Aldehyde dehydrogenase, mitochondrial

Overview
NameAldehyde dehydrogenase, mitochondrial
Smed IDSMED30023050
Length (bp)2209
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Aldehyde dehydrogenase, mitochondrial (SMED30023050) t-SNE clustered cells

Violin plots show distribution of expression levels for Aldehyde dehydrogenase, mitochondrial (SMED30023050) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Aldehyde dehydrogenase, mitochondrial (SMED30023050) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Aldehyde dehydrogenase, mitochondrial (SMED30023050) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023050

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30023050SMESG000078654.1 Contig2274GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30023050SMESG000016195.1 Contig2274GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
tail regionSMED30023050SMESG000016195.1 SmedASXL_003022SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30023050SMESG000016195.1 dd_Smed_v4_1339_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30023050SMESG000016195.1 dd_Smed_v4_1339_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30023050SMESG000016195.1 dd_Smed_v4_1339_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023050SMESG000016195.1 dd_Smed_v4_1339_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023050SMESG000016195.1 dd_Smed_v4_1339_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023050SMESG000016195.1 dd_Smed_v4_1339_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30023050SMESG000016195.1 dd_Smed_v4_1339_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023050SMESG000016195.1 Contig53642uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023050SMESG000016195.1 Contig53642newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023050SMESG000022206.1 SMESG000016195.1 Contig45541uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023050SMESG000022206.1 SMESG000016195.1 Contig45541newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
tail regionSMED30023050SMESG000016195.1 dd_Smed_v6_1339_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
dorsal-ventral muscle cellSMED30023050SMESG000016195.1 dd_Smed_v4_1339_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023050SMESG000016195.1 dd_Smed_v4_1339_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
non-ciliated epidermisSMED30023050SMESG000016195.1 dd_Smed_v4_1339_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30023050SMESG000016195.1 dd_Smed_v4_1339_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Human
Match: ALDH2 (aldehyde dehydrogenase 2 family member [Source:HGNC Symbol;Acc:HGNC:404])

HSP 1 Score: 677.167 bits (1746), Expect = 0.000e+0
Identity = 330/497 (66.40%), Postives = 401/497 (80.68%), Query Frame = 2
Query:  155 SSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFDN-VDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            ++ A P      +V   +IFINNEWHD+VS+KTFPT NP+TG+ ICQVAEG KED+DKAV AA  AFQLGSPWR+MDA+ RG L+ +LA LI RD  YLAALETLD+GKP  I+   D+++ +KC  YYAGWADK HGK IPI GD+  +TRHEPVGVCGQIIPWNFPLLMQAWKL PAL+ GN VV+K AEQTPLTA YVA+L  EAGFPPGVVN+VPG GPTAGAA+ +H  VDK+AFTGSTE+G++I      +N+KR+TLELGGKSPNI+ +DAD D AV+ ++FALFFN GQCCCAGSR +V+E IYD+FVE  VA AKS+VVGNPFD+  +QGPQ+DE Q  KILG+I++GK EGA++  GG     +G+FI+PT+F  V+D M IAKEEIFGPVMQI+KFK   EV+ RANN+ YGLAA++FT+D+DK+ +++Q+L+AGTVWVNCYDVF A +PFGGYK SG GRELGEYGL  YTEVK VT+K P KNS
Sbjct:   21 ATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPSTGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS 517          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Human
Match: ALDH1B1 (aldehyde dehydrogenase 1 family member B1 [Source:HGNC Symbol;Acc:HGNC:407])

HSP 1 Score: 632.484 bits (1630), Expect = 0.000e+0
Identity = 309/497 (62.17%), Postives = 389/497 (78.27%), Query Frame = 2
Query:  155 SSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            ++L  PI   DI   Y ++FINNEW D+VSKKTFPT NP TG+ I  VAEG + D+D+AV AA +AF+LGSPWR+MDA++RG L+ +LA L+ RD  YLA+LETLD+GKP   + A D++  IK Y Y+AGWADK HGK IP+ G +  FTRHEPVGVCGQIIPWNFPL+MQ WKLAPAL+ GNTVV+K AEQTPL+A Y+ASL  EAGFPPGVVN++ G GPTAGAA+  H  VDK+AFTGSTEVG +I K   ++N+KR+TLELGGKSP+IV ADAD ++AV+  + ALFFNMGQCCCAGSR +VEE IY++F+E  V +AK + VGNPF+ +  QGPQ+D+EQ  ++LG+I  G+ EGA++  GG++ G +GFFI+PT+F  V+D MRIAKEEIFGPV  + KFK   EV+ RANN  YGLAA++FT+D+DK+++ TQ+L+AGTVWVN Y++     PFGG+K SG GRELGE GL  YTEVK VTIK P KNS
Sbjct:   23 AALPSPILNPDIP--YNQLFINNEWQDAVSKKTFPTVNPTTGEVIGHVAEGDRADVDRAVKAAREAFRLGSPWRRMDASERGRLLNRLADLVERDRVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKWHGKTIPMDGQHFCFTRHEPVGVCGQIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNIITGYGPTAGAAIAQHVDVDKVAFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKNS 517          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Human
Match: ALDH1A2 (aldehyde dehydrogenase 1 family member A2 [Source:HGNC Symbol;Acc:HGNC:15472])

HSP 1 Score: 614.379 bits (1583), Expect = 0.000e+0
Identity = 300/492 (60.98%), Postives = 382/492 (77.64%), Query Frame = 2
Query:  170 PITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            P    ++++ YTKIFINNEW +S S + FP  NPATG+ +C+V E  K DIDKAV AA  AF LGS WR+MDA++RG L+ KLA L+ RD   LA +E+L+ GKP   A   D++  IK + YYAGWADK HG  IP+ GDY  FTRHEP+GVCGQIIPWNFPLLM AWK+APAL  GNTVV+K AEQTPL+A Y+ +L  EAGFPPGV+N++PG GPTAGAA+ +H  +DKIAFTGSTEVG++I +    +N+KR+TLELGGKSPNI+FADAD D AV+ ++  +FFN GQCC AGSRI+VEE IY++FV   V  AK +VVG+PFD   +QGPQID++Q NKIL  I SG +EGA++  GGK +G KGFFIEPT+F+ V D MRIAKEEIFGPV +I++FK  +EVI RANN+++GL A++FT DI+K+L V+ +++AGTVW+NCY+  +A +PFGG+K SG GRE+GE+GL  Y+EVK VT+K P KNS
Sbjct:   27 PSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS 518          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Human
Match: ALDH1A1 (aldehyde dehydrogenase 1 family member A1 [Source:HGNC Symbol;Acc:HGNC:402])

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 306/492 (62.20%), Postives = 378/492 (76.83%), Query Frame = 2
Query:  170 PITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            P+   D+K+ YTKIFINNEWHDSVS K FP  NPAT +++CQV EG KED+DKAV AA +AFQ+GSPWR MDA++RG L+YKLA LI RD   LA +E+++ GK  S A   D+   IK   Y AGWADK  G+ IPI G++  +TRHEP+GVCGQIIPWNFPL+M  WK+ PALS GNTVV+K AEQTPLTA +VASL  EAGFPPGVVN+VPG GPTAGAA+ +H  +DK+AFTGSTEVG++I +   ++N+KR+TLELGGKSP IV ADAD DNAV+ ++  +F++ GQCC A SRI+VEE IYD+FV   V  AK  ++GNP    V QGPQID+EQ +KIL  I+SGK EGA++  GG   G+KG+F++PT+F+ V D MRIAKEEIFGPV QIMKFK  ++VI RANN  YGL+A +FT+DIDK++ ++ +L+AGTVWVNCY V  A  PFGG+K SG GRELGEYG   YTEVK VT+K   KNS
Sbjct:   10 PVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS 501          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Human
Match: ALDH1A2 (aldehyde dehydrogenase 1 family member A2 [Source:HGNC Symbol;Acc:HGNC:15472])

HSP 1 Score: 607.831 bits (1566), Expect = 0.000e+0
Identity = 298/481 (61.95%), Postives = 376/481 (78.17%), Query Frame = 2
Query:  203 TKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            TKIFINNEW +S S + FP  NPATG+ +C+V E  K DIDKAV AA  AF LGS WR+MDA++RG L+ KLA L+ RD   LA +E+L+ GKP   A   D++  IK + YYAGWADK HG  IP+ GDY  FTRHEP+GVCGQIIPWNFPLLM AWK+APAL  GNTVV+K AEQTPL+A Y+ +L  EAGFPPGV+N++PG GPTAGAA+ +H  +DKIAFTGSTEVG++I +    +N+KR+TLELGGKSPNI+FADAD D AV+ ++  +FFN GQCC AGSRI+VEE IY++FV   V  AK +VVG+PFD   +QGPQID++Q NKIL  I SG +EGA++  GGK +G KGFFIEPT+F+ V D MRIAKEEIFGPV +I++FK  +EVI RANN+++GL A++FT DI+K+L V+ +++AGTVW+NCY+  +A +PFGG+K SG GRE+GE+GL  Y+EVK VT+K P KNS
Sbjct:    9 TKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS 489          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Celegans
Match: alh-1 (ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;Acc:Q20780])

HSP 1 Score: 616.305 bits (1588), Expect = 0.000e+0
Identity = 303/492 (61.59%), Postives = 379/492 (77.03%), Query Frame = 2
Query:  170 PITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            P   +++K  YT IFINNE+  + S KTF T NPA G+ + QVAEG K D++ AV AA  AF++GS WR+MDA+ RG L+ +LA L+ RD   LA+LE+LD+GKP ++A  AD+ L+IK   YYAGWADKNHGK IPI GDY  +TRHEPVGVCGQIIPWNFPLLMQAWKL PAL+MGNTVV+K AEQTPL+A +VA+L  EAGFP GVVN++PG G TAG A+ +H  VDK+AFTGSTEVG+++ K   E+N+K++TLELGGKSPNI+FADAD +++V  +   LFFN GQCCCAGSR +VE KIYD FV      A+  V+G+PFD    QGPQ+D +Q+  IL +I +GK +GAQ+ TGG + G +G F++PTIF  V+D M IA+EEIFGPVM I++F    E++ +ANN  YGLAA + T+DIDK+LH+  + RAG+VWVNCYDVFDAAAPFGG+K SG+GRELGEYGL  YTEVK VTIK P KNS
Sbjct:   19 PPGLSNMKPQYTGIFINNEFVPAKSGKTFETINPANGKVLAQVAEGDKTDVNIAVKAAQNAFRIGSEWRRMDASQRGVLLNRLADLMERDRVILASLESLDNGKPYAVAYNADLPLSIKTLRYYAGWADKNHGKTIPIEGDYFTYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALAMGNTVVMKVAEQTPLSALHVAALTKEAGFPDGVVNIIPGYGHTAGQAISSHMDVDKVAFTGSTEVGRLVMKAAAESNVKKVTLELGGKSPNIIFADADLNDSVHQANHGLFFNQGQCCCAGSRTFVEGKIYDDFVARSKELAEKAVIGDPFDLKTTQGPQVDGKQVETILKYIAAGKKDGAQLVTGGAKHGDQGHFVKPTIFANVKDQMTIAQEEIFGPVMTIIRFDTMEELVEKANNTIYGLAAGVMTKDIDKALHIANATRAGSVWVNCYDVFDAAAPFGGFKQSGIGRELGEYGLEAYTEVKTVTIKVPQKNS 510          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Celegans
Match: alh-1 (ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;Acc:Q20780])

HSP 1 Score: 616.305 bits (1588), Expect = 0.000e+0
Identity = 303/492 (61.59%), Postives = 379/492 (77.03%), Query Frame = 2
Query:  170 PITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            P   +++K  YT IFINNE+  + S KTF T NPA G+ + QVAEG K D++ AV AA  AF++GS WR+MDA+ RG L+ +LA L+ RD   LA+LE+LD+GKP ++A  AD+ L+IK   YYAGWADKNHGK IPI GDY  +TRHEPVGVCGQIIPWNFPLLMQAWKL PAL+MGNTVV+K AEQTPL+A +VA+L  EAGFP GVVN++PG G TAG A+ +H  VDK+AFTGSTEVG+++ K   E+N+K++TLELGGKSPNI+FADAD +++V  +   LFFN GQCCCAGSR +VE KIYD FV      A+  V+G+PFD    QGPQ+D +Q+  IL +I +GK +GAQ+ TGG + G +G F++PTIF  V+D M IA+EEIFGPVM I++F    E++ +ANN  YGLAA + T+DIDK+LH+  + RAG+VWVNCYDVFDAAAPFGG+K SG+GRELGEYGL  YTEVK VTIK P KNS
Sbjct:   19 PPGLSNMKPQYTGIFINNEFVPAKSGKTFETINPANGKVLAQVAEGDKTDVNIAVKAAQNAFRIGSEWRRMDASQRGVLLNRLADLMERDRVILASLESLDNGKPYAVAYNADLPLSIKTLRYYAGWADKNHGKTIPIEGDYFTYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALAMGNTVVMKVAEQTPLSALHVAALTKEAGFPDGVVNIIPGYGHTAGQAISSHMDVDKVAFTGSTEVGRLVMKAAAESNVKKVTLELGGKSPNIIFADADLNDSVHQANHGLFFNQGQCCCAGSRTFVEGKIYDDFVARSKELAEKAVIGDPFDLKTTQGPQVDGKQVETILKYIAAGKKDGAQLVTGGAKHGDQGHFVKPTIFANVKDQMTIAQEEIFGPVMTIIRFDTMEELVEKANNTIYGLAAGVMTKDIDKALHIANATRAGSVWVNCYDVFDAAAPFGGFKQSGIGRELGEYGLEAYTEVKTVTIKVPQKNS 510          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Celegans
Match: alh-2 (ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;Acc:Q9TXM0])

HSP 1 Score: 610.912 bits (1574), Expect = 0.000e+0
Identity = 300/487 (61.60%), Postives = 376/487 (77.21%), Query Frame = 2
Query:  185 DIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            D K  YT +FINNE+ D+ S KTF   NPA G+ + +VAEG ++D+D AV AA KAF++GS WR+MDA+ RG L+ +LA L+ RD   LA+LE+LD+GKP   A   D+ ++IK + YYAG+ADKNHGK IP+ GDY  +TRHEPVGVCGQIIPWNFPLLMQAWKLAPAL+MGNTVV+K A +TPL+A +VASL  EA FP GVVN++PG G  AG A+ +H  VDK+AFTGSTEVG+ I K   E+N+K++TLELGGKSPNIVFADAD + AV+ S+ ALFFN GQCC AGSR +VE KIYD+FV       +  V+G+PFD N  QGPQIDE Q+  I+ +I+SGK EGAQ+ TGG + G +G+F++PTIF  V D M+IA+EEIFGPVM +++F    E+I +ANN  YGLAA + T D++K+L V  ++RAG+VWVNCYDVFD AAPFGG+K SG+GRELGEYGL+ YTEVK VTIK P KNS
Sbjct:   28 DFKPKYTSLFINNEFVDAKSGKTFEFVNPANGKLLAKVAEGNRDDVDIAVEAAKKAFKIGSEWRRMDASHRGVLLNRLADLMERDRVILASLESLDNGKPYKEAYNIDLPISIKTFRYYAGYADKNHGKTIPVGGDYFTYTRHEPVGVCGQIIPWNFPLLMQAWKLAPALAMGNTVVMKVAVKTPLSALHVASLIKEAQFPEGVVNIIPGRGTDAGEAIASHMDVDKVAFTGSTEVGKTIMKAAAESNVKKVTLELGGKSPNIVFADADLEEAVRQSHHALFFNQGQCCSAGSRTFVEGKIYDEFVAKAKELVEKTVIGDPFDENTTQGPQIDESQVETIMKYIESGKKEGAQLVTGGVKHGDQGYFVKPTIFANVNDQMKIAQEEIFGPVMIVIRFDSMEELIEKANNTIYGLAAGVVTNDLNKALQVANTIRAGSVWVNCYDVFDPAAPFGGFKQSGIGRELGEYGLAAYTEVKTVTIKVPQKNS 514          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Celegans
Match: alh-1 (ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;Acc:Q20780])

HSP 1 Score: 547.74 bits (1410), Expect = 0.000e+0
Identity = 267/422 (63.27%), Postives = 331/422 (78.44%), Query Frame = 2
Query:  380 MDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            MDA+ RG L+ +LA L+ RD   LA+LE+LD+GKP ++A  AD+ L+IK   YYAGWADKNHGK IPI GDY  +TRHEPVGVCGQIIPWNFPLLMQAWKL PAL+MGNTVV+K AEQTPL+A +VA+L  EAGFP GVVN++PG G TAG A+ +H  VDK+AFTGSTEVG+++ K   E+N+K++TLELGGKSPNI+FADAD +++V  +   LFFN GQCCCAGSR +VE KIYD FV      A+  V+G+PFD    QGPQ+D +Q+  IL +I +GK +GAQ+ TGG + G +G F++PTIF  V+D M IA+EEIFGPVM I++F    E++ +ANN  YGLAA + T+DIDK+LH+  + RAG+VWVNCYDVFDAAAPFGG+K SG+GRELGEYGL  YTEVK VTIK P KNS
Sbjct:    1 MDASQRGVLLNRLADLMERDRVILASLESLDNGKPYAVAYNADLPLSIKTLRYYAGWADKNHGKTIPIEGDYFTYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALAMGNTVVMKVAEQTPLSALHVAALTKEAGFPDGVVNIIPGYGHTAGQAISSHMDVDKVAFTGSTEVGRLVMKAAAESNVKKVTLELGGKSPNIIFADADLNDSVHQANHGLFFNQGQCCCAGSRTFVEGKIYDDFVARSKELAEKAVIGDPFDLKTTQGPQVDGKQVETILKYIAAGKKDGAQLVTGGAKHGDQGHFVKPTIFANVKDQMTIAQEEIFGPVMTIIRFDTMEELVEKANNTIYGLAAGVMTKDIDKALHIANATRAGSVWVNCYDVFDAAAPFGGFKQSGIGRELGEYGLEAYTEVKTVTIKVPQKNS 422          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Celegans
Match: alh-1 (ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;Acc:Q20780])

HSP 1 Score: 547.74 bits (1410), Expect = 0.000e+0
Identity = 267/422 (63.27%), Postives = 331/422 (78.44%), Query Frame = 2
Query:  380 MDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            MDA+ RG L+ +LA L+ RD   LA+LE+LD+GKP ++A  AD+ L+IK   YYAGWADKNHGK IPI GDY  +TRHEPVGVCGQIIPWNFPLLMQAWKL PAL+MGNTVV+K AEQTPL+A +VA+L  EAGFP GVVN++PG G TAG A+ +H  VDK+AFTGSTEVG+++ K   E+N+K++TLELGGKSPNI+FADAD +++V  +   LFFN GQCCCAGSR +VE KIYD FV      A+  V+G+PFD    QGPQ+D +Q+  IL +I +GK +GAQ+ TGG + G +G F++PTIF  V+D M IA+EEIFGPVM I++F    E++ +ANN  YGLAA + T+DIDK+LH+  + RAG+VWVNCYDVFDAAAPFGG+K SG+GRELGEYGL  YTEVK VTIK P KNS
Sbjct:    1 MDASQRGVLLNRLADLMERDRVILASLESLDNGKPYAVAYNADLPLSIKTLRYYAGWADKNHGKTIPIEGDYFTYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALAMGNTVVMKVAEQTPLSALHVAALTKEAGFPDGVVNIIPGYGHTAGQAISSHMDVDKVAFTGSTEVGRLVMKAAAESNVKKVTLELGGKSPNIIFADADLNDSVHQANHGLFFNQGQCCCAGSRTFVEGKIYDDFVARSKELAEKAVIGDPFDLKTTQGPQVDGKQVETILKYIAAGKKDGAQLVTGGAKHGDQGHFVKPTIFANVKDQMTIAQEEIFGPVMTIIRFDTMEELVEKANNTIYGLAAGVMTKDIDKALHIANATRAGSVWVNCYDVFDAAAPFGGFKQSGIGRELGEYGLEAYTEVKTVTIKVPQKNS 422          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Fly
Match: Aldh (gene:FBgn0012036 transcript:FBtr0332597)

