ATP-binding cassette sub-family A member 1

Overview
NameATP-binding cassette sub-family A member 1
Smed IDSMED30023044
Length (bp)2501
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023044

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 38

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30023044h1SMcG0002123 Contig3771GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30023044h1SMcG0012030 Contig3640GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30023044h1SMcG0012029 Contig3771GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30023044h1SMcG0012029 Contig3640GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30023044h1SMcG0012028 Contig3771GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30023044h1SMcG0012028 Contig3640GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30023044h1SMcG0012030 Contig3771GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30023044h1SMcG0012034 Contig3640GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30023044h1SMcG0012034 Contig3771GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30023044h1SMcG0012033 Contig3640GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30023044h1SMcG0012033 Contig3771GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30023044h1SMcG0012029 SmedASXL_004745SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30023044h1SMcG0012029 SmedASXL_004744SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30023044h1SMcG0012028 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30023044h1SMcG0012028 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023044h1SMcG0012028 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023044h1SMcG0012028 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30023044h1SMcG0012028 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30023044h1SMcG0012028 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023044h1SMcG0012028 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30023044h1SMcG0012029 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30023044h1SMcG0012029 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023044h1SMcG0012029 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023044h1SMcG0012029 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30023044h1SMcG0012029 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30023044h1SMcG0012029 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023044h1SMcG0012029 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
body wall musculatureSMED30023044h1SMcG0012029 dd_Smed_v4_30574_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
testisSMED30023044h1SMcG0002123 Contig3771GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30023044h1SMcG0012029 Contig3771GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30023044h1SMcG0012028 Contig3771GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
reproductive organSMED30023044h1SMcG0012029 Contig8654uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30023044h1SMcG0012029 Contig8654newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testisSMED30023044h1SMcG0012030 Contig3771GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30023044h1SMcG0012034 Contig3771GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30023044h1SMcG0012033 Contig3771GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
epidermisSMED30023044h1SMcG0012028 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023044h1SMcG0012029 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Human
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:HGNC Symbol;Acc:HGNC:29])

HSP 1 Score: 298.13 bits (762), Expect = 1.355e-84
Identity = 259/881 (29.40%), Postives = 440/881 (49.94%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK-----------------NFNAQKENFRKGISNSG--------------DKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIEN-QEPFL--DLEDLNQQAFVDKS----LISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKW--SPIP--------NGNIPL--ISPECDCNTTGYQ----ICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRK-----------LYGGFQFVLPSTFGWS-SKLIGDSPFWEELRDFVNASQANHNQSNLNSL-KFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYF------NNKIKKT--EDFDISLEKNRMNSEQKFDDVLQVINLTKIYNR 2410
             DRIAIIS GKL C GSS+FLK + G GY L LVK                 ++  ++++  +  S++G                +   I+ H+ +A++  +   + ++VLP   +    F  LF  +D+ + +L   SYG+S+T+LEE+F++VA++ + ++ ET +  L P   NR A +GD ++   PF   D  D N      +S    L+S    +    ++G+ L +QQ + L  KR   A+R++KG FA+++LP + + + +    +V P    P++E+ PW+            +  +   ++       G    +N LT         D G  G RCM  +    T  +   E    +W  +P+P        NGN  +   SP C C++   +    +C     G P    R   ++D L +LTG NISDYL+K + ++  K            YGGF   + +T     S+ + D+   ++++  +  ++ +     LNSL +F+  L     +        ++W N+KG+ ++ ++ N+ +N +LR+ L K       YGI+  N P+ + +       +    +++ ++I VIF +SF+PASFV+FL++ERVS +K  QF+SG+ P +YW+SNF+WD+  Y++P  ++IIIFI F  +SY+ S N     LLL+ YG +I P MYP SF    PSTA+VVL + NL +G   +++TF+L++   TD      N+ILK VFLIFP + LGRG+ID+  N    +  + + +        W++    L ++ +              GV+  ++  +++  +F      N K+     ED D+  E+ R+      +D+L++  LTKIY R
Sbjct: 1098 GDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSYLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEE-SGVDAETSDGTL-PARRNRRA-FGDKQSCLRPFTEDDAADPNDSDIDPESRETDLLSGMDGKGSYQVKGWKLTQQQFVALLWKRLLIARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLELQPWM------------YNEQYTFVSNDAPEDTGTLELLNALT--------KDPG-FGTRCMEGNPIPDTPCQAGEE----EWTTAPVPQTIMDLFQNGNWTMQNPSPACQCSSDKIKKMLPVCPPGAGGLP-PPQRKQNTADILQDLTGRNISDYLVKTYVQIIAKSLKNKIWVNEFRYGGFSLGVSNTQALPPSQEVNDAI--KQMKKHLKLAKDSSADRFLNSLGRFMTGLDTKNNV--------KVWFNNKGWHAISSFLNVINNAILRANLQKGE-NPSHYGITAFNHPLNLTKQQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHLQFISGVKPVIYWLSNFVWDMCNYVVPATLVIIIFICFQQKSYVSSTNLPVLALLLLLYGWSITPLMYPASFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELF--TDNKLNNINDILKSVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPLSWDLVGRNLFAMAV-------------EGVVFFLITVLIQYRFFIRPRPVNAKLSPLNDEDEDVRRERQRILDGGGQNDILEIKELTKIYRR 1923          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Human
Match: ABCA7 (ATP binding cassette subfamily A member 7 [Source:HGNC Symbol;Acc:HGNC:37])

