLFKFEKTTIPIDNSSIRE-----GRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            DYL +L  D+K +      SGI F H   LLD+EI  V+++++         +   + E     G +   QEK+++PVKE P++NFVGRILGPRG TAKQLE +  CKIM+RG+GSMRD+ KEE NR KPNWEHLNEDLHVLI + D  NR   K+   + AI+   +  +   E  D LK+MQLMEL+ILN + R
Sbjct:   16 DYLMQLMNDRKVMSSLPNFSGI-FTHLERLLDEEIGRVRKDMYNDTLNGGMFNGRDMEELPEAIGPVAQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEMNRGKPNWEHLNEDLHVLITVEDTHNRAKIKL---QRAINEVKKLLVPAAEGEDNLKKMQLMELAILNGTYR 207          
BLAST of KH domain-containing protein vs. Planmine SMEST
Match: SMESG000080790.1 (SMESG000080790.1)

HSP 1 Score: 615.92 bits (1587), Expect = 0.000e+0
Identity = 323/338 (95.56%), Postives = 323/338 (95.56%), Query Frame = 3
Query:   33 MNNELSSEKKIIYTSDYLQELFKDKKSIQLSGINFKHATNLLDKEIALVKENLFKFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDRMXXXXXXXXXXXXXSAAGYPLPPLMNSNILKLPFLPNVYDPFTDLSQLINLQSQAQPDPLQVVSLGQPWQALTAPMMPLDNSYSTENILSLSNDQNNSTLLSLFNQPPTINYVNYSIAGPLKLRTDQRTHPYSRAQ 1046
            MNNELSSEKKIIYTSDYLQELFKDKKSIQLSGINFKHATNLLDKEIALVKEN              SIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISD ENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDRMQQQQQRQQTLFQQSAAGYPLPPLMNSNILKLPFLPNVYDPFTDLSQLINLQSQAQPDPLQVVSLGQPWQALTAPMMPLDNSYSTENILSLSNDQNNSTLLSLFNQPPTINYVNYSIAGPLKLRTDQRTHPYSRAQ
Sbjct:    1 MNNELSSEKKIIYTSDYLQELFKDKKSIQLSGINFKHATNLLDKEIALVKENF-------------SIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDCENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDRMQQQQQRQQTLFQQSAAGYPLPPLMNSNILKLPFLPNVYDPFTDLSQLINLQSQAQPDPLQVVSLGQPWQALTAPMMPLDNSYSTENILSLSNDQNNSTLLSLFNQPPTINYVNYSIAGPLKLRTDQRTHPYSRAQ 325          
BLAST of KH domain-containing protein vs. Planmine SMEST
Match: SMESG000068399.1 (SMESG000068399.1)

HSP 1 Score: 201.06 bits (510), Expect = 6.455e-61
Identity = 100/195 (51.28%), Postives = 138/195 (70.77%), Query Frame = 3
Query:   72 TSDYLQELFKDKKSIQL--SGINFKHATNLLDKEIALVKENLFKFEKT---TIPIDNS-SIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            T +YLQEL +DK+ +Q      NF+H  N+L+KEI  V+E LF    T   T  I+N+    +G  V+ QEK+++PV ENPNYNF+GRILGPRG TAKQLEQ+L CK+MIRG+GS+R++ KE++ R KPNWEHLN+ LH+ I + DYENR   K+    +AI  FI++G+  P+  D +K+ QLMEL+I+N + R
Sbjct:   24 TPEYLQELLQDKQKLQCFQPNFNFRHLLNILEKEINRVREKLFHINGTSGQTKSIENALPCPKGEYVTLQEKVYVPVDENPNYNFIGRILGPRGLTAKQLEQELQCKLMIRGKGSLRNKEKEDELRGKPNWEHLNDKLHINITVEDYENRAVIKLKWALDAIEKFIEQGIKMPDGEDDIKKRQLMELAIINGTYR 218          
BLAST of KH domain-containing protein vs. Planmine SMEST
Match: SMESG000069949.1 (SMESG000069949.1)

HSP 1 Score: 116.701 bits (291), Expect = 9.453e-30
Identity = 73/196 (37.24%), Postives = 112/196 (57.14%), Query Frame = 3
Query:   72 TSDYLQELFKDKKSI-QLSGINFKHATNLLDKEIALVKENLF------KFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            T +YL EL +D K+I  LS I   +   LL++EI + +  LF      K  + ++P    S  E  I++  +K+ +PV  NP YNF+GRILGP G T KQ+E++ DCKI IRGRGS+R+  KE+  + K N  +  +DLH++I ++  E+    +  + +  I S   E ++     D  KQ QLME +I+  + R
Sbjct:   29 TIEYLHELLRDYKTIINLSQIVSNNIKRLLEREIMISRHILFHQKYVTKQSRESLP--QVSATENVIIT--QKLLVPVHLNPTYNFIGRILGPGGLTLKQIEREFDCKIKIRGRGSVRNVQKEKCFKTKNNTNNQQDDLHLIITVTGDESYARNQTRSAENYIKSLFDEAVSKSIDEDEAKQNQLMEYAIVKGTYR 220          
BLAST of KH domain-containing protein vs. Planmine SMEST