HSP 1 Score: 619.772 bits (1597), Expect = 0.000e+0
Identity = 302/499 (60.52%), Postives = 371/499 (74.35%), Query Frame = 2
Query:  152 FSSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQI-GSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            +SSL +P T  DI   YT +FINNEWH S S K F T NP T + I ++    KEDID AV AA  AF+LGSPWR+MDA++RG L+Y+LA L+ RD  YLA+LETLD+GKP S++   D+   IK   Y+AGWADKNHGK IP+ GD+  +TRHEPVGVCGQIIPWNFP+LM AWKL PAL+ GNT+VLK AEQT LTA Y+A L  EA   P  V  V     TAGAAL  H  VDK+AFTGST+VG++I       N+KR+TLELGGKSPNI+ +D D D AV+T++F LFFNMGQCCCAGSR +VE+KIYD+FVE     AK + VGNPFD N +QGPQ++EEQM KILG I +GK +GA++  GG +  G  G+F++PT+F  V+D M IA+EEIFGPV Q+++FK  +EVI RANN+EYGLAA++FT+D+DK+ ++   LRAGTVWVN Y+V  A APFGGYK SG GRE GEY LSNYTEVK V +K   KNS
Sbjct:   25 YSSLPQPQTTPDI--LYTGVFINNEWHKSKSGKIFETINPTTAEVIAEIQCADKEDIDIAVQAARNAFKLGSPWRRMDASERGRLLYRLADLMERDQVYLASLETLDNGKPYSMSYNVDLPTAIKNLRYFAGWADKNHGKTIPMDGDFFTYTRHEPVGVCGQIIPWNFPILMMAWKLGPALATGNTIVLKPAEQTSLTALYIAQLVKEA-GFPEGVVNVVPGFGTAGAALANHCDVDKVAFTGSTDVGKLIQLASGNTNLKRVTLELGGKSPNIILSDTDMDYAVETAHFGLFFNMGQCCCAGSRTFVEDKIYDEFVERSAERAKKRTVGNPFDLNTEQGPQVNEEQMEKILGMIKTGKKQGAKLVAGGSRPEGLPGYFVQPTVFADVQDDMTIAREEIFGPVQQLIRFKKLDEVIERANNSEYGLAAAVFTKDLDKANYIVGGLRAGTVWVNTYNVLAAQAPFGGYKMSGHGRENGEYALSNYTEVKSVIVKVAQKNS 520          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Fly
Match: Aldh (gene:FBgn0012036 transcript:FBtr0079806)

HSP 1 Score: 619.772 bits (1597), Expect = 0.000e+0
Identity = 302/499 (60.52%), Postives = 371/499 (74.35%), Query Frame = 2
Query:  152 FSSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQI-GSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            +SSL +P T  DI   YT +FINNEWH S S K F T NP T + I ++    KEDID AV AA  AF+LGSPWR+MDA++RG L+Y+LA L+ RD  YLA+LETLD+GKP S++   D+   IK   Y+AGWADKNHGK IP+ GD+  +TRHEPVGVCGQIIPWNFP+LM AWKL PAL+ GNT+VLK AEQT LTA Y+A L  EA   P  V  V     TAGAAL  H  VDK+AFTGST+VG++I       N+KR+TLELGGKSPNI+ +D D D AV+T++F LFFNMGQCCCAGSR +VE+KIYD+FVE     AK + VGNPFD N +QGPQ++EEQM KILG I +GK +GA++  GG +  G  G+F++PT+F  V+D M IA+EEIFGPV Q+++FK  +EVI RANN+EYGLAA++FT+D+DK+ ++   LRAGTVWVN Y+V  A APFGGYK SG GRE GEY LSNYTEVK V +K   KNS
Sbjct:   25 YSSLPQPQTTPDI--LYTGVFINNEWHKSKSGKIFETINPTTAEVIAEIQCADKEDIDIAVQAARNAFKLGSPWRRMDASERGRLLYRLADLMERDQVYLASLETLDNGKPYSMSYNVDLPTAIKNLRYFAGWADKNHGKTIPMDGDFFTYTRHEPVGVCGQIIPWNFPILMMAWKLGPALATGNTIVLKPAEQTSLTALYIAQLVKEA-GFPEGVVNVVPGFGTAGAALANHCDVDKVAFTGSTDVGKLIQLASGNTNLKRVTLELGGKSPNIILSDTDMDYAVETAHFGLFFNMGQCCCAGSRTFVEDKIYDEFVERSAERAKKRTVGNPFDLNTEQGPQVNEEQMEKILGMIKTGKKQGAKLVAGGSRPEGLPGYFVQPTVFADVQDDMTIAREEIFGPVQQLIRFKKLDEVIERANNSEYGLAAAVFTKDLDKANYIVGGLRAGTVWVNTYNVLAAQAPFGGYKMSGHGRENGEYALSNYTEVKSVIVKVAQKNS 520          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Fly
Match: CG31075 (gene:FBgn0051075 transcript:FBtr0085080)

HSP 1 Score: 535.028 bits (1377), Expect = 0.000e+0
Identity = 280/479 (58.46%), Postives = 355/479 (74.11%), Query Frame = 2
Query:  191 KVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIK 1624
            K  YTK+FINNE+ DSVS KTF T NPAT ++I QV+EG K DID AV AA KAF   S WRK+    R +LM KL  L+ RD  +LA+LET D+GKP + A   DV  +I   +YYAGW DK  G  IP  G ++  TR EPVGV GQIIPWN+PLLM AWK  PAL++G T+++K AEQTPLTA ++A+LA EAGFP GV+NVV G GPTAGAA+  HP + K+AFTGS E+G+I+ +    +N+KR++LELGGKSP +VF DAD D AV+T++ ALF N GQ CCAGSR YV EKIYD+FV    A+AK++ VGNPF+ NV QGPQID++ + K+LG+I+SGK EGA++  GGK+IG+ GFF+EPT+F+ V+D MRIA+EEIFGPV  I KF    E+I RANN +YGLAA + T DI+K+L    ++ AG+VW+NCYD    + PFGGYK SG+GRELG+ GL NY E K +T+K
Sbjct:    7 KPKYTKLFINNEFVDSVSGKTFATFNPATSKEIVQVSEGDKADIDLAVKAAKKAFHRDSEWRKLSPLQRTNLMNKLCALMDRDKAFLASLETQDNGKPYAEA-LFDVTYSILTLQYYAGWTDKFFGDTIP-AGGFVSMTRKEPVGVVGQIIPWNYPLLMLAWKWGPALAVGCTIIMKPAEQTPLTALHMAALAKEAGFPAGVINVVNGFGPTAGAAISAHPDIAKVAFTGSVEIGRIVMQAAATSNLKRVSLELGGKSPVVVFDDADIDFAVETTHEALFSNHGQSCCAGSRTYVHEKIYDEFVAKAAAKAKARKVGNPFEQNVQQGPQIDDDMLTKVLGYIESGKKEGAKLQAGGKRIGNVGFFVEPTVFSDVKDDMRIAQEEIFGPVQSIFKFSSLEEMIDRANNVQYGLAAGVITNDINKALKFANNVDAGSVWINCYDAVLPSTPFGGYKHSGIGRELGKDGLDNYLETKTITMK 483          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Fly
Match: CG31075 (gene:FBgn0051075 transcript:FBtr0307506)

HSP 1 Score: 531.561 bits (1368), Expect = 0.000e+0
Identity = 277/477 (58.07%), Postives = 354/477 (74.21%), Query Frame = 2
Query:  197 HYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIK 1624
            +Y ++FINNE+ DSVS KTF T NPAT ++I QV+EG K DID AV AA KAF   S WRK+    R +LM KL  L+ RD  +LA+LET D+GKP + A   DV  +I   +YYAGW DK  G  IP  G ++  TR EPVGV GQIIPWN+PLLM AWK  PAL++G T+++K AEQTPLTA ++A+LA EAGFP GV+NVV G GPTAGAA+  HP + K+AFTGS E+G+I+ +    +N+KR++LELGGKSP +VF DAD D AV+T++ ALF N GQ CCAGSR YV EKIYD+FV    A+AK++ VGNPF+ NV QGPQID++ + K+LG+I+SGK EGA++  GGK+IG+ GFF+EPT+F+ V+D MRIA+EEIFGPV  I KF    E+I RANN +YGLAA + T DI+K+L    ++ AG+VW+NCYD    + PFGGYK SG+GRELG+ GL NY E K +T+K
Sbjct:   32 NYCQLFINNEFVDSVSGKTFATFNPATSKEIVQVSEGDKADIDLAVKAAKKAFHRDSEWRKLSPLQRTNLMNKLCALMDRDKAFLASLETQDNGKPYAEA-LFDVTYSILTLQYYAGWTDKFFGDTIP-AGGFVSMTRKEPVGVVGQIIPWNYPLLMLAWKWGPALAVGCTIIMKPAEQTPLTALHMAALAKEAGFPAGVINVVNGFGPTAGAAISAHPDIAKVAFTGSVEIGRIVMQAAATSNLKRVSLELGGKSPVVVFDDADIDFAVETTHEALFSNHGQSCCAGSRTYVHEKIYDEFVAKAAAKAKARKVGNPFEQNVQQGPQIDDDMLTKVLGYIESGKKEGAKLQAGGKRIGNVGFFVEPTVFSDVKDDMRIAQEEIFGPVQSIFKFSSLEEMIDRANNVQYGLAAGVITNDINKALKFANNVDAGSVWINCYDAVLPSTPFGGYKHSGIGRELGKDGLDNYLETKTITMK 506          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Fly
Match: CG8665 (gene:FBgn0032945 transcript:FBtr0081517)

HSP 1 Score: 405.986 bits (1042), Expect = 6.275e-129
Identity = 224/520 (43.08%), Postives = 330/520 (63.46%), Query Frame = 2
Query:  110 FSILFRPLLLNSKCF-------SSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIR----GDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGS-KGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKF--KDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIK 1624
            FS+L R L   S  F        +      + +I+V  T++FIN E+ D+ +++T    NP   + +C+VA     D+DKAV AA+ AF  GS WR++    RG LM  LA L+ R+ + LA +E++DSG   ++A    V ++I+ + Y+AGW DK  G  IP+      + + FTR EP+GVCG I PWN+PL+M +WK+A  ++ GNT ++K A+  PLTA   A L   AGFPPGV+NV+PG G  AG A+  H  V K+ FTGST +G+ I K C ++N+K+ +LELGGKSP I+FAD D D AVK    ++FFN G+ C A  R++VE++I+D+F+  ++ + ++  +G+P D +   GPQ  +   +K+L F   G  EGA++  GG ++ + KG+F  PT+FT V D M IA+EE FGP+M I KF   D + ++ RAN  EYGLA+ +FT+DI K+L+    + AGTV+VN Y+  D AAPFGG+K SG G++LG+  L+ Y + K VT++
Sbjct:  396 FSLLVRFLRQGSAGFGNQQLDFEAFTLKANKREIRVP-TQLFINGEFVDAEAQRTLEIVNPTNEEVLCKVACASATDVDKAVRAAHSAF-YGS-WRQITPRQRGQLMLNLADLMERNKEELATIESVDSGAVYTLALKTHVGMSIEAWRYFAGWCDKIQGNTIPVNPARPNNVLTFTRKEPIGVCGLITPWNYPLMMLSWKMAACIAAGNTCLIKPAQTCPLTALKFAELTVRAGFPPGVINVLPGKGSDAGQAVADHELVRKLGFTGSTPIGKHIMKSCADSNLKKCSLELGGKSPLIIFADCDMDKAVKHGMSSVFFNKGENCIAAGRLFVEDRIHDEFIRRVLKDLRTMTIGDPLDRSTAHGPQNHKAHFDKLLEFCRRGVDEGAKLVYGGCRVPNLKGYFFTPTVFTNVTDDMFIAQEESFGPIMIISKFNGSDIDSLMQRANRTEYGLASGVFTKDIGKALNFADRIEAGTVFVNVYNKTDVAAPFGGFKQSGYGKDLGQEALNEYLKTKCVTVE 912          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Zebrafish
Match: aldh2.2 (aldehyde dehydrogenase 2 family member, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-030326-5])

HSP 1 Score: 671.389 bits (1731), Expect = 0.000e+0
Identity = 326/521 (62.57%), Postives = 412/521 (79.08%), Query Frame = 2
Query:   83 MSKIMISKKFSILFRPLLLNSKCFSSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            M + ++S+ F  + R   ++S   S++  P  Q D  VHY KIFINNEWHD+VSKKTFPT NPATG+ IC VAEG K D+DKAV AA  AF+LGSPWR+MDA+ RG L+ +LA  I RDA YLA LETLD+GKP +++ + DV + +KC  YYAGWADK  GK IPI G+Y  +TRHEP+GVCGQIIPWNFPLLMQAWKL PAL+ GNTVV+K AEQTPLTA Y+ASL  E GFP GVVN++PGMGPTAGAA+ +H  VDK+AFTGST+VG +I +  + +N+K++TLELGGKSPNI+ +DA+ + AV+ S+ ALFFN GQCCCAG+R +V+E IYD+FVE  V  AK+++VG+PFD N +QGPQ++E+Q  K+LG+I SGK EGA++  GG     +G+FI+PT+F  V+D M IA+EEIFGPVMQI+KFK   EVI RAN+++YGLA ++FTQDIDK+ +++  LRAGTVW+NCY+VF   APFGGYK+SG+GRE+GEYGL NYTEVK VTIK P KNS
Sbjct:    1 MLRTVLSRAFPQVCR---ISSCQHSTIPAPNVQPD--VHYNKIFINNEWHDAVSKKTFPTINPATGEIICHVAEGDKADVDKAVKAARDAFKLGSPWRRMDASQRGLLLSRLADCIERDAAYLAELETLDNGKPYAVSFSVDVPMVVKCMRYYAGWADKWEGKTIPIDGNYFCYTRHEPIGVCGQIIPWNFPLLMQAWKLGPALATGNTVVMKVAEQTPLTALYIASLIKEVGFPAGVVNIIPGMGPTAGAAIASHMDVDKVAFTGSTDVGHLIQRASSASNLKKVTLELGGKSPNIILSDANMEEAVEQSHIALFFNQGQCCCAGTRTFVQESIYDEFVERSVERAKNRIVGDPFDLNTEQGPQVNEDQFKKVLGYISSGKREGAKLMCGGAPAAERGYFIQPTVFGDVKDDMTIAREEIFGPVMQILKFKSLEEVIERANDSKYGLAGAVFTQDIDKANYISHGLRAGTVWINCYNVFGVQAPFGGYKASGIGREMGEYGLENYTEVKTVTIKVPEKNS 516          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Zebrafish
Match: aldh2.2 (aldehyde dehydrogenase 2 family member, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-030326-5])

HSP 1 Score: 671.389 bits (1731), Expect = 0.000e+0
Identity = 326/521 (62.57%), Postives = 412/521 (79.08%), Query Frame = 2
Query:   83 MSKIMISKKFSILFRPLLLNSKCFSSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            M + ++S+ F  + R   ++S   S++  P  Q D  VHY KIFINNEWHD+VSKKTFPT NPATG+ IC VAEG K D+DKAV AA  AF+LGSPWR+MDA+ RG L+ +LA  I RDA YLA LETLD+GKP +++ + DV + +KC  YYAGWADK  GK IPI G+Y  +TRHEP+GVCGQIIPWNFPLLMQAWKL PAL+ GNTVV+K AEQTPLTA Y+ASL  E GFP GVVN++PGMGPTAGAA+ +H  VDK+AFTGST+VG +I +  + +N+K++TLELGGKSPNI+ +DA+ + AV+ S+ ALFFN GQCCCAG+R +V+E IYD+FVE  V  AK+++VG+PFD N +QGPQ++E+Q  K+LG+I SGK EGA++  GG     +G+FI+PT+F  V+D M IA+EEIFGPVMQI+KFK   EVI RAN+++YGLA ++FTQDIDK+ +++  LRAGTVW+NCY+VF   APFGGYK+SG+GRE+GEYGL NYTEVK VTIK P KNS
Sbjct:    1 MLRTVLSRAFPQVCR---ISSCQHSTIPAPNVQPD--VHYNKIFINNEWHDAVSKKTFPTINPATGEIICHVAEGDKADVDKAVKAARDAFKLGSPWRRMDASQRGLLLSRLADCIERDAAYLAELETLDNGKPYAVSFSVDVPMVVKCMRYYAGWADKWEGKTIPIDGNYFCYTRHEPIGVCGQIIPWNFPLLMQAWKLGPALATGNTVVMKVAEQTPLTALYIASLIKEVGFPAGVVNIIPGMGPTAGAAIASHMDVDKVAFTGSTDVGHLIQRASSASNLKKVTLELGGKSPNIILSDANMEEAVEQSHIALFFNQGQCCCAGTRTFVQESIYDEFVERSVERAKNRIVGDPFDLNTEQGPQVNEDQFKKVLGYISSGKREGAKLMCGGAPAAERGYFIQPTVFGDVKDDMTIAREEIFGPVMQILKFKSLEEVIERANDSKYGLAGAVFTQDIDKANYISHGLRAGTVWINCYNVFGVQAPFGGYKASGIGREMGEYGLENYTEVKTVTIKVPEKNS 516          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Zebrafish
Match: aldh2.1 (aldehyde dehydrogenase 2 family member, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1262])

HSP 1 Score: 659.062 bits (1699), Expect = 0.000e+0
Identity = 322/521 (61.80%), Postives = 406/521 (77.93%), Query Frame = 2
Query:   83 MSKIMISKKFSILFRPLLLNSKCFSSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            M + + S+ F  +FR   ++S   S++  P  Q D  VHY KIFINNEWHD+VSKKTFPT NPAT + IC VAEG K D+DKAV AA  AF+LGSPWR+MDA+ RG L+ +LA  I RDA YLA LETLD+GKP +++   D+ + +KC  YYAGWADK  GK IPI G+Y  +TRHEP+GVCGQIIPWNFPLLMQA KL PAL+ GNTVV+K AEQTPLTA Y+ASL  E GFP GVVN++PG GPTAGAA+ +H  VDK+AFTGST+VG +I +  + +N+K ++LELGGKSPNI+ +DA+ + AV+ ++ ALFFN GQCCCAG+R +V+E IYD+FVE  V  AK+++VG+PFD N +QGPQ+DE+Q  K+LG+I SGK EGA++  GG     +G+FI+PT+F  V+D M IA+EEIFGPVMQI+KFK   EVI RAN+++YGLA ++FTQDIDK+ +++  LRAGTVW+NCY+VF   APFGGYK+SG+GRELGEYGL  YTEVK VTIK P KNS
Sbjct:    1 MLRTVFSRTFPQVFR---ISSCQHSTIPAPNVQPD--VHYNKIFINNEWHDAVSKKTFPTINPATAEVICHVAEGDKADVDKAVKAARDAFKLGSPWRRMDASQRGLLLSRLADCIERDAAYLAELETLDNGKPYTLSFCVDLPMVVKCLRYYAGWADKWEGKTIPIDGNYFCYTRHEPIGVCGQIIPWNFPLLMQALKLGPALATGNTVVMKVAEQTPLTALYIASLIKEVGFPAGVVNIIPGFGPTAGAAIASHMDVDKVAFTGSTDVGHLIQQASSASNLKNVSLELGGKSPNIILSDANMEEAVEQAHSALFFNQGQCCCAGTRTFVQESIYDEFVERSVERAKNRIVGDPFDLNTEQGPQVDEDQFKKVLGYISSGKREGAKLMCGGAPAAERGYFIQPTVFGDVKDDMTIAREEIFGPVMQILKFKSLEEVIERANDSKYGLAGAVFTQDIDKANYISHGLRAGTVWINCYNVFGVQAPFGGYKASGIGRELGEYGLDIYTEVKTVTIKVPQKNS 516          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Zebrafish
Match: aldh1a2 (aldehyde dehydrogenase 1 family, member A2 [Source:ZFIN;Acc:ZDB-GENE-011010-3])

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 303/495 (61.21%), Postives = 376/495 (75.96%), Query Frame = 2
Query:  161 LAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            +  P+   +IK  YTKIFINNEWHDSVS K F T NPATG+ IC V E  K D+DKAV AA  AF LGS WRKMDA++RG L++KLA L+ RD+ YLA LE+LDSGKP       D++  IK + YYAGWADK HG  IPI G++   TRHEP+GVCGQIIPWNFPL+M AWKL PALS GNTVVLK AEQTPLT  Y+ +L  EAGFPPGVVN++PG GPTAGAA+ +H  +DK+AFTGSTEVG++I +   ++N+KR+TLELGGKSPNI+FADADF+ A++ ++  +FFN GQCC AGSRI+VEE IYD+FV   V  A+ + VGNPFD   + GPQ+ EEQ  ++L  I SG +EGA++  GGK   +KGFF+EPT+F+ V+D MRIAKEEIFGPV QIMKFK   EVI RANN EYGLAA++FT+DI K++ ++ +++AGTVW+NCY+      PFGG+K SG GRELGE GL  YTE+K +T+K   K S
Sbjct:   26 MPSPVPNPEIK--YTKIFINNEWHDSVSGKVFHTYNPATGEKICDVQESDKADVDKAVQAARSAFSLGSVWRKMDASERGKLLFKLADLVERDSAYLATLESLDSGKPFLPCFFVDLQGIIKTFRYYAGWADKIHGSTIPIDGEFFTLTRHEPIGVCGQIIPWNFPLVMTAWKLGPALSCGNTVVLKPAEQTPLTCLYLGALIKEAGFPPGVVNILPGYGPTAGAAISSHMGIDKVAFTGSTEVGKLIQEAAGKSNLKRVTLELGGKSPNIIFADADFELALEQAHQGVFFNNGQCCTAGSRIFVEEPIYDEFVRRSVERAQRRKVGNPFDPTTEHGPQVSEEQQRRVLELIQSGITEGAKLECGGKAPPTKGFFVEPTVFSNVKDHMRIAKEEIFGPVQQIMKFKTIEEVIERANNTEYGLAAAVFTRDISKAMTISAAVQAGTVWINCYNALSCQCPFGGFKMSGNGRELGEIGLKEYTELKTITMKMSGKTS 518          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Zebrafish
Match: aldh1a2 (aldehyde dehydrogenase 1 family, member A2 [Source:ZFIN;Acc:ZDB-GENE-011010-3])