HSP 1 Score: 286.96 bits (733), Expect = 6.480e-81
Identity = 250/857 (29.17%), Postives = 412/857 (48.07%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK-------------------NFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAK---INEETKNEKL--------IPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIPNGN-IP-LISPECDCNTTGYQI----CNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRK-----------LYGGFQFVLPSTFGWSSKLIGDS--PFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKY------DAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYN 2407
             DR+A+++ G+L CCGS +FL+R  G GY L LVK                   +   +K+N  +G      +LL  ++  +P A++  E   +   VLP   ++   F+ LF  LD  +  L    YG+SDTSLEE+F++V ++ A    + + +  + L        +   L        +EN EP     + +Q +  D         R    ++G+ L +QQ+  L +KRF  A+R+++G+FA+++LP L + L +    +V P    PA+ +SP             T Y    Q++F   +  G+      L   L+        E+G+    P +  S+H    PE        + +GN  P   SP C C+  G +     C     G P     +  S + + NLTG N+SD+L+K +P+L R+            YGGF          S + +G S    W  L      +  +    NL +       Q + KI          W N+KG+ SM A+ N  SN +LR+ L     +   + I+  N P+ + +       +    +++ ++I V+F +SF+PASF + L+EERV+ +K  Q + G++P +YW+ NFLWD+  Y++P  I+++IF+AF  ++Y+   N  A +LLL+ YG +I P MYP SFF S PSTA+VVL   NL +G   +M+TF+L++   +D+  +  + ILK+VFLIFP + LGRG+ID+  N     M D + +           WEV  + L ++++   L+ +  ++++       L    +V      +   ED D++ E+ R+       DVL + NLTK+Y 
Sbjct: 1005 GDRVAVVAGGRLCCCGSPLFLRRHLGSGYYLTLVKARLPLTTNEKADTDMEGSVDTRQEKKNGSQGSRVGTPQLLALVQHWVPGARLVEELPHELVLVLPYTGAHDGSFATLFRELDTRLAELRLTGYGISDTSLEEIFLKVVEECAADTDMEDGSCGQHLCTGIAGLDVTLRLKMPPQETALENGEPAGSAPETDQGSGPDA------VGR----VQGWALTRQQLQALLLKRFLLARRSRRGLFAQIVLPALFVGLALVFSLIVPPFGHYPALRLSP-------------TMYGA--QVSFFSEDAPGDPGRARLLEALLQ--------EAGLE--EPPVQHSSHRFSAPEVPAEVAKVLASGNWTPESPSPACQCSRPGARRLLPDCPAAAGGPP-PPQAVTGSGEVVQNLTGRNLSDFLVKTYPRLVRQGLKTKKWVNEVRYGGFSLGGRDPGLPSGQELGRSVEELWALLSPLPGGA-LDRVLKNLTAWAHSLDAQDSLKI----------WFNNKGWHSMVAFVNRASNAILRAHLPPGPARHA-HSITTLNHPLNLTKEQLSEGALMASSVDVLVSICVVFAMSFVPASFTLVLIEERVTRAKHLQLMGGLSPTLYWLGNFLWDMCNYLVPACIVVLIFLAFQQRAYVAPANLPALLLLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINGSMATFVLELF--SDQKLQEVSRILKQVFLIFPHFCLGRGLIDMVRN---QAMADAFERLGDRQFQSPLRWEVVGKNLLAMVIQGPLFLLFTLLLQH---RSQLLPQPRVRSL--PLLGEEDEDVARERERVVQGATQGDVLVLRNLTKVYR 1803          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Human
Match: ABCA4 (ATP binding cassette subfamily A member 4 [Source:HGNC Symbol;Acc:HGNC:34])