Match: SMESG000031862.1 (SMESG000031862.1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.722e-14
Identity = 45/126 (35.71%), Postives = 73/126 (57.94%), Query Frame = 3
Query:  261 QEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            +EK+F+P  + P+ N +G I+GPRG T K LE++ + KI+IRG+GS+ +      N   P  +   E LH    I+ +     EK     + I+  IQEG++ PE  + L++ Q+ +L+ILN + R
Sbjct:  143 EEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGED---ECLHAY--ITSFSKECVEKAT---DRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYR 260          
BLAST of KH domain-containing protein vs. Planmine SMEST
Match: SMESG000060577.1 (SMESG000060577.1)

HSP 1 Score: 70.0922 bits (170), Expect = 7.083e-13
Identity = 42/126 (33.33%), Postives = 71/126 (56.35%), Query Frame = 3
Query:  261 QEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 638
            +E+IF+P ++ P+ NF G I+GPRG T K+LE++   KI+IRG+GS +     + N +       +E LH  +     E+     ++   E I   IQ+G+  PE  + L++ Q+ +L+I N + R
Sbjct:  261 EERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPG---QFNGDGAPLPGEDEPLHAYVTSMSRES-----VDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYR 378          
The following BLAST results are available for this feature:
BLAST of KH domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
QKI1.001e-5748.11QKI, KH domain containing RNA binding [Source:HGNC... [more]
QKI1.001e-5748.11QKI, KH domain containing RNA binding [Source:HGNC... [more]
QKI1.791e-5748.11QKI, KH domain containing RNA binding [Source:HGNC... [more]
QKI1.982e-5748.11QKI, KH domain containing RNA binding [Source:HGNC... [more]
QKI2.109e-5748.11QKI, KH domain containing RNA binding [Source:HGNC... [more]
back to top
BLAST of KH domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
asd-29.086e-5849.01RNA-binding protein asd-2 [Source:UniProtKB/Swiss... [more]
asd-25.099e-5749.01RNA-binding protein asd-2 [Source:UniProtKB/Swiss... [more]
asd-21.365e-5649.01RNA-binding protein asd-2 [Source:UniProtKB/Swiss... [more]
asd-21.663e-5649.01RNA-binding protein asd-2 [Source:UniProtKB/Swiss... [more]
gld-11.630e-5047.62Female germline-specific tumor suppressor gld-1 [... [more]
back to top
BLAST of KH domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
how2.111e-5549.22gene:FBgn0264491 transcript:FBtr0084178[more]
how2.292e-5549.22gene:FBgn0264491 transcript:FBtr0100514[more]
how3.708e-5549.22gene:FBgn0264491 transcript:FBtr0084177[more]
how3.708e-5549.22gene:FBgn0264491 transcript:FBtr0301401[more]
how3.899e-5549.22gene:FBgn0264491 transcript:FBtr0301402[more]
back to top
BLAST of KH domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
qki27.203e-5747.64QKI, KH domain containing, RNA binding 2 [Source:N... [more]
qki28.613e-5747.64QKI, KH domain containing, RNA binding 2 [Source:N... [more]
qkib1.700e-5648.36QKI, KH domain containing, RNA binding b [Source:Z... [more]
qkib1.285e-5548.36QKI, KH domain containing, RNA binding b [Source:Z... [more]
qkib1.558e-5548.36QKI, KH domain containing, RNA binding b [Source:Z... [more]
back to top
BLAST of KH domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spsb35.815e-5748.36splA/ryanodine receptor domain and SOCS box contai... [more]
spsb33.677e-5345.61splA/ryanodine receptor domain and SOCS box contai... [more]