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 303/495 (61.21%), Postives = 376/495 (75.96%), Query Frame = 2
Query:  161 LAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            +  P+   +IK  YTKIFINNEWHDSVS K F T NPATG+ IC V E  K D+DKAV AA  AF LGS WRKMDA++RG L++KLA L+ RD+ YLA LE+LDSGKP       D++  IK + YYAGWADK HG  IPI G++   TRHEP+GVCGQIIPWNFPL+M AWKL PALS GNTVVLK AEQTPLT  Y+ +L  EAGFPPGVVN++PG GPTAGAA+ +H  +DK+AFTGSTEVG++I +   ++N+KR+TLELGGKSPNI+FADADF+ A++ ++  +FFN GQCC AGSRI+VEE IYD+FV   V  A+ + VGNPFD   + GPQ+ EEQ  ++L  I SG +EGA++  GGK   +KGFF+EPT+F+ V+D MRIAKEEIFGPV QIMKFK   EVI RANN EYGLAA++FT+DI K++ ++ +++AGTVW+NCY+      PFGG+K SG GRELGE GL  YTE+K +T+K   K S
Sbjct:   26 MPSPVPNPEIK--YTKIFINNEWHDSVSGKVFHTYNPATGEKICDVQESDKADVDKAVQAARSAFSLGSVWRKMDASERGKLLFKLADLVERDSAYLATLESLDSGKPFLPCFFVDLQGIIKTFRYYAGWADKIHGSTIPIDGEFFTLTRHEPIGVCGQIIPWNFPLVMTAWKLGPALSCGNTVVLKPAEQTPLTCLYLGALIKEAGFPPGVVNILPGYGPTAGAAISSHMGIDKVAFTGSTEVGKLIQEAAGKSNLKRVTLELGGKSPNIIFADADFELALEQAHQGVFFNNGQCCTAGSRIFVEEPIYDEFVRRSVERAQRRKVGNPFDPTTEHGPQVSEEQQRRVLELIQSGITEGAKLECGGKAPPTKGFFVEPTVFSNVKDHMRIAKEEIFGPVQQIMKFKTIEEVIERANNTEYGLAAAVFTRDISKAMTISAAVQAGTVWINCYNALSCQCPFGGFKMSGNGRELGEIGLKEYTELKTITMKMSGKTS 518          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Xenopus
Match: aldh2 (aldehyde dehydrogenase 2 family member [Source:NCBI gene;Acc:448267])

HSP 1 Score: 626.706 bits (1615), Expect = 0.000e+0
Identity = 311/499 (62.32%), Postives = 380/499 (76.15%), Query Frame = 2
Query:  149 CFSSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            C  S+A P       VH+ ++FINNEWHD+ SKKTFPT NP+TG+ IC VAEG K D+DKAV AA +AF+LGSPWR+MDA+ RG L+ +LA LI RD   LA LETLD+GKP +I+ A D++L +KC  YYAGWADK HGK IPI GDY  +TRHEPVGVCGQIIPWNFPLLM AWK  PAL+ GN +V+K AEQTPLTA +VASL  EAGFPPGVVN++ GMGPTAGAA+ +H  VDK+AFTGSTEVG++I +                       A    D AV+ ++FALFFN GQCCCAGSR YV+E IY++FVE  +  AK+++VGNPFD   +QGPQ+DEEQ NK+LG+I SGK EGA++  GG     +G+FI+PT+F  V D+M IA+EEIFGPVMQI+KFK   EVI RANN+ YGLAA++FT+DIDK+ +V+QS+RAGTVW+NCYDVF A APFGG+K+SG+GRELGEYGL  YTEVK +TIK P KNS
Sbjct:   23 CRYSVAIPTPNPKPDVHFNQLFINNEWHDAASKKTFPTINPSTGEVICHVAEGDKADVDKAVKAAREAFRLGSPWRRMDASQRGVLLNRLADLIERDRAILATLETLDNGKPYAISYAVDLDLVVKCLRYYAGWADKCHGKTIPIDGDYFTYTRHEPVGVCGQIIPWNFPLLMLAWKFGPALATGNVIVMKVAEQTPLTALHVASLVKEAGFPPGVVNIITGMGPTAGAAISSHMDVDKVAFTGSTEVGRLIQQAAGR-------------------AIEKMDWAVEQAHFALFFNQGQCCCAGSRTYVQEDIYNEFVERSIQRAKNRIVGNPFDFKTEQGPQVDEEQFNKVLGYIKSGKKEGAKLLYGGNPAADRGYFIQPTVFGDVTDNMTIAREEIFGPVMQILKFKSIEEVIDRANNSMYGLAAAVFTKDIDKAHYVSQSVRAGTVWINCYDVFGAQAPFGGFKASGIGRELGEYGLEAYTEVKNITIKIPQKNS 502          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Xenopus
Match: aldh2 (aldehyde dehydrogenase 2 family member [Source:NCBI gene;Acc:448267])

HSP 1 Score: 620.542 bits (1599), Expect = 0.000e+0
Identity = 307/487 (63.04%), Postives = 374/487 (76.80%), Query Frame = 2
Query:  185 DIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            D  +H   +FINNEWHD+ SKKTFPT NP+TG+ IC VAEG K D+DKAV AA +AF+LGSPWR+MDA+ RG L+ +LA LI RD   LA LETLD+GKP +I+ A D++L +KC  YYAGWADK HGK IPI GDY  +TRHEPVGVCGQIIPWNFPLLM AWK  PAL+ GN +V+K AEQTPLTA +VASL  EAGFPPGVVN++ GMGPTAGAA+ +H  VDK+AFTGSTEVG++I +                       A    D AV+ ++FALFFN GQCCCAGSR YV+E IY++FVE  +  AK+++VGNPFD   +QGPQ+DEEQ NK+LG+I SGK EGA++  GG     +G+FI+PT+F  V D+M IA+EEIFGPVMQI+KFK   EVI RANN+ YGLAA++FT+DIDK+ +V+QS+RAGTVW+NCYDVF A APFGG+K+SG+GRELGEYGL  YTEVK +TIK P KNS
Sbjct:   32 DPNIHPNHLFINNEWHDAASKKTFPTINPSTGEVICHVAEGDKADVDKAVKAAREAFRLGSPWRRMDASQRGVLLNRLADLIERDRAILATLETLDNGKPYAISYAVDLDLVVKCLRYYAGWADKCHGKTIPIDGDYFTYTRHEPVGVCGQIIPWNFPLLMLAWKFGPALATGNVIVMKVAEQTPLTALHVASLVKEAGFPPGVVNIITGMGPTAGAAISSHMDVDKVAFTGSTEVGRLIQQAAGR-------------------AIEKMDWAVEQAHFALFFNQGQCCCAGSRTYVQEDIYNEFVERSIQRAKNRIVGNPFDFKTEQGPQVDEEQFNKVLGYIKSGKKEGAKLLYGGNPAADRGYFIQPTVFGDVTDNMTIAREEIFGPVMQILKFKSIEEVIDRANNSMYGLAAAVFTKDIDKAHYVSQSVRAGTVWINCYDVFGAQAPFGGFKASGIGRELGEYGLEAYTEVKNITIKIPQKNS 499          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Xenopus
Match: aldh2 (aldehyde dehydrogenase 2 family member [Source:NCBI gene;Acc:448267])

HSP 1 Score: 617.076 bits (1590), Expect = 0.000e+0
Identity = 306/482 (63.49%), Postives = 373/482 (77.39%), Query Frame = 2
Query:  200 YTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            +T +FINNEWHD+ SKKTFPT NP+TG+ IC VAEG K D+DKAV AA +AF+LGSPWR+MDA+ RG L+ +LA LI RD   LA LETLD+GKP +I+ A D++L +KC  YYAGWADK HGK IPI GDY  +TRHEPVGVCGQIIPWNFPLLM AWK  PAL+ GN +V+K AEQTPLTA +VASL  EAGFPPGVVN++ GMGPTAGAA+ +H  VDK+AFTGSTEVG++I +                       A    D AV+ ++FALFFN GQCCCAGSR YV+E IY++FVE  +  AK+++VGNPFD   +QGPQ+DEEQ NK+LG+I SGK EGA++  GG     +G+FI+PT+F  V D+M IA+EEIFGPVMQI+KFK   EVI RANN+ YGLAA++FT+DIDK+ +V+QS+RAGTVW+NCYDVF A APFGG+K+SG+GRELGEYGL  YTEVK +TIK P KNS
Sbjct:   10 FTDLFINNEWHDAASKKTFPTINPSTGEVICHVAEGDKADVDKAVKAAREAFRLGSPWRRMDASQRGVLLNRLADLIERDRAILATLETLDNGKPYAISYAVDLDLVVKCLRYYAGWADKCHGKTIPIDGDYFTYTRHEPVGVCGQIIPWNFPLLMLAWKFGPALATGNVIVMKVAEQTPLTALHVASLVKEAGFPPGVVNIITGMGPTAGAAISSHMDVDKVAFTGSTEVGRLIQQAAGR-------------------AIEKMDWAVEQAHFALFFNQGQCCCAGSRTYVQEDIYNEFVERSIQRAKNRIVGNPFDFKTEQGPQVDEEQFNKVLGYIKSGKKEGAKLLYGGNPAADRGYFIQPTVFGDVTDNMTIAREEIFGPVMQILKFKSIEEVIDRANNSMYGLAAAVFTKDIDKAHYVSQSVRAGTVWINCYDVFGAQAPFGGFKASGIGRELGEYGLEAYTEVKNITIKIPQKNS 472          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Xenopus
Match: ALDH1B1 (aldehyde dehydrogenase 1 family member B1 [Source:NCBI gene;Acc:100498540])

HSP 1 Score: 615.15 bits (1585), Expect = 0.000e+0
Identity = 307/498 (61.65%), Postives = 381/498 (76.51%), Query Frame = 2
Query:  152 FSSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            FS+   P   ++ +V YTK+FINNEW D+VS + FPT +P TG+ I  VAE  K DID AV AA +AF+ GSPWR MDA+ RG L+++LA LI RD  YLA+LET+D+GKP + + A D+   +K Y YYAG+ADK HGK IP+ G+Y  +TRHEPVGVCGQIIPWNFPL+MQ WKL PAL+ GNTVV+K AEQTPL+A Y+ASL  EAG+PPGVVN++ G GPTAGAAL  H  VDKIAFTGSTEVG++I K     N+KR+TLELGGKSP IV ADAD + AV+  + ALFFNMGQCC AGSR +VEE +YD+F+E  V +AK + VGNPFD +   GPQI++EQ +KILG+I SGK+EGA++  GG++ G KGFFI+PT+F  V+D+M+IA+EEIFGPV  + KFK   EVI RANN  YGLAA IFT+D+DK++ +TQ+LRAGTVWVN Y++     PFGG+K SG GRELGE GL  YTEVK VT+K   K S
Sbjct:   20 FSTAIIPKPLSNPEVFYTKLFINNEWRDAVSGRRFPTVDPCTGEVITHVAEADKADIDAAVKAAREAFKQGSPWRSMDASQRGQLLHRLADLIERDKIYLASLETMDNGKPFADSFAIDLSTVVKVYRYYAGFADKVHGKTIPLDGNYFCYTRHEPVGVCGQIIPWNFPLVMQGWKLGPALATGNTVVMKVAEQTPLSALYIASLIKEAGYPPGVVNILTGFGPTAGAALAQHMDVDKIAFTGSTEVGRLIQKAAGSTNLKRVTLELGGKSPCIVMADADLEQAVEQCHEALFFNMGQCCAAGSRTFVEENVYDEFLERTVEKAKLRKVGNPFDLDTKHGPQINKEQFDKILGYIKSGKTEGAKLMCGGERYGDKGFFIKPTVFANVQDNMKIAREEIFGPVQPVFKFKSIKEVIERANNTSYGLAAGIFTRDLDKAMLLTQALRAGTVWVNTYNIVTCQTPFGGFKESGNGRELGEDGLKAYTEVKTVTMKISHKKS 517          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Xenopus
Match: aldh2 (aldehyde dehydrogenase 2 family member [Source:NCBI gene;Acc:448267])

HSP 1 Score: 614.764 bits (1584), Expect = 0.000e+0
Identity = 306/483 (63.35%), Postives = 373/483 (77.23%), Query Frame = 2
Query:  197 HYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            H   +FINNEWHD+ SKKTFPT NP+TG+ IC VAEG K D+DKAV AA +AF+LGSPWR+MDA+ RG L+ +LA LI RD   LA LETLD+GKP +I+ A D++L +KC  YYAGWADK HGK IPI GDY  +TRHEPVGVCGQIIPWNFPLLM AWK  PAL+ GN +V+K AEQTPLTA +VASL  EAGFPPGVVN++ GMGPTAGAA+ +H  VDK+AFTGSTEV  +         ++R+   LG             D AV+ ++FALFFN GQCCCAGSR YV+E IY++FVE  +  AK+++VGNPFD   +QGPQ+DEEQ NK+LG+I SGK EGA++  GG     +G+FI+PT+F  V D+M IA+EEIFGPVMQI+KFK   EVI RANN+ YGLAA++FT+DIDK+ +V+QS+RAGTVW+NCYDVF A APFGG+K+SG+GRELGEYGL  YTEVK +TIK P KNS
Sbjct:   14 HGKNLFINNEWHDAASKKTFPTINPSTGEVICHVAEGDKADVDKAVKAAREAFRLGSPWRRMDASQRGVLLNRLADLIERDRAILATLETLDNGKPYAISYAVDLDLVVKCLRYYAGWADKCHGKTIPIDGDYFTYTRHEPVGVCGQIIPWNFPLLMLAWKFGPALATGNVIVMKVAEQTPLTALHVASLVKEAGFPPGVVNIITGMGPTAGAAISSHMDVDKVAFTGSTEVKSL--------KVERMKRHLG------------VDWAVEQAHFALFFNQGQCCCAGSRTYVQEDIYNEFVERSIQRAKNRIVGNPFDFKTEQGPQVDEEQFNKVLGYIKSGKKEGAKLLYGGNPAADRGYFIQPTVFGDVTDNMTIAREEIFGPVMQILKFKSIEEVIDRANNSMYGLAAAVFTKDIDKAHYVSQSVRAGTVWINCYDVFGAQAPFGGFKASGIGRELGEYGLEAYTEVKNITIKIPQKNS 476          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Mouse
Match: Aldh2 (aldehyde dehydrogenase 2, mitochondrial [Source:MGI Symbol;Acc:MGI:99600])

HSP 1 Score: 682.174 bits (1759), Expect = 0.000e+0
Identity = 333/504 (66.07%), Postives = 407/504 (80.75%), Query Frame = 2
Query:  134 LLNSKCFSSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFDN-VDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            LL++   S++  P  Q +  V   +IFINNEWHD+VS+KTFPT NP+TG+ ICQVAEG KED+DKAV AA  AFQLGSPWR+MDA+DRG L+Y+LA LI RD  YLAALETLD+GKP  I+   D+++ +KC  YYAGWADK HGK IPI GD+  +TRHEPVGVCGQIIPWNFPLLMQAWKL PAL+ GN VV+K AEQTPLTA YVA+L  EAGFPPGVVN+VPG GPTAGAA+ +H  VDK+AFTGSTEVG +I      +N+KR+TLELGGKSPNI+ +DAD D AV+ ++FALFFN GQCCCAGSR +V+E +YD+FVE  VA AKS+VVGNPFD+  +QGPQ+DE Q  KILG+I SG+ EGA++  GG     +G+FI+PT+F  V+D M IAKEEIFGPVMQI+KFK   EV+ RAN+++YGLAA++FT+D+DK+ +++Q+L+AGTVW+NCYDVF A +PFGGYK SG GRELGEYGL  YTEVK VT+K P KNS
Sbjct:   18 LLSAAATSAVPAPNHQPE--VFCNQIFINNEWHDAVSRKTFPTVNPSTGEVICQVAEGNKEDVDKAVKAARAAFQLGSPWRRMDASDRGRLLYRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEGVDKVAFTGSTEVGHLIQVAAGSSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQENVYDEFVERSVARAKSRVVGNPFDSRTEQGPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVKDGMTIAKEEIFGPVMQILKFKTIEEVVGRANDSKYGLAAAVFTKDLDKANYLSQALQAGTVWINCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS 519          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Mouse
Match: Aldh1b1 (aldehyde dehydrogenase 1 family, member B1 [Source:MGI Symbol;Acc:MGI:1919785])

HSP 1 Score: 632.098 bits (1629), Expect = 0.000e+0
Identity = 312/497 (62.78%), Postives = 388/497 (78.07%), Query Frame = 2
Query:  155 SSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            ++L  PI   +I   Y K+FINNEWHD+VSKKTFPT NP TG+ I  VAEG + D+D AV AA +AF+LGSPWR+MDA++RG L+ +LA L+ RD  YLA+LETLD+GKP   +   D++  IK Y Y+AGWADK HGK IP+ G++  FTRHEPVGVCGQIIPWNFPL+MQ WKLAPAL+ GNTVV+K AEQTPL+A Y+ASL  EAGFPPGVVN++ G GPTAGAA+  H  VDK+AFTGSTEVG +I K   E+N+KR+TLELGGKSP+IV ADAD ++AV   + ALFFNMGQCCCAGSR +VEE IY +F+E  V +AK + VGNPF+ +  QGPQ+D+EQ  +ILG+I  G+ EGA++  GG+++G +GFFI+PT+F  V+D MRIAKEEIFGPV  + KFK   EVI RANN  YGLAA++FT+D+DK+++ TQ+L+AGTVWVN Y++     PFGG+K SG GRELGE GL  YTEVK VTIK P KNS
Sbjct:   25 AALPNPIPNPEI--CYNKLFINNEWHDAVSKKTFPTVNPTTGEVIGHVAEGDRADVDLAVKAAREAFRLGSPWRRMDASERGRLLNRLADLVERDRVYLASLETLDNGKPFQESYVLDLDEVIKVYRYFAGWADKWHGKTIPMDGEHFCFTRHEPVGVCGQIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNIITGYGPTAGAAIAQHMDVDKVAFTGSTEVGHLIQKAAGESNLKRVTLELGGKSPSIVLADADMEHAVDQCHEALFFNMGQCCCAGSRTFVEESIYREFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERILGYIRLGQKEGAKLLCGGERLGERGFFIKPTVFGDVQDGMRIAKEEIFGPVQPLFKFKKIEEVIQRANNTRYGLAAAVFTRDLDKAIYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLRAYTEVKTVTIKVPEKNS 519          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Mouse
Match: Aldh1a2 (aldehyde dehydrogenase family 1, subfamily A2 [Source:MGI Symbol;Acc:MGI:107928])

HSP 1 Score: 609.372 bits (1570), Expect = 0.000e+0
Identity = 298/492 (60.57%), Postives = 381/492 (77.44%), Query Frame = 2
Query:  170 PITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            P    ++++ YTKIFINNEW +S S + FP  NPATG+ +C+V E  K DIDKAV AA  AF LGS WR+MDA++RG L+ KLA L+ RD   LA +E+L+ GKP   A   D++  IK   YYAGWADK HG  IP+ GDY  FTRHEP+GVCGQIIPWNFPLLM  WK+APAL  GNTVV+K AEQTPL+A Y+ +L  EAGFPPGVVN++PG GPTAGAA+ +H  +DKIAFTGSTEVG++I +    +N+KR+TLELGGKSPNI+FADAD D AV+ ++  +FFN GQCC AGSRI+VEE IY++FV+  V  AK ++VG+PFD   +QGPQID++Q NK+L  I SG +EGA++  GGK +G KGFFIEPT+F+ V D MRIAKEEIFGPV +I++FK  +EVI RANN+++GL A++FT DI+K+L V+ +++AGTVW+NCY+  +A +PFGG+K SG GRE+GE+GL  Y+EVK VT+K P KNS
Sbjct:   27 PSPTPNLEIKYTKIFINNEWQNSESGRVFPVCNPATGEQVCEVQEADKVDIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRATLATMESLNGGKPFLQAFYIDLQGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFTWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVVNILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVKRSVERAKRRIVGSPFDPTTEQGPQIDKKQYNKVLELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALMVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS 518          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Mouse
Match: Aldh2 (aldehyde dehydrogenase 2, mitochondrial [Source:MGI Symbol;Acc:MGI:99600])