HSP 1 Score: 278.87 bits (712), Expect = 3.604e-78
Identity = 253/885 (28.59%), Postives = 424/885 (47.91%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILV---KNFNAQKENFR-------KGISNS---------------GD--KLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHK--------------LLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKE-NQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYR--STHYRCFPEYKNNKWSPIPNGNIPLISPECDCNT----TGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSR-----------KLYGGFQF-----VLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLK-FIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEM--EQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKY------DAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKKT--------EDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRT 2413
             DRIAII+QG+L C G+ +FLK  FG G  L LV   KN  +Q++          KG S +               GD  +L+  +  H+P+AK+      +  F+LP  +     ++ LF  L+E + +L   S+G+SDT LEE+F++V +D           +   +N+N          + P L   +   Q   D ++ S      H               L  G  L+ Q +  L +KRF +  R+ K   A+++LP   + L + L  ++ P    PA+ + PW+   +    +++    ++   L   + N+ G  N    L +    EY          C N + ++  S        ++  KW+ +        SP C C+T    T    C +  +GG P   R   S++ L +LT  NISD+L+K +P L R           + YGG        V+P T      L+G   F  +L   +N S     +     +  F+ +L+    I        ++W N+KG+ ++ ++ N+  N +LR+ L K      +YGI+V + P+ +  EQ ++   L   +  +  +AI VIF +SF+PASFV++L++ERV+ SK  QF+SG++P  YWV+NFLWDIM Y +   +++ IFI F  ++Y   +N  A + LL+ YG A+IP MYP SF    PSTA+V L+  NL +G  ++  TFIL++ E+     R  N +L+K+ ++FP + LGRG+IDL+   +   +TD YA++      + F W++  + L ++++              GV+  +L  +++  +F ++            ED D++ E+ R+ +     D+L++  LTKIY  T
Sbjct: 1127 GDRIAIIAQGRLYCSGTPLFLKNCFGTGLYLTLVRKMKNIQSQRKGSEGTCSCSSKGFSTTCPAHVDDLTPEQVLDGDVNELMDVVLHHVPEAKLVECIGQELIFLLPNKNFKHRAYASLFRELEETLADLGLSSFGISDTPLEEIFLKVTEDSDSGPLFAGGAQQKRENVN---------PRHPCLGPREKAGQTPQDSNVCSPGAPAAHPEGQPPPEPECPGPQLNTGTQLVLQHVQALLVKRFQHTIRSHKDFLAQIVLPATFVFLALMLSIVIPPFGEYPALTLHPWIYGQQYTFFSMDEPGSEQFTVLADVLLNKPGFGNRC--LKEGWLPEYP---------CGNSTPWKTPSVSPNITQLFQKQKWTQVNP------SPSCRCSTREKLTMLPECPE-GAGGLPPPQRTQRSTEILQDLTDRNISDFLVKTYPALIRSSLKSKFWVNEQRYGGISIGGKLPVVPIT---GEALVG---FLSDLGRIMNVSGGPITREASKEIPDFLKHLETEDNI--------KVWFNNKGWHALVSFLNVAHNAILRASLPKDRSPE-EYGITVISQPLNLTKEQLSEITVLTTSV--DAVVAICVIFSMSFVPASFVLYLIQERVNKSKHLQFISGVSPTTYWVTNFLWDIMNYSVSAGLVVGIFIGFQKKAYTSPENLPALVALLLLYGWAVIPMMYPASFLFDVPSTAYVALSCANLFIGINSSAITFILELFENNRTLLR-FNAVLRKLLIVFPHFCLGRGLIDLA---LSQAVTDVYARFGEEHSANPFHWDLIGKNLFAMVV-------------EGVVYFLLTLLVQRHFFLSQWIAEPTKEPIVDEDDDVAEERQRIITGGNKTDILRLHELTKIYPGT 1950          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Human
Match: ABCA4 (ATP binding cassette subfamily A member 4 [Source:HGNC Symbol;Acc:HGNC:34])