spsb34.581e-5345.61splA/ryanodine receptor domain and SOCS box contai... [more]
spsb31.994e-4948.37splA/ryanodine receptor domain and SOCS box contai... [more]
pdc8.540e-2738.02phosducin [Source:Xenbase;Acc:XB-GENE-983832][more]
back to top
BLAST of KH domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Qk6.871e-5848.11quaking [Source:MGI Symbol;Acc:MGI:97837][more]
Qk6.871e-5848.11quaking [Source:MGI Symbol;Acc:MGI:97837][more]
Qk1.230e-5748.11quaking [Source:MGI Symbol;Acc:MGI:97837][more]
Qk1.670e-5748.11quaking [Source:MGI Symbol;Acc:MGI:97837][more]
Khdrbs15.107e-2536.41KH domain containing, RNA binding, signal transduc... [more]
back to top
BLAST of KH domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5W9D5|QKI_PIG1.168e-5648.11Protein quaking OS=Sus scrofa OX=9823 GN=QKI PE=2 ... [more]
sp|Q9QYS9|QKI_MOUSE1.168e-5648.11Protein quaking OS=Mus musculus OX=10090 GN=Qki PE... [more]
sp|Q96PU8|QKI_HUMAN1.168e-5648.11Protein quaking OS=Homo sapiens OX=9606 GN=QKI PE=... [more]
sp|Q5W9D6|QKI_HORSE1.168e-5648.11Protein quaking OS=Equus caballus OX=9796 GN=QKI P... [more]
sp|Q7JJZ8|QKI_FELCA1.168e-5648.11Protein quaking OS=Felis catus OX=9685 GN=QKI PE=2... [more]
back to top
BLAST of KH domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GEY44.192e-6850.90KH domain-containing protein (Fragment) OS=Macrost... [more]
A0A267ES683.294e-6750.90KH domain-containing protein (Fragment) OS=Macrost... [more]
A0A267G2J65.041e-6750.90KH domain-containing protein OS=Macrostomum lignan... [more]
A0A068WWQ61.381e-6655.50Protein quaking OS=Echinococcus granulosus OX=6210... [more]
A0A087VXC93.222e-6655.50Protein quaking OS=Echinococcus multilocularis OX=... [more]
back to top
BLAST of KH domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
qki21.953e-5647.64protein quaking-B [Source:NCBI gene;Acc:103029551][more]
qki22.360e-5647.64protein quaking-B [Source:NCBI gene;Acc:103029551][more]
qki23.273e-5647.64protein quaking-B [Source:NCBI gene;Acc:103029551][more]
qkib2.566e-5446.23QKI, KH domain containing, RNA binding b [Source:Z... [more]
qkia1.195e-4945.50QKI, KH domain containing, RNA binding a [Source:N... [more]
back to top
BLAST of KH domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
KHDRBS32.069e-2335.95KH RNA binding domain containing, signal transduct... [more]
khdrbs1a1.731e-2132.98KH domain containing, RNA binding, signal transduc... [more]
khdrbs21.327e-1935.38KH domain containing, RNA binding, signal transduc... [more]
sf13.665e-1839.37splicing factor 1 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
back to top
BLAST of KH domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
MSL51.228e-1733.73Component of commitment complex; which defines fir... [more]
back to top
BLAST of KH domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO302971.362e-3840.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO441279.900e-2735.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO286416.233e-2035.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454842.060e-1139.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO269371.166e-938.36pep supercontig:ASM20922v1:NEMVEscaffold_5067:6022... [more]
back to top
BLAST of KH domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
qkia5.384e-5447.39protein quaking-A [Source:NCBI gene;Acc:101158568][more]