HSP 1 Score: 604.364 bits (1557), Expect = 0.000e+0
Identity = 297/456 (65.13%), Postives = 368/456 (80.70%), Query Frame = 2
Query:  134 LLNSKCFSSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFDN-VDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVW 1498
            LL++   S++  P  Q +  V   +IFINNEWHD+VS+KTFPT NP+TG+ ICQVAEG KED+DKAV AA  AFQLGSPWR+MDA+DRG L+Y+LA LI RD  YLAALETLD+GKP  I+   D+++ +KC  YYAGWADK HGK IPI GD+  +TRHEPVGVCGQIIPWNFPLLMQAWKL PAL+ GN VV+K AEQTPLTA YVA+L  EAGFPPGVVN+VPG GPTAGAA+ +H  VDK+AFTGSTEVG +I      +N+KR+TLELGGKSPNI+ +DAD D AV+ ++FALFFN GQCCCAGSR +V+E +YD+FVE  VA AKS+VVGNPFD+  +QGPQ+DE Q  KILG+I SG+ EGA++  GG     +G+FI+PT+F  V+D M IAKEEIFGPVMQI+KFK   EV+ RAN+++YGLAA++FT+D+DK+ +++Q+L+AGTVW
Sbjct:   18 LLSAAATSAVPAPNHQPE--VFCNQIFINNEWHDAVSRKTFPTVNPSTGEVICQVAEGNKEDVDKAVKAARAAFQLGSPWRRMDASDRGRLLYRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEGVDKVAFTGSTEVGHLIQVAAGSSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQENVYDEFVERSVARAKSRVVGNPFDSRTEQGPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVKDGMTIAKEEIFGPVMQILKFKTIEEVVGRANDSKYGLAAAVFTKDLDKANYLSQALQAGTVW 471          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Mouse
Match: Aldh1a7 (aldehyde dehydrogenase family 1, subfamily A7 [Source:MGI Symbol;Acc:MGI:1347050])

HSP 1 Score: 588.186 bits (1515), Expect = 0.000e+0
Identity = 294/494 (59.51%), Postives = 378/494 (76.52%), Query Frame = 2
Query:  164 AKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFDN-VDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            A P    ++K+ +TKIFINNEWHDSVS K FP  NPAT + IC V EG K D+DKAV AA +AFQ+GSPWR MDA++RG L+ KLA L+ RD   LA +E++++GK  + A   DVE++IK  +Y+AGWADK HG+ IP  G+   +TR EP+GVCGQIIPWN PL++  WKL PALS GNTVV+K AEQTPLTA ++ASL  EAGFPPGVVN+VPG GPTAG A+ +H  +DK++FTGSTEVG++I +   ++N+KR+TLELGGKSP IVFADAD D+AV+ ++  +FF+ GQ C A SR++VEE IYD+FV   V  AK  ++GNP ++ ++QGPQID+EQ NKILG I+SGK EGA++  GG + G+KGFF++PT+F+ V D MRIAKEEIFGPV QIMKFK  ++VI RANN  YGLAA +FT+D+DK++ V+ +L+AG VWVNCY       PFGG+K SG GRELGE+GL  YTE+K V ++   KNS
Sbjct:    8 AVPAPLANLKIQHTKIFINNEWHDSVSSKKFPVLNPATEEVICHVEEGDKADVDKAVKAARQAFQIGSPWRTMDASERGRLLNKLADLMERDRLLLATMESMNAGKVFAHAYLLDVEISIKALQYFAGWADKIHGQTIPSDGNIFTYTRREPIGVCGQIIPWNGPLIIFTWKLGPALSCGNTVVVKPAEQTPLTALHMASLIKEAGFPPGVVNIVPGYGPTAGGAISSHMDIDKVSFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVFADADLDSAVEFAHQGVFFHQGQICVAASRLFVEESIYDEFVRRSVERAKKYILGNPLNSGINQGPQIDKEQHNKILGLIESGKKEGAKLECGGGRWGNKGFFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSMDDVIKRANNTTYGLAAGVFTKDLDKAITVSSALQAGMVWVNCYLAVPVQCPFGGFKMSGNGRELGEHGLYEYTELKTVAMQISQKNS 501          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. UniProt/SwissProt
Match: sp|P11884|ALDH2_RAT (Aldehyde dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Aldh2 PE=1 SV=1)

HSP 1 Score: 685.641 bits (1768), Expect = 0.000e+0
Identity = 335/504 (66.47%), Postives = 407/504 (80.75%), Query Frame = 2
Query:  134 LLNSKCFSSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFDN-VDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            LL++   S++  P  Q +  V   +IFINNEWHD+VSKKTFPT NP+TG+ ICQVAEG KED+DKAV AA  AFQLGSPWR+MDA+DRG L+Y+LA LI RD  YLAALETLD+GKP  I+   D+++ +KC  YYAGWADK HGK IPI GD+  +TRHEPVGVCGQIIPWNFPLLMQAWKL PAL+ GN VV+K AEQTPLTA YVA+L  EAGFPPGVVN+VPG GPTAGAA+ +H  VDK+AFTGSTEVG +I      +N+KR+TLELGGKSPNI+ +DAD D AV+ ++FALFFN GQCCCAGSR +V+E +YD+FVE  VA AKS+VVGNPFD+  +QGPQ+DE Q  KILG+I SG+ EGA++  GG     +G+FI+PT+F  V+D M IAKEEIFGPVMQI+KFK   EV+ RANN++YGLAA++FT+D+DK+ +++Q+L+AGTVW+NCYDVF A +PFGGYK SG GRELGEYGL  YTEVK VT+K P KNS
Sbjct:   18 LLSAAATSAVPAPNQQPE--VFCNQIFINNEWHDAVSKKTFPTVNPSTGEVICQVAEGNKEDVDKAVKAAQAAFQLGSPWRRMDASDRGRLLYRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGSSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYDEFVERSVARAKSRVVGNPFDSRTEQGPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVKDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWINCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS 519          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. UniProt/SwissProt
Match: sp|P47738|ALDH2_MOUSE (Aldehyde dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Aldh2 PE=1 SV=1)

HSP 1 Score: 682.174 bits (1759), Expect = 0.000e+0
Identity = 333/504 (66.07%), Postives = 407/504 (80.75%), Query Frame = 2
Query:  134 LLNSKCFSSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFDN-VDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            LL++   S++  P  Q +  V   +IFINNEWHD+VS+KTFPT NP+TG+ ICQVAEG KED+DKAV AA  AFQLGSPWR+MDA+DRG L+Y+LA LI RD  YLAALETLD+GKP  I+   D+++ +KC  YYAGWADK HGK IPI GD+  +TRHEPVGVCGQIIPWNFPLLMQAWKL PAL+ GN VV+K AEQTPLTA YVA+L  EAGFPPGVVN+VPG GPTAGAA+ +H  VDK+AFTGSTEVG +I      +N+KR+TLELGGKSPNI+ +DAD D AV+ ++FALFFN GQCCCAGSR +V+E +YD+FVE  VA AKS+VVGNPFD+  +QGPQ+DE Q  KILG+I SG+ EGA++  GG     +G+FI+PT+F  V+D M IAKEEIFGPVMQI+KFK   EV+ RAN+++YGLAA++FT+D+DK+ +++Q+L+AGTVW+NCYDVF A +PFGGYK SG GRELGEYGL  YTEVK VT+K P KNS
Sbjct:   18 LLSAAATSAVPAPNHQPE--VFCNQIFINNEWHDAVSRKTFPTVNPSTGEVICQVAEGNKEDVDKAVKAARAAFQLGSPWRRMDASDRGRLLYRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEGVDKVAFTGSTEVGHLIQVAAGSSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQENVYDEFVERSVARAKSRVVGNPFDSRTEQGPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVKDGMTIAKEEIFGPVMQILKFKTIEEVVGRANDSKYGLAAAVFTKDLDKANYLSQALQAGTVWINCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS 519          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. UniProt/SwissProt
Match: sp|P81178|ALDH2_MESAU (Aldehyde dehydrogenase, mitochondrial OS=Mesocricetus auratus OX=10036 GN=ALDH2 PE=1 SV=1)

HSP 1 Score: 680.633 bits (1755), Expect = 0.000e+0
Identity = 332/494 (67.21%), Postives = 399/494 (80.77%), Query Frame = 2
Query:  164 AKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFDN-VDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            A P      +V   +IFINNEWHD+VSKKTFPT NP+TG+ ICQVAEG KED+DKAV AA  AFQLGSPWR+MDA+DRG L+ +LA LI RD  YLAALETLD+GKP  I+   D+++ +KC  YYAGWADK HGK IPI GD+  +TRHEPVGVCGQIIPWNFPLLMQAWKL PAL+ GN VV+K AEQTPLTA YVA+L  EAGFPPGVVN+VPG GPTAGAA+ +H  VDK+AFTGSTEVG +I      +N+KR+TLELGGKSPNI+ +DAD D AV+ ++FALFFN GQCCCAGSR +V+E +YD+FVE  VA AKS+VVGNPFD+  +QGPQ+DE Q  KILG+I SG+ EGA++  GG     +G+FI+PT+F  V+D M IAKEEIFGPVMQI+KFK   EV+ RANN++YGLAA++FT+D+DK+ +++Q+L+AGTVW+NCYDVF A +PFGGYK SG GRELGEYGL  YTEVK VTIK P KNS
Sbjct:    7 AVPAPNQQPEVFCNQIFINNEWHDAVSKKTFPTVNPSTGEVICQVAEGSKEDVDKAVKAARAAFQLGSPWRRMDASDRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGSSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYDEFVERSVARAKSRVVGNPFDSRTEQGPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVKDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWINCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTIKVPQKNS 500          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. UniProt/SwissProt
Match: sp|P05091|ALDH2_HUMAN (Aldehyde dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH2 PE=1 SV=2)

HSP 1 Score: 677.167 bits (1746), Expect = 0.000e+0
Identity = 330/497 (66.40%), Postives = 401/497 (80.68%), Query Frame = 2
Query:  155 SSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFDN-VDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            ++ A P      +V   +IFINNEWHD+VS+KTFPT NP+TG+ ICQVAEG KED+DKAV AA  AFQLGSPWR+MDA+ RG L+ +LA LI RD  YLAALETLD+GKP  I+   D+++ +KC  YYAGWADK HGK IPI GD+  +TRHEPVGVCGQIIPWNFPLLMQAWKL PAL+ GN VV+K AEQTPLTA YVA+L  EAGFPPGVVN+VPG GPTAGAA+ +H  VDK+AFTGSTE+G++I      +N+KR+TLELGGKSPNI+ +DAD D AV+ ++FALFFN GQCCCAGSR +V+E IYD+FVE  VA AKS+VVGNPFD+  +QGPQ+DE Q  KILG+I++GK EGA++  GG     +G+FI+PT+F  V+D M IAKEEIFGPVMQI+KFK   EV+ RANN+ YGLAA++FT+D+DK+ +++Q+L+AGTVWVNCYDVF A +PFGGYK SG GRELGEYGL  YTEVK VT+K P KNS
Sbjct:   21 ATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPSTGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS 517          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q2XQV4|ALDH2_PIG (Aldehyde dehydrogenase, mitochondrial OS=Sus scrofa OX=9823 GN=ALDH2 PE=2 SV=1)

HSP 1 Score: 676.781 bits (1745), Expect = 0.000e+0
Identity = 329/494 (66.60%), Postives = 398/494 (80.57%), Query Frame = 2
Query:  164 AKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFDN-VDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            A P      ++ Y +IFINNEWHD++SKKTFPT NP+TG  IC VAEG KED+D+AV AA  AFQLGSPWR++DA+DRG L+ +LA LI RD  YLAALETLD+GKP  I+   D+++ +KC  YYAGWADK HGK +PI GDY  +TRHEPVGVCGQIIPWNFPLLMQAWKL PAL+ GN VV+K +EQTPLTA YVA+L  EAGFPPGVVN+VPG GPTAGAA+ +H  VDK+AFTGSTEVG +I     ++N+KR+TLELGGKSPNI+ +DAD D AV+ ++FALFFN GQCCCAGSR +V+E IY +FVE  VA A+S+VVGNPFD+  +QGPQIDE Q  KILG+I SGK EGA++  GG     +G+FI+PT+F  V+D M IAKEEIFGPVMQI+KFK   EVI RANN++YGLAA++FT+D+DK+ +++Q+L+AGTVWVNCYDVF A +PFGGYK SG GRELGEYGL  YTEVK VT+K P KNS
Sbjct:   28 AVPAPNQQPEIFYNQIFINNEWHDAISKKTFPTVNPSTGDVICHVAEGDKEDVDRAVEAARAAFQLGSPWRRLDASDRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTLPIDGDYFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVSEQTPLTALYVANLIKEAGFPPGVVNIVPGYGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGKSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYAEFVERSVARARSRVVGNPFDSRTEQGPQIDETQFKKILGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVIGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKLSGSGRELGEYGLQAYTEVKTVTVKVPQKNS 521          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. TrEMBL
Match: A0A5P8I4K9 (ALDH2-like protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1042.72 bits (2695), Expect = 0.000e+0
Identity = 520/520 (100.00%), Postives = 520/520 (100.00%), Query Frame = 2
Query:   83 MSKIMISKKFSILFRPLLLNSKCFSSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFDNVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            MSKIMISKKFSILFRPLLLNSKCFSSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAGFPPGVVNVVPGMGPTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFDNVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS
Sbjct:    1 MSKIMISKKFSILFRPLLLNSKCFSSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAGFPPGVVNVVPGMGPTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFDNVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 520          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. TrEMBL
Match: A0A210QZC4 (Aldehyde dehydrogenase, mitochondrial OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT15257 PE=3 SV=1)

HSP 1 Score: 701.434 bits (1809), Expect = 0.000e+0
Identity = 342/499 (68.54%), Postives = 406/499 (81.36%), Query Frame = 2
Query:  149 CFSSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFDN-VDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            C S++ +P+   DIK  Y K+FINNEW +S S KTFPT NPATG+ IC+VAEG K D++ AV AA +AF+LGSPWR MDAA RG L+YKLA LI RD  Y+A+LETLD+GKP +I+ A D+EL IKCY YYAGWADKNHGKVIPI GDY  +TRHEPVGVCGQIIPWNFPLLMQAWKL PALSMGNTVV+K AEQTPLTA Y+A LA EAGFPPGV+N++PG GPTAGAA+  H  VDK+AFTGSTE+GQ+I      +N+KR+TLELGGKSPNIV ADAD  NAV+ S+FALFFN GQCCCAGSR +V+E +YD+FVE  V  AK + VGNPFD+  +QGPQ+D+EQM KIL  I SGK EGA++  GG ++G KG+FIEPT+FT V+D+MRIAKEEIFGPVMQIMKFK   E+I R+++  YGLAA++ TQD+DK+L++  SLRAG+VWVNC+D+FDAA PFGGYK SG GRELGEYGL  YTE K V IK P KNS
Sbjct:   23 CMSAVPQPLVNPDIK--YEKLFINNEWVNSASGKTFPTINPATGEKICEVAEGDKADVNVAVNAAREAFRLGSPWRTMDAAQRGHLLYKLADLIERDRQYIASLETLDNGKPYNISYAVDLELVIKCYRYYAGWADKNHGKVIPICGDYFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALSMGNTVVMKVAEQTPLTALYIAQLAKEAGFPPGVLNIIPGYGPTAGAAIAEHMDVDKVAFTGSTEIGQLIPVMAASSNLKRVTLELGGKSPNIVLADADMANAVENSHFALFFNQGQCCCAGSRTFVQESVYDEFVERSVERAKQRTVGNPFDSGNEQGPQVDQEQMEKILSLISSGKKEGAKLAVGGNRVGDKGYFIEPTVFTDVQDNMRIAKEEIFGPVMQIMKFKTIEELIERSHDTIYGLAAAVHTQDLDKALYLANSLRAGSVWVNCFDIFDAAQPFGGYKMSGNGRELGEYGLEAYTETKAVCIKVPQKNS 519          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. TrEMBL
Match: A0A0L8GHP9 (Aldedh domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22033237mg PE=3 SV=1)

HSP 1 Score: 696.427 bits (1796), Expect = 0.000e+0
Identity = 345/509 (67.78%), Postives = 415/509 (81.53%), Query Frame = 2
Query:  122 FRPLLLNSKC-FSSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
             R  +L+SK  ++ +  PIT  DI    +KIFINNE+ +SVS KTF T NPA G  IC+VAEG K DID+AV AA  AF+LGSPWR+MDA+DRG+LMYKLA LI RD +Y+A+LETLD+GK  + +   DV   I  Y YYAGWADKNHGK IPIRG++  +TRHEPVGVCGQIIPWNFPLLMQAWKL PAL++GNTVV+KTAEQTPL+A Y+A LA EAG+PPGV+N+VPG GPTAGAAL  H  VDKIAFTGSTE+G+I+S    E+N+KR+TLELGGKSPNIVFADA+ D AV+T +  LFFN GQCCCAGSRI+VEEKIYD+FV   V +AK K+VG+PFD + DQGPQ+D+EQ+ KIL  I+SGK EGA++CTGG + G KG+F+EPT+F  V+D+MRIA+EEIFGPVMQIMKF+D NE+I RA+N  YGLAA++ T D+DK+LH++ S+RAGTVWVNC+DV D AAPFGGYK SG GRELGEYGL NYTEVK VTIK P KNS
Sbjct:   15 LRWYMLSSKAGYAGIPAPITNPDIA--QSKIFINNEFVNSVSGKTFQTLNPANGDVICEVAEGDKADIDRAVAAAKDAFRLGSPWRRMDASDRGNLMYKLADLIERDKNYIASLETLDNGKTYTQSFLVDVAAVINTYRYYAGWADKNHGKTIPIRGNHFTYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALALGNTVVMKTAEQTPLSALYIAQLAVEAGYPPGVLNIVPGYGPTAGAALAKHMDVDKIAFTGSTEIGKIVSVMATESNLKRVTLELGGKSPNIVFADANMDLAVETCHLGLFFNQGQCCCAGSRIFVEEKIYDEFVARSVEQAKRKIVGDPFDPSSDQGPQVDQEQLTKILSLIESGKEEGAKLCTGGARHGDKGYFLEPTVFADVQDNMRIAQEEIFGPVMQIMKFRDMNELIERAHNTIYGLAAAVMTTDLDKALHISNSIRAGTVWVNCFDVLDTAAPFGGYKMSGNGRELGEYGLENYTEVKTVTIKVPQKNS 521          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. TrEMBL
Match: A0A267EC57 (Aldedh domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016970g2 PE=3 SV=1)

HSP 1 Score: 695.656 bits (1794), Expect = 0.000e+0
Identity = 343/525 (65.33%), Postives = 420/525 (80.00%), Query Frame = 2
Query:   71 RVTRMSKIMISKKFSILFRPLLLNSKCFSSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            ++ R+S+  +S+  ++L R L       S+   P  Q + +V + K+FINNEW D+VS KTFPT NP+TGQ I +VAEG K DID+AV AA++AF+LGSPWR+MDA+ RG L+ +LA L+ RD  YLA+LE+LD+GKP + +  ADVEL+IKCY YYAGWA+KNHGK IPI G+   FTRHEPVGVCGQIIPWNFPLLMQAWKL PALSMGNTVV+KTAEQTPLT NY+A L  EAGFPPGVVN+V G GPTAGAAL  H  VDKIAFTGSTEVG++I ++  ++N+KR+TLELGGKSPN++FADAD + AV+ S+FALFFN GQCC AGSR +VEE IYDKFVE  V  AK + VG+PFD N +QGPQID EQM+KIL  IDSGKS+GA++ TGG + G  GFF++PT+F+ V+D MRIA+EEIFGPVMQI+KFK T+E++ RAN   YGLAA +FT+D+DK++HV Q LRAGTVW+N YD FDA APFGG+K SG GRELGEYGL  YTEVK VT++ P KNS
Sbjct:    3 QLARISRKSLSQTPAVLLRSL-----SSSAPQVPQPQRNPEVKFNKLFINNEWVDAVSGKTFPTVNPSTGQVIAEVAEGDKADIDRAVVAASEAFRLGSPWRRMDASGRGVLLNRLADLMERDKVYLASLESLDNGKPYTNSFLADVELSIKCYRYYAGWANKNHGKTIPIDGEGFCFTRHEPVGVCGQIIPWNFPLLMQAWKLGPALSMGNTVVMKTAEQTPLTGNYIAQLTKEAGFPPGVVNIVSGFGPTAGAALAKHNDVDKIAFTGSTEVGRLIPQYAGQSNLKRITLELGGKSPNVIFADADLEYAVEKSHFALFFNQGQCCTAGSRTFVEESIYDKFVEMSVERAKKRSVGDPFDFNTEQGPQIDNEQMSKILELIDSGKSQGAKLLTGGGRHGDAGFFVQPTVFSDVKDEMRIAQEEIFGPVMQILKFKSTDELLERANRTMYGLAAGVFTRDLDKAMHVMQGLRAGTVWINDYDYFDAGAPFGGFKMSGSGRELGEYGLQAYTEVKTVTMRVPQKNS 522          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. TrEMBL
Match: A0A1S3FPT5 (aldehyde dehydrogenase, mitochondrial OS=Dipodomys ordii OX=10020 GN=Aldh2 PE=3 SV=1)