HSP 1 Score: 247.669 bits (631), Expect = 1.724e-68
Identity = 224/803 (27.90%), Postives = 385/803 (47.95%), Query Frame = 2
Query:  167 LQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHK--------------LLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKE-NQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYR--STHYRCFPEYKNNKWSPIPNGNIPLISPECDCNT----TGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSR-----------KLYGGFQF-----VLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLK-FIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEM--EQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKY------DAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYF--------NNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRT 2413
            +  +  H+P+AK+      +  F+LP  +     ++ LF  L+E + +L   S+G+SDT LEE+F++V +D           +   +N+N          + P L   +   Q   D ++ S      H               L  G  L+ Q +  L +KRF +  R+ K   A+++LP   + L + L  ++ P    PA+ + PW+   +    +++    ++   L   + N+ G  N    L +    EY          C N + ++  S        ++  KW+ +        SP C C+T    T    C +  +GG P   R   S++ L +LT  NISD+L+K +P L R           + YGG        V+P T      L+G   F  +L   +N S     +     +  F+ +L+    I        ++W N+KG+ ++ ++ N+  N +LR+ L K      +YGI+V + P+ +  EQ ++   L   +  +  +AI VIF +SF+PASFV++L++ERV+ SK  QF+SG++P  YWV+NFLWDIM Y +   +++ IFI F  ++Y   +N  A + LL+ YG A+IP MYP SF    PSTA+V L+  NL +G  ++  TFIL++ E+     R  N +L+K+ ++FP + LGRG+IDL+   +   +TD YA++      + F W++  + L ++++              GV+  +L  +++  +F          +    ED D++ E+ R+ +     D+L++  LTKIY  T
Sbjct:    1 MDVVLHHVPEAKLVECIGQELIFLLPNKNFKHRAYASLFRELEETLADLGLSSFGISDTPLEEIFLKVTEDSDSGPLFAGGAQQKRENVN---------PRHPCLGPREKAGQTPQDSNVCSPGAPAAHPEGQPPPEPECPGPQLNTGTQLVLQHVQALLVKRFQHTIRSHKDFLAQIVLPATFVFLALMLSIVIPPFGEYPALTLHPWIYGQQYTFFSMDEPGSEQFTVLADVLLNKPGFGNRC--LKEGWLPEYP---------CGNSTPWKTPSVSPNITQLFQKQKWTQVNP------SPSCRCSTREKLTMLPECPE-GAGGLPPPQRTQRSTEILQDLTDRNISDFLVKTYPALIRSSLKSKFWVNEQRYGGISIGGKLPVVPIT---GEALVG---FLSDLGRIMNVSGGPITREASKEIPDFLKHLETEDNI--------KVWFNNKGWHALVSFLNVAHNAILRASLPKDRSPE-EYGITVISQPLNLTKEQLSEITVLTTSV--DAVVAICVIFSMSFVPASFVLYLIQERVNKSKHLQFISGVSPTTYWVTNFLWDIMNYSVSAGLVVGIFIGFQKKAYTSPENLPALVALLLLYGWAVIPMMYPASFLFDVPSTAYVALSCANLFIGINSSAITFILELFENNRTLLR-FNAVLRKLLIVFPHFCLGRGLIDLA---LSQAVTDVYARFGEEHSANPFHWDLIGKNLFAMVV-------------EGVVYFLLTLLVQRHFFLSQWIAEPTKEPIVDEDDDVAEERQRIITGGNKTDILRLHELTKIYPGT 742          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Human
Match: ABCA12 (ATP binding cassette subfamily A member 12 [Source:HGNC Symbol;Acc:HGNC:14637])