qkia6.619e-5447.39protein quaking-A [Source:NCBI gene;Acc:101158568][more]
ENSORLT00000045137.12.495e-5248.47protein quaking-B-like [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000044982.13.052e-5248.47protein quaking-B-like [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000031315.13.562e-5248.47protein quaking-B-like [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of KH domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000080790.10.000e+095.56SMESG000080790.1[more]
SMESG000068399.16.455e-6151.28SMESG000068399.1[more]
SMESG000069949.19.453e-3037.24SMESG000069949.1[more]
SMESG000031862.11.722e-1435.71SMESG000031862.1[more]
SMESG000060577.17.083e-1333.33SMESG000060577.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023052 ID=SMED30023052|Name=KH domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1145bp
ATTTTTGAATTAATTTCATTTTAACGTTAATTATGAATAATGAGTTGTCC
AGTGAAAAAAAAATTATTTATACATCTGATTATCTGCAGGAATTATTTAA
AGACAAAAAATCGATTCAATTATCTGGCATAAATTTTAAGCACGCGACTA
ACTTATTAGACAAAGAAATCGCGTTAGTTAAAGAAAATTTGTTTAAATTT
GAAAAAACCACAATTCCCATTGACAATAGTTCTATTCGTGAAGGTAGGAT
CGTTTCAAAACAAGAAAAAATTTTTCTTCCTGTGAAAGAAAATCCAAATT
ATAATTTTGTTGGGAGAATTCTCGGTCCTCGAGGATACACAGCCAAGCAA
CTTGAACAGAAATTAGATTGTAAAATAATGATTCGAGGCCGAGGGTCAAT
GAGAGATCAGAATAAAGAAGAACAAAATAGAAACAAACCTAATTGGGAAC
ATTTAAATGAAGATCTCCACGTTCTTATAAACATATCAGATTACGAAAAT
CGCGTCGACGAAAAAATGAATACAATTAAAGAGGCTATTAGTTCATTTAT
ACAAGAAGGATTAAATACACCGGAGTCACTTGATACATTGAAACAAATGC
AATTGATGGAACTTTCAATCTTAAATGAAAGCGATAGAATGCAACAGCAA
CAACAACGACAGCAAACTCTTTTTCAACAGTCAGCAGCTGGCTATCCACT
ACCTCCGCTGATGAATTCAAATATTTTGAAACTTCCATTTCTACCCAATG
TTTACGATCCATTTACAGATTTATCTCAGTTGATTAATCTACAAAGTCAG
GCGCAGCCAGATCCTCTCCAAGTTGTCTCGTTGGGTCAACCATGGCAGGC
TTTGACTGCTCCAATGATGCCATTAGATAATTCTTATTCCACAGAAAATA
TTTTATCCCTTTCAAATGATCAAAATAATTCAACTTTACTTTCACTATTT
AATCAACCTCCAACAATTAATTATGTAAATTATTCAATTGCAGGACCTCT
AAAGCTTCGAACAGATCAAAGAACTCATCCGTATTCTCGAGCACAATAAT
TAACATTTCAACAAACTGATGCCATTGTCTTTCTCAAAAGTATTTAATAT
TTGGTAATTGCAACCATAATAATTGTTTCTTGTTTTATTACACCT
back to top

protein sequence of SMED30023052-orf-1

>SMED30023052-orf-1 ID=SMED30023052-orf-1|Name=SMED30023052-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=339bp
MNNELSSEKKIIYTSDYLQELFKDKKSIQLSGINFKHATNLLDKEIALVK
ENLFKFEKTTIPIDNSSIREGRIVSKQEKIFLPVKENPNYNFVGRILGPR
GYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLIN
ISDYENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNES
DRMQQQQQRQQTLFQQSAAGYPLPPLMNSNILKLPFLPNVYDPFTDLSQL
INLQSQAQPDPLQVVSLGQPWQALTAPMMPLDNSYSTENILSLSNDQNNS
TLLSLFNQPPTINYVNYSIAGPLKLRTDQRTHPYSRAQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036612KH_dom_type_1_sf
IPR004087KH_dom
IPR032377STAR_dimer
IPR004088KH_dom_type_1
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003723RNA binding
GO:0003727single-stranded RNA binding
Vocabulary: biological process
TermDefinition
GO:0006417regulation of translation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036612K Homology domain, type 1 superfamilyGENE3DG3DSA:3.30.1370.10coord: 1..95
e-value: 1.4E-23
score: 86.0
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 1..90
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..23
NoneNo IPR availablePANTHERPTHR11208:SF90PROTEIN QUAKINGcoord: 1..167
NoneNo IPR availablePANTHERPTHR11208RNA-BINDING PROTEIN RELATEDcoord: 1..167