HSP 1 Score: 694.501 bits (1791), Expect = 0.000e+0
Identity = 339/507 (66.86%), Postives = 408/507 (80.47%), Query Frame = 2
Query:  125 RPLLLNSKCFSSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFDN-VDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            RP L +    +S A P      +V Y +IFINNEWHD+VSKKTFPT NP+TG+ ICQVAEG KED+DKAV AA  AFQLGSPWR+MDA+DRG L+Y+LA LI RD  YLAALETLD+GKP  I+   D+++ +KC  YYAGWADK HGK IPI GD+  +TRHEPVGVCGQIIPWNFPLLMQAWKL PAL+ GN VV+K AEQTPLTA YVA+L  EAGFPPGVVN+VPG GPTAGAA+ +H  VDK+AFTGSTEVG +I      +N+KR+TLELGGKSPNI+ +DAD D AV+ ++FALFFN GQCCCAGSR +V+E +Y +FVE  VA AKS+VVGNPFD+  +QGPQ+DE Q +KILG+I SGK EGA++  GG     +G+FI+PT+F  V+D M IAKEEIFGPVMQI+KFK   EV+ARANN++YGLAA++FT+D+DK+ +++Q+L+AGTVW+NCYDVF A +PFGGYK SG GRELGEYGL  YTEVK VTIK P KNS
Sbjct:   15 RPGLRSLSAAASQAVPAPNQQPEVFYNQIFINNEWHDAVSKKTFPTVNPSTGEAICQVAEGNKEDVDKAVKAARAAFQLGSPWRRMDASDRGRLLYRLADLIERDRTYLAALETLDNGKPYIISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQTASGSSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYAEFVERSVARAKSRVVGNPFDSRTEQGPQVDETQFHKILGYIKSGKQEGAKLLCGGGAAADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVARANNSKYGLAAAVFTKDLDKASYLSQALQAGTVWINCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTIKVPQKNS 521          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Cavefish
Match: aldh2.2 (aldehyde dehydrogenase 2 family member [Source:NCBI gene;Acc:103036383])

HSP 1 Score: 661.759 bits (1706), Expect = 0.000e+0
Identity = 322/521 (61.80%), Postives = 402/521 (77.16%), Query Frame = 2
Query:   83 MSKIMISKKFSILFRPLLLNSKCFSSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            M +  +++   +L     L +  +S+ A P       VHY K+FINNEWHD++SKKTFPT NP+TG+ IC+VAEG K D+DKAV AA  AF+LGSPWR+MDA+ RG L+ +LA  + RDA YLA LETLD+GKP S+A + DV + +KC  YYAGWADK  GK +PI GD+  +TRHEPVGVCGQIIPWNFPLLMQAWKL PAL+ GNT+V+K AEQTPLTA YVASL  E GFPPGVVN++ G+G TAGAA+ +H  VDKIAFTGSTEVG II +    +N+K++TLELGGKSPNI+ +DA+ + AV+ ++ A+FFNMGQCC AGSR YV+E IY++FVE  V  AK +VVGNPFD   DQGPQ+D+EQ  KILG+I SGK EGA++  GG     +G+FI+PT+F +V+D M+IA+EEIFGPVMQI+KFK   EVI RAN+  YGLAA++ T DI+K+ +++ SLRAGTVW+NCY+VF   APFGGYK+SG GRE+GEYGL  YTEVK VT K P KNS
Sbjct:    1 MLRAALTRACPLLPAAPRLAACRYSAAAIPAPNPQPDVHYNKLFINNEWHDALSKKTFPTINPSTGEVICEVAEGDKADVDKAVKAARDAFRLGSPWRRMDASRRGVLLNRLADAVERDAGYLAELETLDNGKPFSVAYSVDVPMVVKCLRYYAGWADKWEGKTVPIDGDFFCYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNTIVMKVAEQTPLTALYVASLIKEVGFPPGVVNIISGLGHTAGAAISSHMDVDKIAFTGSTEVGHIIQQAAGASNLKKVTLELGGKSPNIILSDANMEEAVEQAHMAIFFNMGQCCSAGSRTYVQESIYNEFVERSVERAKKRVVGNPFDLKTDQGPQVDDEQFKKILGYISSGKKEGAKLMYGGGVAADRGYFIQPTVFGEVQDDMKIAREEIFGPVMQILKFKTIEEVIERANDTNYGLAAAVCTTDINKAHYISNSLRAGTVWINCYNVFGVQAPFGGYKASGTGREMGEYGLEAYTEVKTVTTKIPQKNS 521          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Cavefish
Match: aldh2.2 (aldehyde dehydrogenase 2 family member [Source:NCBI gene;Acc:103036383])

HSP 1 Score: 650.203 bits (1676), Expect = 0.000e+0
Identity = 316/513 (61.60%), Postives = 397/513 (77.39%), Query Frame = 2
Query:   83 MSKIMISKKFSILFRPLLLNSKCFSSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVT 1618
            M +  +++   +L     L +  +S+ A P       VHY K+FINNEWHD++SKKTFPT NP+TG+ IC+VAEG K D+DKAV AA  AF+LGSPWR+MDA+ RG L+ +LA  + RDA YLA LETLD+GKP S+A + DV + +KC  YYAGWADK  GK +PI GD+  +TRHEPVGVCGQIIPWNFPLLMQAWKL PAL+ GNT+V+K AEQTPLTA YVASL  E GFPPGVVN++ G+G TAGAA+ +H  VDKIAFTGSTEVG II +    +N+K++TLELGGKSPNI+ +DA+ + AV+ ++ A+FFNMGQCC AGSR YV+E IY++FVE  V  AK +VVGNPFD   DQGPQ+D+EQ  KILG+I SGK EGA++  GG     +G+FI+PT+F +V+D M+IA+EEIFGPVMQI+KFK   EVI RAN+  YGLAA++ T DI+K+ +++ SLRAGTVW+NCY+VF   APFGGYK+SG GRE+GEYGL  YTEVK V+
Sbjct:    1 MLRAALTRACPLLPAAPRLAACRYSAAAIPAPNPQPDVHYNKLFINNEWHDALSKKTFPTINPSTGEVICEVAEGDKADVDKAVKAARDAFRLGSPWRRMDASRRGVLLNRLADAVERDAGYLAELETLDNGKPFSVAYSVDVPMVVKCLRYYAGWADKWEGKTVPIDGDFFCYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNTIVMKVAEQTPLTALYVASLIKEVGFPPGVVNIISGLGHTAGAAISSHMDVDKIAFTGSTEVGHIIQQAAGASNLKKVTLELGGKSPNIILSDANMEEAVEQAHMAIFFNMGQCCSAGSRTYVQESIYNEFVERSVERAKKRVVGNPFDLKTDQGPQVDDEQFKKILGYISSGKKEGAKLMYGGGVAADRGYFIQPTVFGEVQDDMKIAREEIFGPVMQILKFKTIEEVIERANDTNYGLAAAVCTTDINKAHYISNSLRAGTVWINCYNVFGVQAPFGGYKASGTGREMGEYGLEAYTEVKTVS 513          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Cavefish
Match: aldh1a2 (aldehyde dehydrogenase 1 family member A2 [Source:NCBI gene;Acc:103042804])

HSP 1 Score: 607.831 bits (1566), Expect = 0.000e+0
Identity = 299/488 (61.27%), Postives = 373/488 (76.43%), Query Frame = 2
Query:  170 PITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTP 1630
            P+T  +IK  +TKIFINNEWHDS+S KTF T NPATG+ IC V E  K D+DKAV AA  AF L S WR+MD++DRG L+ KLA L+ RD  YLA LE+LD+GKP   +   D++ TIK   Y+AGWADK HG  IP  G Y+ FTRHEP+GVCGQIIPWNFPL+M AWKL PAL  GNTVV+K AEQTPLT  Y+ SL  EAGFPPGVVN++PG GPTAGA + +H  +DK+AFTGST+VG++I +   ++N+KR+TLELGGK+PNI+FADAD D AV+ ++  +FFN GQCC AGSRI+VEE IYD+FV   V  AK ++VG+PFD   +QGPQI  EQ  ++L F++SG SEGA++  GGK   SKGF+I+PT+F+ V+D MRIA+EEIFGPV QIMKFK   EVI RANN EYGL A++FT DI K++ ++ +L+AGTVW+NC++      PFGG+K SG GRELGEYGL  YTEVK +T+K P
Sbjct:   30 PLTNPEIK--HTKIFINNEWHDSLSGKTFSTYNPATGEKICDVQEADKADVDKAVKAARSAFSLSSEWRRMDSSDRGRLLSKLADLVERDRLYLATLESLDTGKPFLSSFFVDLQGTIKTLRYFAGWADKIHGTSIPTDGGYLSFTRHEPIGVCGQIIPWNFPLMMMAWKLGPALCCGNTVVMKPAEQTPLTCLYMGSLIKEAGFPPGVVNILPGFGPTAGAGIASHMGIDKVAFTGSTKVGKLIQEAAGKSNLKRVTLELGGKNPNIIFADADLDLAVEQAHQGVFFNSGQCCTAGSRIFVEESIYDEFVSRSVERAKRRIVGSPFDPTTEQGPQISAEQQRRVLEFVESGISEGAKLECGGKAHFSKGFYIQPTVFSNVQDHMRIAREEIFGPVQQIMKFKTMEEVIERANNTEYGLTAAVFTNDISKAMAISTALQAGTVWINCFNALSCQCPFGGFKMSGNGRELGEYGLREYTEVKTITVKMP 515          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Cavefish
Match: aldh1a2 (aldehyde dehydrogenase 1 family member A2 [Source:NCBI gene;Acc:103042804])

HSP 1 Score: 577.785 bits (1488), Expect = 0.000e+0
Identity = 286/469 (60.98%), Postives = 358/469 (76.33%), Query Frame = 2
Query:  170 PITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGREL 1573
            P+T  +IK  +TKIFINNEWHDS+S KTF T NPATG+ IC V E  K D+DKAV AA  AF L S WR+MD++DRG L+ KLA L+ RD  YLA LE+LD+GKP   +   D++ TIK   Y+AGWADK HG  IP  G Y+ FTRHEP+GVCGQIIPWNFPL+M AWKL PAL  GNTVV+K AEQTPLT  Y+ SL  EAGFPPGVVN++PG GPTAGA + +H  +DK+AFTGST+VG++I +   ++N+KR+TLELGGK+PNI+FADAD D AV+ ++  +FFN GQCC AGSRI+VEE IYD+FV   V  AK ++VG+PFD   +QGPQI  EQ  ++L F++SG SEGA++  GGK   SKGF+I+PT+F+ V+D MRIA+EEIFGPV QIMKFK   EVI RANN EYGL A++FT DI K++ ++ +L+AGTVW+NC++      PFGG+K SG GREL
Sbjct:   30 PLTNPEIK--HTKIFINNEWHDSLSGKTFSTYNPATGEKICDVQEADKADVDKAVKAARSAFSLSSEWRRMDSSDRGRLLSKLADLVERDRLYLATLESLDTGKPFLSSFFVDLQGTIKTLRYFAGWADKIHGTSIPTDGGYLSFTRHEPIGVCGQIIPWNFPLMMMAWKLGPALCCGNTVVMKPAEQTPLTCLYMGSLIKEAGFPPGVVNILPGFGPTAGAGIASHMGIDKVAFTGSTKVGKLIQEAAGKSNLKRVTLELGGKNPNIIFADADLDLAVEQAHQGVFFNSGQCCTAGSRIFVEESIYDEFVSRSVERAKRRIVGSPFDPTTEQGPQISAEQQRRVLEFVESGISEGAKLECGGKAHFSKGFYIQPTVFSNVQDHMRIAREEIFGPVQQIMKFKTMEEVIERANNTEYGLTAAVFTNDISKAMAISTALQAGTVWINCFNALSCQCPFGGFKMSGNGREL 496          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Cavefish
Match: aldh1a3 (aldehyde dehydrogenase 1 family member A3 [Source:NCBI gene;Acc:103032207])

HSP 1 Score: 557.755 bits (1436), Expect = 0.000e+0
Identity = 281/489 (57.46%), Postives = 357/489 (73.01%), Query Frame = 2
Query:  161 LAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIK 1624
            L +P    DIK  +TK+FINNEWH S   KT P  NPATG  IC+V E  K D+D AV AA  A + GS WR+MD + RG L++KLA+L+ RD   LA +E++DSGKP   +   D+E +IK   YYAGWADK HGK +P+  +++ FT+HEPVGVCG IIPWNFPLLM  WK+APAL  GNTVV+K +E TPLTA +V +L  EAGFPPGVVN+VPG GPT+GAA+ +H  +DK+AFTGS EVGQ+I +   ++N+KR+TLELGGK+P IVF D+D   AV+ +    F+N GQCC A SR++VEE++YD+FV   V  AK  V G+P D     GPQI+++Q  KIL  ++SGK EGA++  GG  +  KG FI+PTIF+ V+D MR+AKEEIFGPV  IMKFK   EVI RAN+  YGLAA++FT+ +D+++ V+ +L AGTVWVNCY+   A APFGGYK SG GRELGEY L+ YTEVK VTIK
Sbjct:   20 LPQPCRITDIK--HTKLFINNEWHSSAKGKTIPIFNPATGDKICEVEEADKADVDVAVEAARAAMKRGSAWRRMDVSGRGRLLHKLAELLERDRTLLATMESMDSGKPFLQSFFIDLEGSIKTLRYYAGWADKIHGKTMPVDDNFMCFTKHEPVGVCGAIIPWNFPLLMFTWKIAPALCCGNTVVIKPSELTPLTALHVGALIKEAGFPPGVVNIVPGFGPTSGAAIASHMGIDKVAFTGSVEVGQLIKEAAAKSNLKRVTLELGGKNPCIVFGDSDLQLAVQEAQKGAFYNQGQCCTAASRVFVEERVYDEFVRLSVESAKKIVAGDPMDPRTSHGPQINQQQFEKILDLVESGKREGAKLECGGHALQDKGLFIQPTIFSDVKDHMRLAKEEIFGPVQCIMKFKSQEEVIERANSTHYGLAAAVFTRSVDRAMSVSSALEAGTVWVNCYNALHAQAPFGGYKMSGNGRELGEYALAEYTEVKAVTIK 506          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Sea Lamprey
Match: aldh1l2 (aldehyde dehydrogenase 1 family, member L2 [Source:ZFIN;Acc:ZDB-GENE-100426-6])

HSP 1 Score: 416.772 bits (1070), Expect = 2.962e-136
Identity = 227/481 (47.19%), Postives = 317/481 (65.90%), Query Frame = 2
Query:  206 KIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIR----GDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXT-AGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFK--DTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIK 1624
            + FI+ ++ D+ + KT+ T NP  G  IC+VA     D+D+AV AA +AF+ G  W +M+  DRG L+YKLA L+    + LA +ETLDSG   ++A    V ++I+ + Y+AGW DK HG  IPI        + FT+ EP+GVCG +IPWN+PL+M AWK A  L+ GNT+VLK A+ TPLTA   A LAA+AGFP GV+N++PG   +  G  +  HP + K+ FTGST +G+ I K C  +N+K+++LELGGKSP I+F D D D AV+    A+FFN G+ C A  R++VEE I+D++V  +V E K   VG+P D + D GPQ     M K++ + + G  EGA +  GG+Q+     F  P++FT VED M IA+EE FGP+M I KF   D + V+ARANN E+GLA+ +FT+DI K+L+V+  L AGTV++N Y+  D AAPFGG+K SG G++LGE  L+ Y   K VT++
Sbjct:  211 QCFIDGKFVDADTSKTYDTVNPTDGSVICKVAFASVADVDEAVAAAKRAFESGE-WGRMNPRDRGRLLYKLADLMEEHQEELATIETLDSGAVYTLALKTHVGMSIQTFRYFAGWCDKIHGTTIPINQARPNRNLTFTKREPIGVCGIVIPWNYPLMMLAWKSAACLAAGNTLVLKPAQVTPLTALKFAELAAKAGFPKGVINIIPGSVGSIVGQRMSEHPHIRKLGFTGSTPIGKQIMKSCATSNLKKVSLELGGKSPLIIFNDCDIDKAVRMGMSAVFFNKGENCIAAGRLFVEESIHDEYVRRVVEEIKKMKVGDPLDRSTDHGPQNHRAHMEKLVEYCEVGVKEGATLVHGGRQVPRPEVFANPSVFTGVEDHMYIAQEESFGPIMVISKFPDGDIDGVLARANNTEFGLASGVFTRDISKALYVSDQLEAGTVFINTYNKTDVAAPFGGFKQSGFGKDLGEEALNEYLRTKAVTVE 690          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004609.1 (pep scaffold:Pmarinus_7.0:GL479321:13801:23388:1 gene:ENSPMAG00000004155.1 transcript:ENSPMAT00000004609.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 311.997 bits (798), Expect = 4.736e-98
Identity = 180/470 (38.30%), Postives = 272/470 (57.87%), Query Frame = 2
Query:  236 SVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNP-FDNVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSK------GFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIK 1624
            S     F   NPATG  +C+    G  D+  AV  A +AF+ GS WR +  ++R   + + + +I+   + LA +E  D+GKPV  AR  DV+   +C EY+AG A    G+ I + G    ++R EP+GVC  I  WNFP  +  WK APAL+ GN +V K +  TPLTA  +A +  EAG PPG+ N+V G G T G  L +H  V K++ TGS   G  + +      IK +TLELGGKSP IVF+D D DNAVK +    F + GQ C   +R++V+  + ++F+E ++    +  +G+P  D+   G  I +  ++++L ++     EGA++  GGK+   +      GFF+ P +  +  D M+  +EEIFGPVM ++ F    EV+ RAN  ++GLAA +FT+D+ ++  V  +L+AG+ ++N Y+V     PFGGYK SG GRE G   +  YT++K V ++
Sbjct:   53 STGGPEFDVVNPATGGLLCRGQASGAVDVQAAVKDAREAFE-GS-WRGLSGSERSQHLLRASAIIKERREELAVMEVKDTGKPVYEARM-DVDSGWQCLEYFAGLAPTIAGQHIQLPGGSFMYSRREPLGVCVGIGAWNFPFQIACWKSAPALACGNAMVFKPSPLTPLTAVALAEIYTEAGLPPGLFNIVQGDGET-GQLLCSHNDVAKVSCTGSVGTGVKVLQQ-TAPRIKPVTLELGGKSPLIVFSDCDLDNAVKAALMGNFLSQGQVCSNATRVFVQRSVCERFLERLLDRVSAIRIGDPQRDSTTMGALISQSHLDRVLAYVQRAVQEGAKLVCGGKKYVPEDPSLKGGFFMTPCVLAECRDDMQAVREEIFGPVMAVLAFDTEEEVLQRANATDFGLAAGVFTKDLTRAHRVIAALQAGSCYINNYNVVLMEMPFGGYKMSGFGRENGMATVDYYTQLKTVYVE 517          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Sea Lamprey
Match: aldh8a1 (aldehyde dehydrogenase 8 family, member A1 [Source:NCBI gene;Acc:447801])

HSP 1 Score: 268.47 bits (685), Expect = 4.196e-82
Identity = 182/487 (37.37%), Postives = 268/487 (55.03%), Query Frame = 2
Query:  212 FINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIG---FTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIIS----KHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNM-GQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGG-------KQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIK 1624
            +IN E+    S+    +  P+TG   C+V + G+ +++ AV AA +AF     W      +RG ++ +LA+LI    + LA  E+ D GK V  AR  D+      + ++A  +   H      + D++G   +T   PVGV G I PWN PL +  WK+APA+++GNTVV K +E T +TA  +  L  EAG PPGVVNVV G G  AGAALV HP V  I+FTGST     I+     HC     KRL+LELGGK+P ++FADAD D  V T+  + F N  G    + S I+    +  +         K+  VG P D   + GP I +E + K+ G+++  + +G Q+  G              G+F+ PT+ T V D     +EEIFGPV+ +  F+D +E + R+N   YGLAA ++++D+ +   V + L+AG VW NC+ + +   PFGG K+SG+GRE  +     +T+VK +TIK
Sbjct:   13 YINGEF--VASETHVDSFEPSTGNVYCRVPDSGEAEVNAAVEAAKRAFPA---WAARSPQERGRILTRLAELIESRLEELAIAESHDQGKTVEHARTVDIPRAAYNFRFFA--SAVQHYTTECTQADHVGCMHYTVRSPVGVVGLISPWNLPLYLLTWKIAPAIALGNTVVAKPSELTSVTAWMLCMLLREAGVPPGVVNVVLGTGQKAGAALVGHPDVPAISFTGSTATACDITVRSALHC-----KRLSLELGGKNPAVIFADADLDACVATTVRSSFANQTGHVPSSLSAIF-SHSVVVQCPRRFFRTTKAWKVGPPDDFTSNMGPLISKEHLAKVRGYVELAERDGGQVLCGEGVDPLLLPPRCQGGYFLAPTVITGVPDDSPAMQEEIFGPVVCVSPFEDEDEAVTRSNGVRYGLAAVVWSRDVARVHRVAKRLQAGIVWTNCWLIRELNLPFGGMKASGIGREGAKDSFEFFTDVKTITIK 486          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Sea Lamprey
Match: aldh5a1 (aldehyde dehydrogenase 5 family, member A1 (succinate-semialdehyde dehydrogenase) [Source:ZFIN;Acc:ZDB-GENE-070228-2])