HSP 1 Score: 214.157 bits (544), Expect = 9.307e-57
Identity = 237/828 (28.62%), Postives = 386/828 (46.62%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDN----LNALSYGLSDTSLEEVFIRVADDPAKIN----EETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWS----PIPNGNIPLISPECDCNTTGYQICNDPR-SGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPI----EMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVG--SITTMS-TFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYA-KYDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSY--FN-NKIKKT--EDFDISLEKNRMNSEQKFDDVLQVINLTKIYN 2407
            SDRIA + QG L+CCGS  +LK  FGDGY L L K    +  N           +   I+SH+P+A ++ +   +  +VLP     S K SG +++L   +DN    LN   YG+SDT++EEVF+ +  +  K +    E    +K+   N N I+   D+           ++   F D+    L   R  +L  GF LL ++I+ + IKRFH+ +RN KG+ A++ILPI+ +T  + L  L N   S P ++ISP L                     +  + Q     + +P T+ L S      G   + C+N S       +C  +    KW+    PI N  +      C C +   Q C  P+ +  PP  +R   SS  + NLTG  + +YL+    +  +K YGG+ F LP T              ++LR  +    AN                          +  ++W + +GY S+PAY N  +N LLR  ++K       +GI + + P     + EQ+T     ++ +I ++ +A+ ++ G S   ASFV ++V E  + +K+ Q +SGI    YWV+NF++D++ Y++P+   I I   F   ++    N  A  LLL+ +G A    MY  +        AF+     NL  G  SI ++S  + L   +  D T    +E LK++FLIFPQ+  G G+I+LS      +    Y  +Y    +E+   KL ++ +  +    +   + R +IN  L + L++ +  FN + +++T  ED D+  E+ R+ S     D++Q+  LTK Y 
Sbjct: 1544 SDRIAFLEQGGLRCCGSPFYLKEAFGDGYHLTLTKK---KSPNLNANAVCDTMAVTAMIQSHLPEAYLKEDIGGELVYVLP---PFSTKVSGAYLSLLRALDNGMGDLNIGCYGISDTTVEEVFLNLTKESQKNSAMSLEHLTQKKIGNSNANGISTPDDL----------SVSSSNFTDRDDKILT--RGERL-DGFGLLLKKIMAILIKRFHHTRRNWKGLIAQVILPIVFVTTAMGLGTLRNSSNSYPEIQISPSL---------------------YGTSEQTAFYANYHPSTEALVSAMWDFPGIDNM-CLNTS-----DLQCLNKDSLEKWNTSGEPITNFGV------CSC-SENVQEC--PKFNYSPP--HRRTYSSQVIYNLTGQRVENYLISTANEFVQKRYGGWSFGLPLT--------------KDLRFDITGVPANR-------------------------TLAKVWYDPEGYHSLPAYLNSLNNFLLRVNMSKYDAA--RHGIIMYSHPYPGVQDQEQAT-----ISSLI-DILVALSILMGYSVTTASFVTYVVREHQTKAKQLQHISGIGVTCYWVTNFIYDMVFYLVPVAFSIGIIAIFKLPAFYSENNLGAVSLLLLLFGYATFSWMYLLAGLFHETGMAFITYVCVNLFFGINSIVSLSVVYFLSKEKPNDPTLELISETLKRIFLIFPQFCFGYGLIELSQQQSVLDFLKAYGVEYPNETFEM--NKLGAMFVALVSQGTMFFSL-RLLINESLIKKLRLFFRKFNSSHVRETIDEDEDVRAERLRVESGAAEFDLVQLYCLTKTYQ 2264          

HSP 2 Score: 51.6026 bits (122), Expect = 7.940e-6
Identity = 35/125 (28.00%), Postives = 59/125 (47.20%), Query Frame = 2
Query:    8 RIAIISQGKLQCCGSSVFLKRKFGDGYRL-ILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADD 379
            R+AI+  GK QC GS   +K +FG G+ + + +KN     E   K           F++ H P   ++ + ++   + +P         + +F  L+     LN  ++ +S T+LEEVFI  A D
Sbjct: 2458 RLAIMVNGKFQCIGSLQHIKSRFGRGFTVKVHLKNNKVTMETLTK-----------FMQLHFPKTYLKDQHLSMLEYHVPVTAGG---VANIFDLLETNKTALNITNFLVSQTTLEEVFINFAKD 2568          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Celegans
Match: abt-2 (ABC Transporter family [Source:UniProtKB/TrEMBL;Acc:Q1RS86])