HSP 1 Score: 237.654 bits (605), Expect = 2.772e-71
Identity = 150/416 (36.06%), Postives = 223/416 (53.61%), Query Frame = 2
Query:  392 DRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRG-DYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXX---XXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFDNVDQ--GPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTI 1621
            +RG+L+ +  ++I ++   LA L T +SGKP       +V       E++   A + +G++IP    D   F+ ++PVGV   I PWNFP+ M   K+  AL+ G T V+K AE TPL+A  +A LA EAG       VV          G  L THP V KI+FTGST  G+++  H     +KR+++ELGG +P IVF  AD D AV+    + F   GQ C   +R+ V+E ++D FV  +     +++   P  +     GP I+E  + K+   +    S+GA++  GG +    G F +PT+   V  +M  A+EE FGP+  I+KFK   E IA AN+   GLA   F++D+ +   V+++L  G V  N   +    APFGG K SG+GRE  + G+  Y  VK V +
Sbjct:    2 ERGALLKRWYEVILQNRQELAQLITAESGKPQQ-ESLGEVSYGAAFLEWFGEEARRAYGQIIPSAAPDRRMFSMYQPVGVAAMITPWNFPVAMITRKVGAALAAGCTAVVKPAEDTPLSALALAQLAVEAGLPPGVLNVVPCSRANVAAVGELLCTHPSVSKISFTGSTATGKVLMAHAV-GTVKRVSMELGGHAPFIVFESADLDAAVRGLLSSKFRFSGQTCVCPNRMLVQESVHDAFVSRLAHAVSTQLRVGPGADTGNTLGPLINEHALEKVERHVVDAVSQGARVVVGGARHALGGSFFQPTVLADVTPNMLCAREETFGPLAPIIKFKTEEEAIALANSTAMGLAGYFFSRDVAQVWRVSEALEVGMVGANEGLLSAVEAPFGGIKQSGLGREGAQQGMLEYMHVKYVCL 415          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002659.1 (pep scaffold:Pmarinus_7.0:GL481598:469:3326:1 gene:ENSPMAG00000002422.1 transcript:ENSPMAT00000002659.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 191.045 bits (484), Expect = 2.254e-57
Identity = 85/158 (53.80%), Postives = 116/158 (73.42%), Query Frame = 2
Query: 1169 PQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            PQIDE+Q +KIL  + S   EGA +  GG     +GF+++PT+F+ V DS RI +EEIFGPV  IM+F    +V+ARAN + YGL  ++FT+D++++L V+ +++AGTVW+NCY+  +A +PFGGYK SG GRE+GEYGL  YTEVK VTIK   KNS
Sbjct:    1 PQIDEKQRSKILELVQSALEEGAHLECGGVACEGRGFYVQPTVFSDVPDSARITREEIFGPVQLIMRFDSLEDVVARANASPYGLVGAVFTRDLERALAVSAAMQAGTVWINCYNAMNAQSPFGGYKMSGNGREMGEYGLQEYTEVKTVTIKISQKNS 158          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Yeast
Match: ALD4 (Mitochondrial aldehyde dehydrogenase; required for growth on ethanol and conversion of acetaldehyde to acetate; phosphorylated; activity is K+ dependent; utilizes NADP+ or NAD+ equally as coenzymes; expression is glucose repressed; can substitute for cytosolic NADP-dependent aldehyde dehydrogenase when directed to the cytosol; human homolog ALDH2 can complement yeast ald4 mutant [Source:SGD;Acc:S000005901])

HSP 1 Score: 479.945 bits (1234), Expect = 2.290e-163
Identity = 247/475 (52.00%), Postives = 338/475 (71.16%), Query Frame = 2
Query:  203 TKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIK 1624
            T +FINN++  S   KTF   NP+T ++IC + EG ++D+++AV AA++AF  GS W  +D  DRG  +Y+LA+LI +D D +A++ETLD+GK +S +R  DV+L I   +  AG+ADK  G++I     +  +T+ +P+GVCGQIIPWNFPLLM AWK+APAL  GNTVVLKTAE TPL+A YV+    +AG PPGV+N+V G G   G A+  HPK+ K+AFTGST  G+ I +      +K++TLELGGKSPNIVFADA+   AV+     +++N G+ CCAGSR+YVEE IYDKF+E   A ++S  VG+PFD +  QG Q  + Q+NKIL ++D GK+EGA + TGG+++GSKG+FI+PT+F  V++ MRI KEEIFGPV+ + KFK  +EVI  AN++EYGLAA I T +I+ +L V   + AGTVW+N Y+ F  A PFGG+ +SG+GRE+    L NY +VK V  K
Sbjct:   45 TGLFINNKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGS-WNGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRG-DVDLVINYLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAWKIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKIVGEAITNHPKIKKVAFTGSTATGRHIYQSAAAG-LKKVTLELGGKSPNIVFADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASESIKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKGYFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLAAGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMSVDALQNYLQVKAVRAK 516          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Yeast
Match: ALD5 (Mitochondrial aldehyde dehydrogenase; involved in regulation or biosynthesis of electron transport chain components and acetate formation; activated by K+; utilizes NADP+ as the preferred coenzyme; constitutively expressed [Source:SGD;Acc:S000000875])

HSP 1 Score: 449.899 bits (1156), Expect = 1.358e-151
Identity = 241/507 (47.53%), Postives = 339/507 (66.86%), Query Frame = 2
Query:  140 NSKCFS-SLAKPITQNDIKV-----------HYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFDN-VDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTI 1621
            NS+ F+ SL +  +Q  ++V             T +FIN E+  S  KKTF   NP+  + I  V +  ++D+D+AV AA KAF+  + W  ++   R   ++ LA L+ +  + LAA+E++D+GK +  AR  DV L  K      GWADK +G VI    ++  ++  EP+GVCGQIIPWNFPLLM +WK+ PAL+ GNTVVLK AE TPL+A + + L  EAG P GVVN++PG G   G  L  HP V KIAFTGST  G+ I K    + +K++TLELGGKSPNIVFADAD D AVK   F +F+N G+ CCAGSRIY+++ +Y++ ++ +    +S  VG+PFD  V QG Q  ++Q++KIL ++D  KSEGA++ TGG + GSKG+F++PT+F  V++ MRI KEE+FGP++ + KF   +EVIA AN+++YGLAA I T DI+K++ V++ ++AGTVW+N Y+ F    PFGG+  SG+GRE+GE  LSNYT+ K V I
Sbjct:   11 NSRIFTRSLLRLYSQAPLRVPITLPNGFTYEQPTGLFINGEFVASKQKKTFDVINPSNEEKITTVYKAMEDDVDEAVAAAKKAFE--TKWSIVEPEVRAKALFNLADLVEKHQETLAAIESMDNGKSLFCARG-DVALVSKYLRSCGGWADKIYGNVIDTGKNHFTYSIKEPLGVCGQIIPWNFPLLMWSWKIGPALATGNTVVLKPAETTPLSALFASQLCQEAGIPAGVVNILPGSGRVVGERLSAHPDVKKIAFTGSTATGRHIMK-VAADTVKKVTLELGGKSPNIVFADADLDKAVKNIAFGIFYNSGEVCCAGSRIYIQDTVYEEVLQKLKDYTESLKVGDPFDEEVFQGAQTSDKQLHKILDYVDVAKSEGARLVTGGARHGSKGYFVKPTVFADVKEDMRIVKEEVFGPIVTVSKFSTVDEVIAMANDSQYGLAAGIHTNDINKAVDVSKRVKAGTVWINTYNNFHQNVPFGGFGQSGIGREMGEAALSNYTQTKSVRI 513          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Yeast
Match: ALD6 (Cytosolic aldehyde dehydrogenase; activated by Mg2+ and utilizes NADP+ as the preferred coenzyme; required for conversion of acetaldehyde to acetate; constitutively expressed; locates to the mitochondrial outer surface upon oxidative stress [Source:SGD;Acc:S000005982])

HSP 1 Score: 429.869 bits (1104), Expect = 3.653e-144
Identity = 224/476 (47.06%), Postives = 318/476 (66.81%), Query Frame = 2
Query:  203 TKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKV-VGNPFDNVD-QGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIK 1624
            T +FINN++  +   KT+P ++P+T   +C+V+    ED++ A+  A++AF   + W   D  +RG L+ KLA  +    D ++++E LD+GK +++AR  DV + I C    A +ADK +G+ I     Y+ FT  EP+GVCGQIIPWNFP++M AWK+APAL+MGN  +LK A  TPL A Y ASL  + G P GVVN+VPG G T GAAL   P++ K+AFTGSTEVG+ ++   +E+N+K++TLELGGKS ++VF DA+    +      +F N GQ C +GSRIYV+E IYD+ + A  A  ++++ VGNPFD  + QG   + +Q + I+ +ID GK EGA++ TGG+++G KG+FI PT+F  V + MRI KEEIFGPV+ + KFK   E +  AN++E+GL + I T+ +   L V + L+AGTVW+N Y+ FD+  PFGG K SG GRE+GE     YTEVK V IK
Sbjct:   26 TGLFINNKFMKAQDGKTYPVEDPSTENTVCEVSSATTEDVEYAIECADRAFH-DTEWATQDPRERGRLLSKLADELESQIDLVSSIEALDNGKTLALARG-DVTIAINCLRDAAAYADKVNGRTINTGDGYMNFTTLEPIGVCGQIIPWNFPIMMLAWKIAPALAMGNVCILKPAAVTPLNALYFASLCKKVGIPAGVVNIVPGPGRTVGAALTNDPRIRKLAFTGSTEVGKSVAVDSSESNLKKITLELGGKSAHLVFDDANIKKTLPNLVNGIFKNAGQICSSGSRIYVQEGIYDELLAAFKAYLETEIKVGNPFDKANFQGAITNRQQFDTIMNYIDIGKKEGAKILTGGEKVGDKGYFIRPTVFYDVNEDMRIVKEEIFGPVVTVAKFKTLEEGVEMANSSEFGLGSGIETESLSTGLKVAKMLKAGTVWINTYNDFDSRVPFGGVKQSGYGREMGEEVYHAYTEVKAVRIK 499          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Yeast
Match: ALD2 (Cytoplasmic aldehyde dehydrogenase; involved in ethanol oxidation and beta-alanine biosynthesis; uses NAD+ as the preferred coenzyme; expression is stress induced and glucose repressed; very similar to Ald3p [Source:SGD;Acc:S000004780])

HSP 1 Score: 365.925 bits (938), Expect = 3.061e-119
Identity = 216/501 (43.11%), Postives = 299/501 (59.68%), Query Frame = 2
Query:  170 PITQNDIKVHYTKI--------FINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADK-NHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKV-VGNPFDNVDQ----GPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQI---GSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTI 1621
            P    DI++   KI        FINNE+  S   KT  T NPATG+ I       ++D+DKAV AA  AF   + W K  +  RG  +  L +LI  + D LAALETLD+GKP       D+   ++   Y+AG ADK + G  IP+  +   +T   P GV  QI+PWN+PL M  WKL  AL+ GNTV++K AE T L+  Y A+L  +AGFPPGVVN+VPG G   G AL +H  +DKI+FTGST+VG  + +   ++N+K +TLE GGKSP +VF DAD D A+      +F+N GQ C A SR+YV+  IYDKFVE     AK +  V   FD  D+    GP I   Q ++I  +I+ GK E         +    G+KG+FI PTIFT V  + ++ ++EIFGPV+ + KF + ++ +  AN+  YGLA+++FT+D+ K+    + ++AGTVW+N  +  D   PFGG+K SG+GRELG+ G+  Y + K V I
Sbjct:    2 PTLYTDIEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQAANEKDVDKAVKAARAAFD--NVWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPYHSNAKGDLAQILQLTRYFAGSADKFDKGATIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACWKLQGALAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNIVPGYGSLVGQALASHMDIDKISFTGSTKVGGFVLEASGQSNLKDVTLECGGKSPALVFEDADLDKAIDWIAAGIFYNSGQNCTANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIERGKREEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPQTSKLLQDEIFGPVVVVSKFTNYDDALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINSSNDEDVTVPFGGFKMSGIGRELGQSGVDTYLQTKAVHI 500          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Yeast
Match: ALD3 (Cytoplasmic aldehyde dehydrogenase; involved in beta-alanine synthesis; uses NAD+ as the preferred coenzyme; very similar to Ald2p; expression is induced by stress and repressed by glucose [Source:SGD;Acc:S000004779])

HSP 1 Score: 364.77 bits (935), Expect = 8.013e-119
Identity = 217/501 (43.31%), Postives = 302/501 (60.28%), Query Frame = 2
Query:  170 PITQNDIKVHYTKI--------FINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADK-NHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKV-VGNPFDNVDQ----GPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQI---GSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTI 1621
            P    DI++   KI        FINNE+  S   KT  T NPATG+ I       ++D+DKAV AA  AF   + W K  +  RG  +  L +LI  + D LAALETLD+GKP       D+   I+   YYAG  DK N G+ IP+  +   +T   P GV  QI+PWN+PL M   K+  AL+ GNTV++K AE T L+  Y A+L  +AGFPPGVVNV+PG G   G AL TH  +DKI+FTGST+VG  + +   ++N+K +TLE GGKSP +VF DAD D A++     +FFN GQ C A SR+YV+  IYDKFVE     AK +  V   FD  D+    GP I   Q ++I  +I+ GK E         +    G+KG+FI PTIFT V ++ ++ ++EIFGPV+ + KF + ++ +  AN+  YGLA+++FT+D+ K+    + ++AGTVW+N  +  +A  PFGG+K SG+GRE G+ G+ NY ++K V +
Sbjct:    2 PTLYTDIEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQAANEKDVDKAVKAARAAFD--NVWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLAQIIELTRYYAGAVDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGALAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDKISFTGSTKVGGSVLEASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQICTANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIERGKKEEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDDALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIGRESGDTGVDNYLQIKSVHV 500          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Nematostella
Match: EDO47653 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLS5])

HSP 1 Score: 645.195 bits (1663), Expect = 0.000e+0
Identity = 318/494 (64.37%), Postives = 386/494 (78.14%), Query Frame = 2
Query:  164 AKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            A+    ++ ++ Y ++FINN++ +SVS KTF T NP+TG+ IC VAEG K D+D AV AA  AF+LGSPWR MDA+DRG L+ +LA LI RD  YLA+LETLD+GKP + +   D+E TIKCY YYAGWADK HGK IP+ G +  +TRHEPVGV GQ+IPWNFPLLMQAWKL PAL+ GNTVV+K AEQTPLTA YVASL AEAGFP GVVN+VPG GPTAG A+ +H  VDKIAFTGSTEVG II +    +N+K +TLELGGKSPNIV AD+D D AV  S+FALFFN GQCCCAGSR +V+E IYD+FVE  V  AK++VVGNPFD    QGPQ+D EQM KIL  I+SG+ EGA++  GG + G KG+FI+PT+F+ V+D+MRIA+EEIFGPVMQI +FKD N++I RAN   YGLA S+ T++++ +L ++ SLR GTVWVNCYD   A APFGGYK SGVGRELGEYGL  Y+EVK VTI  P KN+
Sbjct:   30 AQAAVDDNPEIKYNQVFINNQFVNSVSGKTFQTFNPSTGEVICDVAEGDKHDVDIAVKAAQSAFKLGSPWRTMDASDRGRLLNRLADLIERDKAYLASLETLDNGKPYNDSFNVDLEFTIKCYRYYAGWADKIHGKTIPLDGSFFCYTRHEPVGVVGQVIPWNFPLLMQAWKLGPALACGNTVVMKPAEQTPLTALYVASLIAEAGFPEGVVNIVPGFGPTAGGAIASHMDVDKIAFTGSTEVGHIIQQSAGASNLKNVTLELGGKSPNIVLADSDVDFAVDMSHFALFFNQGQCCCAGSRTFVQEGIYDEFVEKSVQRAKNRVVGNPFDLKTQQGPQVDGEQMTKILNLIESGRKEGAKLEVGGDRAGDKGYFIQPTVFSDVQDNMRIAQEEIFGPVMQIFRFKDMNDIIERANKTTYGLAGSVMTKNLENALMLSNSLRVGTVWVNCYDALSAQAPFGGYKMSGVGRELGEYGLQQYSEVKTVTIAIPQKNT 523          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Nematostella
Match: EDO45538 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSB4])

HSP 1 Score: 596.275 bits (1536), Expect = 0.000e+0
Identity = 304/496 (61.29%), Postives = 377/496 (76.01%), Query Frame = 2
Query:  152 FSSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFDNVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKN 1639
             S   +PI    IK  YTK+FINNE+ D  S K FPT NP TG+ IC ++EG KED+DKAV AA +AF+LGS WR MDA+ RG L+YKLAQLI RD  YLA+LET+DSGK  S +   D++ +  C+ YYAGWADK  GK IP  G Y  +TRHEPVG+ G I PWNFPL M + K+APAL+ GN V+LK AEQTPLTA Y  +L  EAGFP GVVNV+PG GPTAGAA+ TH  +DK++FTGSTEVG++I +   ++N+KRLTLELGGKSPNIVFAD+D D AV+ ++ ALFFN GQCC AGSR +V++ IYD+FV+  V  AK++ VG+PFD+V+QGPQID+EQ +KI+  I+SGK EGA+M  GG + G+KGFFI+PT+F+ V D MRIAKEEIFGPV Q++KFK  +EVI RANN  YGLAA +FT++ID ++ V+  LRAGTVW+NCY+     APFGGYK SG GRE GEYG+  Y EVK VT+K P KN
Sbjct:    1 MSGDVEPIRNPQIK--YTKLFINNEFVDCTSGKVFPTINPTTGEKICDISEGDKEDVDKAVKAAKEAFKLGSAWRTMDASMRGKLLYKLAQLIDRDIAYLASLETIDSGKLFSDS-VGDMQSSANCFRYYAGWADKVTGKTIPADGPYFVYTRHEPVGLVGAITPWNFPLNMASVKIAPALACGNVVILKPAEQTPLTALYFCALVKEAGFPAGVVNVIPGYGPTAGAAITTHLDIDKVSFTGSTEVGRLIQEASAKSNLKRLTLELGGKSPNIVFADSDMDYAVEMAHEALFFNQGQCCSAGSRTFVQDTIYDEFVKKSVKRAKARTVGDPFDSVEQGPQIDQEQFDKIMDLIESGKKEGAKMQCGGARHGNKGFFIQPTVFSDVTDDMRIAKEEIFGPVQQLIKFKSVDEVIERANNTTYGLAAGVFTKNIDTAIAVSSGLRAGTVWINCYECGAPQAPFGGYKMSGYGREWGEYGVLPYCEVKTVTMKVPLKN 493          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Nematostella
Match: EDO36183 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJA5])

HSP 1 Score: 521.931 bits (1343), Expect = 3.183e-180
Identity = 284/495 (57.37%), Postives = 356/495 (71.92%), Query Frame = 2
Query:  161 LAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFDN-VDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            +AKP       V YT++FINNE+ DSVS KTFPT NPAT + IC V+E  K D+D AV AA +AF+LGS WR MDA+ RG  +YKLA L  RDADYLA LE+ D GK ++ A+  DV+  I C+ YYAGWADK  GK IP  G +  +TRHEPVGV G I PWNFPLLM+  KLAPAL+ G  V+LK AEQTPLTA Y+ASL  EAGFP GVVNV+PG GPTAGAA+ +H  +DKI+FTGSTEVG++I +   ++N+KR+TLELGGKSPNIVFADAD D AV+ S   LF N GQCCCAG+RI+VEE I+D+FV   VA AK++VVG+P +    QGPQ+DEEQ NKILG I+SGK +GA++  GG + G+KG+F+EPT+F+ V+D MRIAKEEIFGPVMQI+KF + NEVI RAN+  YGLA ++F++DIDK+L V  S++AGT+W                            G ++   +  VT+K P+KNS
Sbjct:    1 MAKP------DVKYTQLFINNEFVDSVSGKTFPTLNPATEEKICDVSEADKADVDIAVAAAKEAFKLGSVWRTMDASARGHFLYKLADLCERDADYLARLESYDGGKVINEAKI-DVQGMISCFRYYAGWADKVTGKTIPADGPFFTYTRHEPVGVVGAITPWNFPLLMEGLKLAPALACGCVVILKPAEQTPLTALYLASLVKEAGFPTGVVNVLPGYGPTAGAAISSHMGIDKISFTGSTEVGRLIQETAAKSNLKRVTLELGGKSPNIVFADADLDWAVEMSCLGLFINQGQCCCAGTRIFVEESIHDEFVRQCVARAKARVVGDPLEEKTVQGPQVDEEQFNKILGLIESGKQQGAKVECGGGRHGNKGYFVEPTVFSGVQDDMRIAKEEIFGPVMQILKFNEINEVIRRANDTTYGLAGAVFSKDIDKALMVAHSIQAGTMW----------------------------GWASMAFINSVTVKMPTKNS 460          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Nematostella
Match: EDO46151 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQR3])

HSP 1 Score: 417.157 bits (1071), Expect = 5.214e-134
Identity = 226/493 (45.84%), Postives = 313/493 (63.49%), Query Frame = 2
Query:  185 DIKVHYTKI------FINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRG----DYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFDN-VDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTN--EVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIK 1624
            D+ V+Y  I      FIN E+ DS   KTF T NP  G  + QV+    ED+D AV AA +AF  G PW  M+A DR +LM +LA L+ +  + LA +E+LDSG   ++A    V ++I    Y+AGW DK  G  +P+        + +T+ EP+GVCG I+PWN+PL+M AWK++P L+ GNTVVLK A+ TP+TA   A LAA AGFP GV+N++PG G   G  +  HP V K+ FTGST VG+ I + C  +N+K+ +LELGGKSP I+F+D D + AV+    A  FN G+ C A  R++VEE I+D+FV  +V E K   +G+P D   D GPQ  +  ++ ++ ++  G  EGA++  GG+ +   GFF EP +FT VED M IAKEE FGPV+ I KF D +   V+  AN  EYGLA+ +FT+D+ K+L V  +L AGT +VN Y+  D AAPFGG K SG G++LG   L+ Y + K++TI+
Sbjct:  382 DMDVNYMTIHMPHQLFINGEFVDSHHGKTFNTINPTDGTVLAQVSLATHEDVDDAVDAAKEAFYNG-PWGSMNARDRATLMNRLADLMEQHKEELATIESLDSGAVYTLALKTHVGMSIDTVRYFAGWCDKIQGLTVPVNNAKPNRNLCYTKREPIGVCGLIVPWNYPLMMLAWKISPLLAAGNTVVLKPAQVTPMTALKFAELAARAGFPKGVINILPGSGSVVGNRICEHPDVRKLGFTGSTPVGKAIMESCATSNLKKCSLELGGKSPLIIFSDCDMERAVRQGMMACLFNKGENCIAAGRLFVEESIHDEFVNRLVDELKKLKIGDPLDTATDHGPQNHKAHLDSLVEYVKRGVEEGAKLVYGGRHLDRPGFFFEPAVFTNVEDDMFIAKEESFGPVVIISKFDDGDVEGVLESANGTEYGLASGVFTKDMSKALRVADALEAGTCFVNTYNKTDVAAPFGGCKQSGFGKDLGMEALNEYLKTKVITIE 873          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Nematostella
Match: EDO29328 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3Y4])

HSP 1 Score: 334.724 bits (857), Expect = 3.451e-108
Identity = 184/391 (47.06%), Postives = 257/391 (65.73%), Query Frame = 2
Query:  449 LAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADA-DFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFDNVD-QGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKG--FFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVK 1609
            LA L++L+ GKPV  A   DV    + + +YA   DK + +V P   D +     EP+GV G ++PWNFPL + AWKLAPAL+ GN+VVLK AEQ+P +A  +  LA EAG PPGV+NVVPGMG TAG AL  H  VD +AFTGSTEVG+    +  ++N+K++ LE GGKS N+VFAD  D D A + + FA+FFN G+ C A SR+ VE  I+D+FV+ +VA+A+  + G+P +     G  +D  Q  +I+GFID  +S+GA +  GG+++   G   FI+PTIFT V   M++A+EE+FGPV+ ++ F    E +  ANN++YGLAAS++T D++++  V + LRAGTV VN  D  D   PFGG K SG GR+L  +    Y+ +K
Sbjct:    7 LALLDSLNMGKPVMDAYNIDVPGAAQVFSWYAEVLDKRYDEVAPTASDALATITREPLGVIGAVVPWNFPLDLAAWKLAPALAAGNSVVLKPAEQSPFSALRLGQLALEAGLPPGVLNVVPGMGETAGKALGLHMDVDCLAFTGSTEVGKYFMAYAAQSNLKQVWLECGGKSANLVFADCQDLDLAAEKAAFAIFFNQGEVCSANSRLLVERSIHDEFVQCLVAKAQQWLPGDPLNPASGAGAIVDARQAERIMGFIDRAQSQGATLVCGGQRLSINGSDSFIQPTIFTNVSPDMQLAQEEVFGPVLAVIPFDSEEEAVRLANNSQYGLAASLWTDDLNRAHRVAKRLRAGTVSVNTVDALDVCVPFGGCKQSGFGRDLSLHAFDKYSLMK 397          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Medaka
Match: aldh2.2 (aldehyde dehydrogenase 2 family member [Source:NCBI gene;Acc:101172271])

HSP 1 Score: 669.078 bits (1725), Expect = 0.000e+0
Identity = 333/515 (64.66%), Postives = 403/515 (78.25%), Query Frame = 2
Query:  113 SILFR---PLLLNSKC-FSSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            S +FR   PL     C FS+   P+     +VHY K+FINN W D+ S KTFPT NPATG+ ICQVAE  + D++KAV AA+ AF+LGSPWR+MDA+ RG L+ +LA  I RDA YLA LETLD+GKP ++A + D+   +KC  YYAGWADK  GK IPI GDY  +TRHEPVGVCGQIIPWNFPLLMQAWKL PAL+ GNTVV+K AEQTPLTA YVASL  E GFP GVVN++PGMGPTAGAA+  H  VDK+AFTGSTEVG +I +    +N+KR+TLELGGKSPNIV +DA+ ++AV+ S+FALFFN GQCCCAGSR YV+  IYD+FVE  V  AK +VVG+PFD   +QGPQ+D+EQ NKILG+I SGK EGA++  GG     +G+FI+PT+F  V+D+M IA+EEIFGPVMQI KFK   EV+ RAN+++YGLAA++FT+DIDK+ +V+  LRAGTVW+NCYDVF A APFGGYK+SGVGRELG+YGL NYTEVK VTIK P KNS
Sbjct:   53 SAVFRAVTPLSRVLACRFSAAPIPVPNTQPEVHYNKLFINNRWQDAESGKTFPTINPATGEVICQVAEADESDVNKAVKAASDAFRLGSPWRRMDASHRGLLLNRLADAIERDAAYLAELETLDNGKPYAVAYSVDLPNVVKCLRYYAGWADKWEGKTIPIDGDYFCYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNTVVMKVAEQTPLTALYVASLIKEVGFPEGVVNILPGMGPTAGAAIARHMDVDKVAFTGSTEVGHLIQQASGSSNLKRVTLELGGKSPNIVLSDANMEDAVEQSHFALFFNQGQCCCAGSRTYVQADIYDEFVERSVERAKRRVVGDPFDMKTEQGPQVDQEQFNKILGYISSGKREGAKLMCGGGVAADRGYFIQPTVFGDVQDNMTIAREEIFGPVMQIFKFKTLEEVLTRANDSKYGLAAAVFTKDIDKANYVSSGLRAGTVWINCYDVFGAQAPFGGYKASGVGRELGQYGLENYTEVKTVTIKIPQKNS 567          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Medaka
Match: aldh2.2 (aldehyde dehydrogenase 2 family member [Source:NCBI gene;Acc:101172271])

HSP 1 Score: 654.055 bits (1686), Expect = 0.000e+0
Identity = 326/506 (64.43%), Postives = 396/506 (78.26%), Query Frame = 2
Query:  113 SILFR---PLLLNSKC-FSSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMV 1615
            S +FR   PL     C FS+   P+     +VHY K+FINN W D+ S KTFPT NPATG+ ICQVAE  + D++KAV AA+ AF+LGSPWR+MDA+ RG L+ +LA  I RDA YLA LETLD+GKP ++A + D+   +KC  YYAGWADK  GK IPI GDY  +TRHEPVGVCGQIIPWNFPLLMQAWKL PAL+ GNTVV+K AEQTPLTA YVASL  E GFP GVVN++PGMGPTAGAA+  H  VDK+AFTGSTEVG +I +    +N+KR+TLELGGKSPNIV +DA+ ++AV+ S+FALFFN GQCCCAGSR YV+  IYD+FVE  V  AK +VVG+PFD   +QGPQ+D+EQ NKILG+I SGK EGA++  GG     +G+FI+PT+F  V+D+M IA+EEIFGPVMQI KFK   EV+ RAN+++YGLAA++FT+DIDK+ +V+  LRAGTVW+NCYDVF A APFGGYK+SGVGRELG+YGL NYTEVK V
Sbjct:   53 SAVFRAVTPLSRVLACRFSAAPIPVPNTQPEVHYNKLFINNRWQDAESGKTFPTINPATGEVICQVAEADESDVNKAVKAASDAFRLGSPWRRMDASHRGLLLNRLADAIERDAAYLAELETLDNGKPYAVAYSVDLPNVVKCLRYYAGWADKWEGKTIPIDGDYFCYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNTVVMKVAEQTPLTALYVASLIKEVGFPEGVVNILPGMGPTAGAAIARHMDVDKVAFTGSTEVGHLIQQASGSSNLKRVTLELGGKSPNIVLSDANMEDAVEQSHFALFFNQGQCCCAGSRTYVQADIYDEFVERSVERAKRRVVGDPFDMKTEQGPQVDQEQFNKILGYISSGKREGAKLMCGGGVAADRGYFIQPTVFGDVQDNMTIAREEIFGPVMQIFKFKTLEEVLTRANDSKYGLAAAVFTKDIDKANYVSSGLRAGTVWINCYDVFGAQAPFGGYKASGVGRELGQYGLENYTEVKTV 558          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Medaka
Match: aldh1a2 (aldehyde dehydrogenase 1 family member A2 [Source:NCBI gene;Acc:100049450])

HSP 1 Score: 608.216 bits (1567), Expect = 0.000e+0
Identity = 300/495 (60.61%), Postives = 380/495 (76.77%), Query Frame = 2
Query:  161 LAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            +  P+   ++K  YTKIFINNEWH SVS K FP  NPATG+ IC+V E  K D+DKAV AA  AF LGS WR+MDA++RG L+ KLA L+ RD+ YLA +E+L+SGKP       D++ TIK   Y+AG+ADK HG  IP+ G+Y+ FTR+EP+GVCGQIIPWNFPL+M AWKLAPAL+ GNTVVLK +E+TPLT  YVA+L  EAGFPPGVVN++PG GPTAGAA+ +H  +DK+AFTGSTEVG++I +    +N+KR+TLE+GGK+PNI+FADAD D AV+ ++  +FFN GQCC AGSRIYVEE IYD+FV   V  AK ++VG+PFD   +QGPQI  E  N++L +I SG  EGA++  GGK +G KGFFIEPT+F+ V+D MRIAKEEIFGPV QIMKFK   E I RANN++YGL A++FT DI+K++ V+ +++AGTVWVNC++      PFGGYK SG GRELGE GL  Y E+K +T+KT +KNS
Sbjct:   26 MPSPVPNPELK--YTKIFINNEWHVSVSGKVFPVYNPATGEQICEVQEADKADVDKAVQAARLAFSLGSVWRRMDASERGKLLAKLADLVERDSVYLATIESLNSGKPFLPTLFVDLQGTIKTLRYFAGYADKIHGTSIPMDGEYLTFTRYEPIGVCGQIIPWNFPLMMAAWKLAPALACGNTVVLKPSEETPLTCLYVAALVKEAGFPPGVVNILPGFGPTAGAAIASHMGIDKVAFTGSTEVGKLIQEAAGRSNLKRVTLEMGGKNPNIIFADADLDLAVEQAHQGVFFNAGQCCTAGSRIYVEEPIYDEFVRRSVERAKRRIVGSPFDPTTEQGPQISREHQNRVLEYIQSGIQEGAKLECGGKALGLKGFFIEPTVFSDVKDDMRIAKEEIFGPVQQIMKFKTVEEAIERANNSDYGLTAAVFTTDINKAMTVSTAMQAGTVWVNCFNALSTQCPFGGYKMSGNGRELGESGLKEYLEIKTITMKTVTKNS 518          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Medaka
Match: aldh1a2 (aldehyde dehydrogenase 1 family member A2 [Source:NCBI gene;Acc:100049450])

HSP 1 Score: 580.482 bits (1495), Expect = 0.000e+0
Identity = 287/472 (60.81%), Postives = 363/472 (76.91%), Query Frame = 2
Query:  161 LAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGREL 1573
            +  P+   ++K  YTKIFINNEWH SVS K FP  NPATG+ IC+V E  K D+DKAV AA  AF LGS WR+MDA++RG L+ KLA L+ RD+ YLA +E+L+SGKP       D++ TIK   Y+AG+ADK HG  IP+ G+Y+ FTR+EP+GVCGQIIPWNFPL+M AWKLAPAL+ GNTVVLK +E+TPLT  YVA+L  EAGFPPGVVN++PG GPTAGAA+ +H  +DK+AFTGSTEVG++I +    +N+KR+TLE+GGK+PNI+FADAD D AV+ ++  +FFN GQCC AGSRIYVEE IYD+FV   V  AK ++VG+PFD   +QGPQI  E  N++L +I SG  EGA++  GGK +G KGFFIEPT+F+ V+D MRIAKEEIFGPV QIMKFK   E I RANN++YGL A++FT DI+K++ V+ +++AGTVWVNC++      PFGGYK SG GREL
Sbjct:   26 MPSPVPNPELK--YTKIFINNEWHVSVSGKVFPVYNPATGEQICEVQEADKADVDKAVQAARLAFSLGSVWRRMDASERGKLLAKLADLVERDSVYLATIESLNSGKPFLPTLFVDLQGTIKTLRYFAGYADKIHGTSIPMDGEYLTFTRYEPIGVCGQIIPWNFPLMMAAWKLAPALACGNTVVLKPSEETPLTCLYVAALVKEAGFPPGVVNILPGFGPTAGAAIASHMGIDKVAFTGSTEVGKLIQEAAGRSNLKRVTLEMGGKNPNIIFADADLDLAVEQAHQGVFFNAGQCCTAGSRIYVEEPIYDEFVRRSVERAKRRIVGSPFDPTTEQGPQISREHQNRVLEYIQSGIQEGAKLECGGKALGLKGFFIEPTVFSDVKDDMRIAKEEIFGPVQQIMKFKTVEEAIERANNSDYGLTAAVFTTDINKAMTVSTAMQAGTVWVNCFNALSTQCPFGGYKMSGNGREL 495          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Medaka
Match: aldh1l2 (aldehyde dehydrogenase 1 family member L2 [Source:NCBI gene;Acc:101167504])

HSP 1 Score: 440.654 bits (1132), Expect = 4.793e-142
Identity = 229/493 (46.45%), Postives = 329/493 (66.73%), Query Frame = 2
Query:  167 KPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIR----GDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFK--DTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIK 1624
            K +    +K+ Y + FIN ++ D+   KT+ T NP  G  IC+V+     D+D+AV AA +AF  G PW +M+  DRGSL+YKLA L+    + LA +E++DSG   ++A    V ++I+ + Y+AGW DK  GK IPI        + FT+ EP+GVC  +IPWN+PL+M AWK A  L+ GNT+VLK A+ TPLTA   A L+ +AG P GV+N++PG G   G  L  HP + K+ FTGST VG+ I K C  +N+K+++LELGGKSP I+F+D D D AV+    ++FFN G+ C A  R++VEE I+D+++  +V E     +G+P D + D GPQ  +  ++K+L + + G  EGA +  GGKQ+   GFF++PT+FT VED M IAKEE FGPVM + KF+  D + V+ RAN+ EYGLA+ +FT+DI+K+++V++ L AGTV+VN Y+  D A+PFGG+K SG G++LGE  LS Y + K VT++
Sbjct:  432 KEVNNMTVKMPY-QCFINGKFEDAEDGKTYSTINPTDGSVICKVSYAAVGDVDRAVAAAKEAFDNG-PWGRMNPRDRGSLLYKLADLMEEHQEELATIESIDSGAVYTLALKTHVGMSIQTFRYFAGWCDKIQGKTIPINQARPNRNLTFTKKEPLGVCAIVIPWNYPLMMLAWKSAACLAAGNTLVLKPAQVTPLTALKFAELSVKAGIPKGVINILPGSGGMVGQRLSDHPDIRKLGFTGSTPVGKQIMKSCALSNLKKVSLELGGKSPLIIFSDCDMDKAVRMGMSSVFFNKGENCIAAGRLFVEESIHDEYIRRVVEEIMKMKIGDPLDRSTDHGPQNHKAHLDKLLEYCEIGVKEGATLVYGGKQVDRPGFFMQPTVFTDVEDHMFIAKEESFGPVMVVSKFRNGDVDGVLQRANDTEYGLASGVFTRDINKAMYVSEQLEAGTVFVNTYNKTDVASPFGGFKQSGFGKDLGEDALSEYLKTKAVTVE 922          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Planmine SMEST
Match: SMESG000016195.1 (SMESG000016195.1)

HSP 1 Score: 1042.72 bits (2695), Expect = 0.000e+0
Identity = 519/520 (99.81%), Postives = 520/520 (100.00%), Query Frame = 2
Query:   83 MSKIMISKKFSILFRPLLLNSKCFSSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFDNVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            MSKIMISKKFSILFRPLLLNSKCFSSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAGFPPGVVN+VPGMGPTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFDNVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS
Sbjct:    1 MSKIMISKKFSILFRPLLLNSKCFSSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAGFPPGVVNIVPGMGPTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFDNVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 520          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Planmine SMEST
Match: SMESG000016195.1 (SMESG000016195.1)

HSP 1 Score: 1033.86 bits (2672), Expect = 0.000e+0
Identity = 515/516 (99.81%), Postives = 516/516 (100.00%), Query Frame = 2
Query:   95 MISKKFSILFRPLLLNSKCFSSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFDNVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            MISKKFSILFRPLLLNSKCFSSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAGFPPGVVN+VPGMGPTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFDNVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS
Sbjct:    1 MISKKFSILFRPLLLNSKCFSSLAKPITQNDIKVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAGFPPGVVNIVPGMGPTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFDNVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 516          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Planmine SMEST
Match: SMESG000001708.1 (SMESG000001708.1)

HSP 1 Score: 531.946 bits (1369), Expect = 0.000e+0
Identity = 274/486 (56.38%), Postives = 347/486 (71.40%), Query Frame = 2
Query:  191 KVHYTKIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADA-DFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFDN-VDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIKTPSKNS 1642
            +V +TKIFINNEW DS    TFPT NP   + I QV EG  +DI+KAV AA  AF+ GS WR +DA+ RG L+ KLA LI  +ADY++ LE LD+GK   IA+  D+E ++K   YYAG+ADK HG      GD++ +TR EPVGV G IIPWN+P ++  +KLAP ++ G T+V+K AEQTPL+A Y+  L  +AGFP GVVN+VPG GPTAGAAL +HP V KI FTGSTEVG II K     ++KR+TLELGGKSP I+FADA + D A  T++ A   N GQCC AG+R +VE  +YD  VE +   A+ ++VG+PFD    QGPQ+D+EQ NKI+  I+SGK EGA++ TGG ++G  GFFI+PT+F  V+D+MRIAKEEIFGPV  + KF    EVI RAN+  YGL A +FT DI+K++ ++QSL AG+VW+NCYDV     PFGG+K SG+GRELG YGL  Y EVK VTI  P KNS
Sbjct:    5 EVKFTKIFINNEWCDSEEGHTFPTINPTNEEVIVQVQEGRDKDINKAVKAAKSAFKFGSEWRTLDASKRGILLNKLADLIESNADYISRLEALDNGKSYVIAKG-DLEFSVKILRYYAGYADKIHGNTTSPDGDFLSYTRIEPVGVVGAIIPWNYPFMLAVFKLAPVMAAGCTLVIKPAEQTPLSALYLGDLVLKAGFPKGVVNIVPGYGPTAGAALTSHPDVRKITFTGSTEVGHIIMKTIGNTSLKRVTLELGGKSPLIIFADAHNLDEAAATAHEACMTNHGQCCVAGTRTFVEASVYDVVVEKLRKLAEKRIVGDPFDEKTIQGPQVDKEQFNKIMDLIESGKQEGAKLVTGGNRVGDVGFFIQPTVFGDVKDNMRIAKEEIFGPVQSVFKFNTVEEVIERANDTHYGLGAGVFTSDINKAIMMSQSLEAGSVWINCYDVGLVTTPFGGFKQSGIGRELGCYGLEPYLEVKAVTIAIPQKNS 489          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Planmine SMEST
Match: SMESG000005275.1 (SMESG000005275.1)