HSP 1 Score: 91.2781 bits (225), Expect = 1.842e-18
Identity = 99/383 (25.85%), Postives = 182/383 (47.52%), Query Frame = 2
Query: 1031 CDCNTTGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDY-LLKNFPKLSRK----LYGGFQFVLPSTFGWSSKLIGDSP--FWEELRDFVNASQA-NHNQSNLN--SLKFIDYLQKTFKIYGIKTSF---------TRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIF----VIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIG-SKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLG----RGMI 2095
            C C   G+    +       N  R+ T+ D++ +LTG N++ + L+  F +L+        GGF     +    S   I  S   + E ++D   + +  N N + +   + K +D   +   +  +              ++W N+K +   P  +NI SN LLR      A+   D GI   N P+  +  ++ LD  N +    +LA+F    ++  LS IPA F ++LVE+R+  +   Q V G+    YWV+++L+D++ Y + II+I++I++ F    +        AF+LL   +G++ I + Y F    S  + +FV++   +  VG +  ++  +L+ +   D +  P + +   VFL+ PQY+LG    RG++
Sbjct: 1317 CGCEDFGWNCTLEDWKWNETNWLRLNTT-DRIFDLTGRNLTQFRLITRFAQLANTTAPFFLGGFSLGHVNQRAQSQADIDTSKRGWLETIKDIAQSMRIINLNTTGIEPATPKVLDPFAQNITLNQVVNDLLQNLDVRENVKVWFNNKIWPGFPIASNILSNALLRQEDY--AIDPEDLGILTMNHPMN-KTISQTLD-QNALKFTQALAVFRITILLLVLSMIPAGFTVYLVEDRICEALHLQLVGGLRKVTYWVTSYLYDMVVYTLVIIVIMLIYLCFRVSDFTADGATFFAFLLLFFVHGMSTILYAYVFQKAFSVAALSFVLIAIGSYFVGIVCALTVIMLESLMVQDPSLIPAHTVCSIVFLVLPQYNLGIAIFRGLM 1694          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Celegans
Match: abt-2 (ABC Transporter family [Source:UniProtKB/TrEMBL;Acc:Q1RS86])

HSP 1 Score: 91.2781 bits (225), Expect = 1.948e-18
Identity = 99/383 (25.85%), Postives = 182/383 (47.52%), Query Frame = 2
Query: 1031 CDCNTTGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDY-LLKNFPKLSRK----LYGGFQFVLPSTFGWSSKLIGDSP--FWEELRDFVNASQA-NHNQSNLN--SLKFIDYLQKTFKIYGIKTSF---------TRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIF----VIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIG-SKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLG----RGMI 2095
            C C   G+    +       N  R+ T+ D++ +LTG N++ + L+  F +L+        GGF     +    S   I  S   + E ++D   + +  N N + +   + K +D   +   +  +              ++W N+K +   P  +NI SN LLR      A+   D GI   N P+  +  ++ LD  N +    +LA+F    ++  LS IPA F ++LVE+R+  +   Q V G+    YWV+++L+D++ Y + II+I++I++ F    +        AF+LL   +G++ I + Y F    S  + +FV++   +  VG +  ++  +L+ +   D +  P + +   VFL+ PQY+LG    RG++
Sbjct: 1280 CGCEDFGWNCTLEDWKWNETNWLRLNTT-DRIFDLTGRNLTQFRLITRFAQLANTTAPFFLGGFSLGHVNQRAQSQADIDTSKRGWLETIKDIAQSMRIINLNTTGIEPATPKVLDPFAQNITLNQVVNDLLQNLDVRENVKVWFNNKIWPGFPIASNILSNALLRQEDY--AIDPEDLGILTMNHPMN-KTISQTLD-QNALKFTQALAVFRITILLLVLSMIPAGFTVYLVEDRICEALHLQLVGGLRKVTYWVTSYLYDMVVYTLVIIVIMLIYLCFRVSDFTADGATFFAFLLLFFVHGMSTILYAYVFQKAFSVAALSFVLIAIGSYFVGIVCALTVIMLESLMVQDPSLIPAHTVCSIVFLVLPQYNLGIAIFRGLM 1657          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Celegans
Match: abt-4 (ABC Transporter family [Source:UniProtKB/TrEMBL;Acc:Q9TXV8])

HSP 1 Score: 78.1814 bits (191), Expect = 1.933e-14
Identity = 51/171 (29.82%), Postives = 93/171 (54.39%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFV 514
             DRIAI++ G+L+CCGS +FLK+++GDGY L +V +  +  +     +S + D     I+ +IP+A + +    + +++L  + ++   F  LF  L++        S+G+S T++EEVF++V       +E    E  I ++++ +     IE  +P   L+DL  Q  V
Sbjct:  794 GDRIAIMAHGQLECCGSPMFLKQQYGDGYHLTIVYDTTSTPD-----VSKTTD----IIREYIPEAHVFSYIGQEATYLL--SATHRPIFPKLFKELEDHQTQCGITSFGVSITTMEEVFLKVGHTA---DERYNYEHGIENDISEM-----IEKDDPI--LQDLRAQVRV 943          