HSP 1 Score: 453.751 bits (1166), Expect = 1.106e-147
Identity = 246/534 (46.07%), Postives = 347/534 (64.98%), Query Frame = 2
Query:   59 NFQFRVTRMSKIMISKKFSILFRPLLLNSKCFSSLAK----PITQNDIKVHYT---KIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRG----DYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIK 1624
            NF   + ++  I +   F  LF+ ++L  +   S  K     +  N  K+ +    +IFINNE+ +S S K + +KNP+    IC+V+   K+D+D AV AA +AF+ G  W KM A DRG ++YKLA L+   A+ LA LE+LDSG   ++A    + ++I+ + Y+AGW DK  G  IPI        + FT+ EP+GVCG I PWN+PL+M AWK+A  L+ GNTVVLK A+ TPL +     L+ EAGFP GV+NV+PG G  AG A+  HP + K+ FTGST +GQ I   C ++N+K+ +LELGGKSP I+F+D D D AVK++  ++FFN G+ C A  RI+V+ +I+D F++ +V + K   +G+P D +VD GPQ  E  + K+L F D G  EGA++  GGK+   KG+F+EPTIFT V D M IA+EE FGP+M I KF D +EVI RAN  EYGLA+ +FT DI K+L V  ++ AGTV++N Y+  D AAPFGG+K SG G++LG+  L+ Y + K VT++
Sbjct:  355 NFNVEL-KIDHIYLYSTFDTLFKWIVLRKRGGGSQKKLHYDAVIINANKMTFPIPHQIFINNEFVNSESGKEYDSKNPSDESVICRVSYSSKKDVDIAVKAAKEAFEFGE-WGKMSARDRGRILYKLADLMEEHAEELATLESLDSGAVYTLALKTHIGMSIETFRYFAGWCDKIQGSTIPISNARPNKNLSFTKKEPIGVCGIITPWNYPLMMLAWKVAACLAAGNTVVLKPAQVTPLASLKFCELSVEAGFPSGVINVLPGSGAIAGTAISEHPDIRKLGFTGSTAIGQTIMSSCAKSNLKKCSLELGGKSPLIIFSDCDMDKAVKSACSSVFFNKGENCIAAGRIFVDVRIHDVFLKLVVEDVKKMKIGDPLDRSVDHGPQNHEIHLLKLLEFCDIGVKEGAKLVFGGKRCDRKGYFMEPTIFTSVTDDMYIAREESFGPIMIISKFYDIDEVIVRANKTEYGLASGVFTNDISKALRVADAIDAGTVFINTYNKTDVAAPFGGFKQSGFGKDLGQEALNEYLKTKTVTVE 886          
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Planmine SMEST
Match: SMESG000005275.1 (SMESG000005275.1)

HSP 1 Score: 452.981 bits (1164), Expect = 5.619e-147
Identity = 246/534 (46.07%), Postives = 347/534 (64.98%), Query Frame = 2
Query:   59 NFQFRVTRMSKIMISKKFSILFRPLLLNSKCFSSLAK----PITQNDIKVHYT---KIFINNEWHDSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKMDAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCYEYYAGWADKNHGKVIPIRG----DYIGFTRHEPVGVCGQIIPWNFPLLMQAWKLAPALSMGNTVVLKTAEQTPLTANYVASLAAEAXXXXXXXXXXXXXXXTAGAALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFADADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSKVVGNPFD-NVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMVTIK 1624
            NF   + ++  I +   F  LF+ ++L  +   S  K     +  N  K+ +    +IFINNE+ +S S K + +KNP+    IC+V+   K+D+D AV AA +AF+ G  W KM A DRG ++YKLA L+   A+ LA LE+LDSG   ++A    + ++I+ + Y+AGW DK  G  IPI        + FT+ EP+GVCG I PWN+PL+M AWK+A  L+ GNTVVLK A+ TPL +     L+ EAGFP GV+NV+PG G  AG A+  HP + K+ FTGST +GQ I   C ++N+K+ +LELGGKSP I+F+D D D AVK++  ++FFN G+ C A  RI+V+ +I+D F++ +V + K   +G+P D +VD GPQ  E  + K+L F D G  EGA++  GGK+   KG+F+EPTIFT V D M IA+EE FGP+M I KF D +EVI RAN  EYGLA+ +FT DI K+L V  ++ AGTV++N Y+  D AAPFGG+K SG G++LG+  L+ Y + K VT++
Sbjct:  381 NFNVEL-KIDHIYLYSTFDTLFKWIVLRKRGGGSQKKLHYDAVIINANKMTFPIPHQIFINNEFVNSESGKEYDSKNPSDESVICRVSYSSKKDVDIAVKAAKEAFEFGE-WGKMSARDRGRILYKLADLMEEHAEELATLESLDSGAVYTLALKTHIGMSIETFRYFAGWCDKIQGSTIPISNARPNKNLSFTKKEPIGVCGIITPWNYPLMMLAWKVAACLAAGNTVVLKPAQVTPLASLKFCELSVEAGFPSGVINVLPGSGAIAGTAISEHPDIRKLGFTGSTAIGQTIMSSCAKSNLKKCSLELGGKSPLIIFSDCDMDKAVKSACSSVFFNKGENCIAAGRIFVDVRIHDVFLKLVVEDVKKMKIGDPLDRSVDHGPQNHEIHLLKLLEFCDIGVKEGAKLVFGGKRCDRKGYFMEPTIFTSVTDDMYIAREESFGPIMIISKFYDIDEVIVRANKTEYGLASGVFTNDISKALRVADAIDAGTVFINTYNKTDVAAPFGGFKQSGFGKDLGQEALNEYLKTKTVTVE 912          
The following BLAST results are available for this feature:
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ALDH20.000e+066.40aldehyde dehydrogenase 2 family member [Source:HGN... [more]
ALDH1B10.000e+062.17aldehyde dehydrogenase 1 family member B1 [Source:... [more]
ALDH1A20.000e+060.98aldehyde dehydrogenase 1 family member A2 [Source:... [more]
ALDH1A10.000e+062.20aldehyde dehydrogenase 1 family member A1 [Source:... [more]
ALDH1A20.000e+061.95aldehyde dehydrogenase 1 family member A2 [Source:... [more]
back to top
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alh-10.000e+061.59ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;A... [more]
alh-10.000e+061.59ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;A... [more]
alh-20.000e+061.60ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;A... [more]
alh-10.000e+063.27ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;A... [more]
alh-10.000e+063.27ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Aldh0.000e+060.52gene:FBgn0012036 transcript:FBtr0332597[more]
Aldh0.000e+060.52gene:FBgn0012036 transcript:FBtr0079806[more]
CG310750.000e+058.46gene:FBgn0051075 transcript:FBtr0085080[more]
CG310750.000e+058.07gene:FBgn0051075 transcript:FBtr0307506[more]
CG86656.275e-12943.08gene:FBgn0032945 transcript:FBtr0081517[more]
back to top
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aldh2.20.000e+062.57aldehyde dehydrogenase 2 family member, tandem dup... [more]
aldh2.20.000e+062.57aldehyde dehydrogenase 2 family member, tandem dup... [more]
aldh2.10.000e+061.80aldehyde dehydrogenase 2 family member, tandem dup... [more]
aldh1a20.000e+061.21aldehyde dehydrogenase 1 family, member A2 [Source... [more]
aldh1a20.000e+061.21aldehyde dehydrogenase 1 family, member A2 [Source... [more]
back to top
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aldh20.000e+062.32aldehyde dehydrogenase 2 family member [Source:NCB... [more]
aldh20.000e+063.04aldehyde dehydrogenase 2 family member [Source:NCB... [more]
aldh20.000e+063.49aldehyde dehydrogenase 2 family member [Source:NCB... [more]
ALDH1B10.000e+061.65aldehyde dehydrogenase 1 family member B1 [Source:... [more]
aldh20.000e+063.35aldehyde dehydrogenase 2 family member [Source:NCB... [more]
back to top
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Aldh20.000e+066.07aldehyde dehydrogenase 2, mitochondrial [Source:MG... [more]
Aldh1b10.000e+062.78aldehyde dehydrogenase 1 family, member B1 [Source... [more]
Aldh1a20.000e+060.57aldehyde dehydrogenase family 1, subfamily A2 [Sou... [more]
Aldh20.000e+065.13aldehyde dehydrogenase 2, mitochondrial [Source:MG... [more]
Aldh1a70.000e+059.51aldehyde dehydrogenase family 1, subfamily A7 [Sou... [more]
back to top
BLAST of Aldehyde dehydrogenase, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P11884|ALDH2_RAT0.000e+066.47Aldehyde dehydrogenase, mitochondrial OS=Rattus no... [more]
sp|P47738|ALDH2_MOUSE0.000e+066.07Aldehyde dehydrogenase, mitochondrial OS=Mus muscu... [more]
sp|P81178|ALDH2_MESAU0.000e+067.21Aldehyde dehydrogenase, mitochondrial OS=Mesocrice... [more]
sp|P05091|ALDH2_HUMAN0.000e+066.40Aldehyde dehydrogenase, mitochondrial OS=Homo sapi... [more]
sp|Q2XQV4|ALDH2_PIG0.000e+066.60Aldehyde dehydrogenase, mitochondrial OS=Sus scrof... [more]
back to top
BLAST of Aldehyde dehydrogenase, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5P8I4K90.000e+0100.00ALDH2-like protein OS=Schmidtea mediterranea OX=79... [more]
A0A210QZC40.000e+068.54Aldehyde dehydrogenase, mitochondrial OS=Mizuhopec... [more]
A0A0L8GHP90.000e+067.78Aldedh domain-containing protein OS=Octopus bimacu... [more]
A0A267EC570.000e+065.33Aldedh domain-containing protein OS=Macrostomum li... [more]
A0A1S3FPT50.000e+066.86aldehyde dehydrogenase, mitochondrial OS=Dipodomys... [more]
back to top
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aldh2.20.000e+061.80aldehyde dehydrogenase 2 family member [Source:NCB... [more]
aldh2.20.000e+061.60aldehyde dehydrogenase 2 family member [Source:NCB... [more]
aldh1a20.000e+061.27aldehyde dehydrogenase 1 family member A2 [Source:... [more]
aldh1a20.000e+060.98aldehyde dehydrogenase 1 family member A2 [Source:... [more]
aldh1a30.000e+057.46aldehyde dehydrogenase 1 family member A3 [Source:... [more]
back to top
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aldh1l22.962e-13647.19aldehyde dehydrogenase 1 family, member L2 [Source... [more]
ENSPMAT00000004609.14.736e-9838.30pep scaffold:Pmarinus_7.0:GL479321:13801:23388:1 g... [more]
aldh8a14.196e-8237.37aldehyde dehydrogenase 8 family, member A1 [Source... [more]
aldh5a12.772e-7136.06aldehyde dehydrogenase 5 family, member A1 (succin... [more]
ENSPMAT00000002659.12.254e-5753.80pep scaffold:Pmarinus_7.0:GL481598:469:3326:1 gene... [more]
back to top
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ALD42.290e-16352.00Mitochondrial aldehyde dehydrogenase; required for... [more]
ALD51.358e-15147.53Mitochondrial aldehyde dehydrogenase; involved in ... [more]
ALD63.653e-14447.06Cytosolic aldehyde dehydrogenase; activated by Mg2... [more]
ALD23.061e-11943.11Cytoplasmic aldehyde dehydrogenase; involved in et... [more]
ALD38.013e-11943.31Cytoplasmic aldehyde dehydrogenase; involved in be... [more]
back to top
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO476530.000e+064.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455380.000e+061.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361833.183e-18057.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461515.214e-13445.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO293283.451e-10847.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aldh2.20.000e+064.66aldehyde dehydrogenase 2 family member [Source:NCB... [more]
aldh2.20.000e+064.43aldehyde dehydrogenase 2 family member [Source:NCB... [more]
aldh1a20.000e+060.61aldehyde dehydrogenase 1 family member A2 [Source:... [more]
aldh1a20.000e+060.81aldehyde dehydrogenase 1 family member A2 [Source:... [more]
aldh1l24.793e-14246.45aldehyde dehydrogenase 1 family member L2 [Source:... [more]
back to top
BLAST of Aldehyde dehydrogenase, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016195.10.000e+099.81SMESG000016195.1[more]
SMESG000016195.10.000e+099.81SMESG000016195.1[more]
SMESG000001708.10.000e+056.38SMESG000001708.1[more]
SMESG000005275.11.106e-14746.07SMESG000005275.1[more]
SMESG000005275.15.619e-14746.07SMESG000005275.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023050 ID=SMED30023050|Name=Aldehyde dehydrogenase, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=2209bp
AAAACTAAAATTTTACATTTTACCTTTAACTATTTAGAACATAACTTTTT
CATCATTAAATTTTCAATTTCGAGTAACAAGGATGTCAAAAATTATGATT
TCTAAAAAATTCTCGATTTTATTTCGTCCACTTTTGTTGAATTCCAAATG
CTTTTCATCATTAGCTAAACCAATAACTCAAAACGATATCAAAGTTCATT
ATACTAAAATATTTATCAACAATGAATGGCACGACTCAGTGAGCAAGAAA
ACGTTTCCAACGAAAAATCCAGCAACTGGACAGGATATTTGTCAAGTGGC
TGAAGGGGGAAAGGAAGATATTGATAAAGCTGTCACTGCCGCTAACAAAG
CATTCCAATTAGGATCTCCTTGGCGTAAAATGGATGCTGCCGACAGAGGA
TCATTGATGTATAAACTAGCGCAATTAATTCGTAGAGATGCAGACTATTT
AGCAGCATTGGAAACTCTGGATAGTGGCAAACCAGTCAGCATCGCACGTG
CTGCTGATGTTGAGTTGACGATTAAATGTTATGAGTATTATGCTGGATGG
GCAGATAAAAATCATGGGAAAGTTATTCCTATTCGCGGTGACTATATAGG
ATTCACAAGACACGAGCCAGTTGGGGTTTGTGGTCAAATTATACCGTGGA
ATTTCCCGTTATTAATGCAAGCGTGGAAATTGGCACCTGCACTGAGCATG
GGAAACACAGTCGTATTGAAAACTGCTGAACAAACACCACTTACGGCAAA
TTATGTAGCGTCTTTGGCTGCTGAAGCAGGATTTCCTCCAGGTGTGGTTA
ATGTCGTCCCAGGCATGGGTCCAACGGCAGGGGCAGCATTAGTCACACAT
CCAAAGGTTGACAAAATTGCTTTCACTGGTAGCACGGAAGTTGGTCAAAT
AATTTCCAAACACTGCAATGAAAACAATATCAAGCGCTTGACCTTGGAAC
TCGGTGGTAAAAGTCCAAATATTGTATTTGCTGACGCCGATTTCGATAAT
GCTGTGAAGACGTCTTATTTCGCATTATTCTTCAATATGGGCCAATGTTG
CTGTGCTGGATCACGGATCTACGTGGAAGAAAAAATCTATGATAAATTCG
TAGAAGCAATGGTAGCGGAAGCTAAATCCAAAGTTGTTGGAAACCCGTTT
GATAATGTCGATCAGGGCCCACAAATCGATGAGGAACAGATGAATAAAAT
ATTGGGATTCATTGACAGTGGCAAATCAGAAGGAGCTCAGATGTGCACGG
GTGGCAAACAAATTGGAAGCAAAGGCTTTTTCATCGAACCTACAATATTT
ACAAAAGTCGAAGATTCAATGCGCATTGCTAAAGAAGAGATATTCGGTCC
GGTGATGCAGATAATGAAGTTCAAGGATACCAATGAAGTGATTGCAAGAG
CCAACAATAATGAATATGGTCTCGCTGCTTCGATATTTACACAGGACATC
GACAAATCTTTGCACGTAACGCAGTCGCTACGCGCGGGCACAGTTTGGGT
GAATTGCTATGACGTATTTGATGCGGCTGCGCCTTTCGGAGGCTACAAAT
CATCGGGGGTCGGCAGAGAGCTCGGTGAATACGGCTTGAGTAATTACACG
GAGGTGAAAATGGTGACAATCAAGACCCCCTCCAAAAACAGCTAGATATC
ATATCATTACTTCATCGCCGAGATTCACATCAAACCAATTCACATCGAAT
AATAAATGTTTGCATCGAGTTTATTGTTTTATTATTGATTTATTATTGCG
CGTTAGTGGGATCCTGAGATCTGATCCTCAATTTGCCATTAGTTTTCCTG
TTTTCCCGCTGTTTTCACTAAGGCATTGATTTATCATTTTATTGATTATA
TGCCATTGATTTATCCAAATATTGATTATATTAGTTTTATATTTGCCATA
CAATCATAATATCGAATAGATATAATTTGATTATTAAATTTCCCTTTCCG
CATTTTGATTGGACAATATTGACAGTAACAAGATCGAGACTTTGGAAATG
AGGATTGTATTGTTTTATCTGGAATATGATGAGTAATTTGTCGTTTCATT
CTCCATTTTCATTGGTTGACCGGCACTGATATTTTGATCCGATAATTTCG
TCGTGTAGTCGATTAAGGAGGGAACTCTATCAATTAATGATCTGATTCAT
TTATTAAGTGTTTATTTAAAACAGAACCCTTTTTACATTTTTTTAAAACA
TATTAACAG
back to top

protein sequence of SMED30023050-orf-1

>SMED30023050-orf-1 ID=SMED30023050-orf-1|Name=SMED30023050-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=521bp
MSKIMISKKFSILFRPLLLNSKCFSSLAKPITQNDIKVHYTKIFINNEWH
DSVSKKTFPTKNPATGQDICQVAEGGKEDIDKAVTAANKAFQLGSPWRKM
DAADRGSLMYKLAQLIRRDADYLAALETLDSGKPVSIARAADVELTIKCY
EYYAGWADKNHGKVIPIRGDYIGFTRHEPVGVCGQIIPWNFPLLMQAWKL
APALSMGNTVVLKTAEQTPLTANYVASLAAEAGFPPGVVNVVPGMGPTAG
AALVTHPKVDKIAFTGSTEVGQIISKHCNENNIKRLTLELGGKSPNIVFA
DADFDNAVKTSYFALFFNMGQCCCAGSRIYVEEKIYDKFVEAMVAEAKSK
VVGNPFDNVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQIGSKGFF
IEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAAS
IFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEY
GLSNYTEVKMVTIKTPSKNS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0043878glyceraldehyde-3-phosphate dehydrogenase (NAD+) (non-phosphorylating) activity
GO:0051287NAD binding
GO:0016491oxidoreductase activity
GO:0016620oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0004029aldehyde dehydrogenase (NAD) activity
GO:0005515protein binding
GO:0042802identical protein binding
GO:0070404NADH binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000106ciliated epithelial cell
PLANA:0000421tail
PLANA:0002028dorsal-ventral muscle cell
PLANA:0002032epidermal cell
PLANA:0002063non-ciliated epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR015590Aldehyde_DH_dom
IPR016162Ald_DH_N
IPR016163Ald_DH_C
IPR029510Ald_DH_CS_GLU
IPR016160Ald_DH_CS_CYS
IPR016161Ald_DH/histidinol_DH
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
GO:0055114oxidation-reduction process
GO:0001889liver development
GO:0006068ethanol catabolic process
GO:0032355response to estradiol
GO:0032496response to lipopolysaccharide
GO:0032570response to progesterone
GO:0032870cellular response to hormone stimulus
GO:0033574response to testosterone
GO:0035094response to nicotine
GO:0043066negative regulation of apoptotic process
GO:0055093response to hyperoxia
GO:0071398cellular response to fatty acid
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005759mitochondrial matrix
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR016163Aldehyde dehydrogenase, C-terminalGENE3DG3DSA:3.40.309.10coord: 294..482
e-value: 8.1E-196
score: 652.9
IPR015590Aldehyde dehydrogenase domainPFAMPF00171Aldedhcoord: 49..511
e-value: 3.8E-182
score: 605.9
IPR016162Aldehyde dehydrogenase, N-terminalGENE3DG3DSA:3.40.605.10coord: 57..511
e-value: 8.1E-196
score: 652.9
NoneNo IPR availablePANTHERPTHR11699ALDEHYDE DEHYDROGENASE-RELATEDcoord: 22..520
NoneNo IPR availablePANTHERPTHR11699:SF233ALDEHYDE DEHYDROGENASE, MITOCHONDRIALcoord: 22..520
NoneNo IPR availableCDDcd07141ALDH_F1AB_F2_RALDH1coord: 35..514
e-value: 0.0
score: 886.307
IPR016160Aldehyde dehydrogenase, cysteine active sitePROSITEPS00070ALDEHYDE_DEHYDR_CYScoord: 316..327
IPR029510Aldehyde dehydrogenase, glutamic acid active sitePROSITEPS00687ALDEHYDE_DEHYDR_GLUcoord: 288..295
IPR016161Aldehyde/histidinol dehydrogenaseSUPERFAMILYSSF53720ALDH-likecoord: 35..514