HSP 2 Score: 66.2402 bits (160), Expect = 9.766e-11
Identity = 43/165 (26.06%), Postives = 81/165 (49.09%), Query Frame = 2
Query: 1598 LAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILL-LIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFL-IFPQYDLGR 2086
            +A  +I   +   A +  FL+ ER   SK  Q +SGI P+++W++ F+WD   ++I I+    IF  F+  +Y      +  + L  + YG   +P  Y F FF  +    F+++  Y++L G I +++  I+      D  +     +   +F  +FP Y++ +
Sbjct: 1159 IAYGLIVSFAVCVAGYSQFLITERKKKSKHMQLLSGIRPWMFWLTAFIWDAAWFVIRILCFDAIFYIFNITAYTHDFGVMLILTLSFLLYGWTALPFTYWFQFFFESAPKGFMMVTMYHILTGMIGSIAVPIISQTSSLDAGY-----LWSIIFAWLFPTYNISQ 1318          

HSP 3 Score: 52.373 bits (124), Expect = 1.665e-6
Identity = 38/127 (29.92%), Postives = 63/127 (49.61%), Query Frame = 2
Query:    8 RIAIISQGKLQCCGSSVFLKRKFGDGYRLIL-VKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPA 385
             +AI+  GK +C GS   +K ++G GY L++ +KN             N  +K    IK     + ++ E + Q +F +P++  +   +S LF  L+    +LN   Y LS T+LE+VFI  + D  
Sbjct: 1649 ELAIMVYGKFRCYGSCQHIKSRYGSGYTLLIRLKN------------RNDAEKTKSTIKQTFRGSVIKEEHVLQLNFDIPRDGDS---WSRLFEKLETVSTSLNWDDYSLSQTTLEQVFIEFSRDAG 1760          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Celegans
Match: ced-7 (ABC transporter ced-7 [Source:UniProtKB/Swiss-Prot;Acc:P34358])

HSP 1 Score: 76.2554 bits (186), Expect = 7.817e-14
Identity = 50/189 (26.46%), Postives = 106/189 (56.08%), Query Frame = 2
Query: 1547 QSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIF-YGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFL-IFPQYDLGRGMIDLSS 2107
            +ST   +L+   ++++ LA  +I   + + ++FV+FL+EER      QQF++GI+P  ++ ++ ++D + Y +  +I + +F+AF +       + LA ++L  F Y  + +P +Y  SF   +PS A V+L  + +++     ++ F++ +I + DE  +    IL  +F+ + P Y  G  +I +++
Sbjct: 1163 KSTSNSNLLPSQLIDVLLAPMLILIFAMVTSTFVMFLIEERTCQFAHQQFLTGISPITFYSASLIYDGILYSLICLIFLFMFLAFHWM-----YDHLAIVILFWFLYFFSSVPFIYAVSFLFQSPSKANVLLIIWQVVISGAALLAVFLIFMIFNIDEWLK---SILVNIFMFLLPSYAFGSAIITINT 1343          

HSP 2 Score: 56.6102 bits (135), Expect = 8.257e-8
Identity = 59/233 (25.32%), Postives = 100/233 (42.92%), Query Frame = 2
Query:    5 DRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISN----------SGDKLLQFIKSHIPDA-KMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFL-----DLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAE 655
            D + I+S GKL   G++ +LK+KFG GY L +V + N  K      +++           G+   Q I+  +P+A K E   + Q    +   +  S  F  +   L  ++  L   S+GLS  +LE+VFI + D   K     +N ++  ++ N           EP L     D +   + A   + L+        K   G   +  Q I +  K+F Y++RN   +F +
Sbjct:  799 DWVFIMSHGKLVASGTNQYLKQKFGTGYLLTVVLDHNGDKRKMAVILTDVCTHYVKEAERGEMHGQQIEIILPEARKKEFVPLFQALEAIQDRNYRSNVFDNMPNTLKSQLATLEMRSFGLSLNTLEQVFITIGDKVDKAIASRQNSRISHNSRN---------ASEPSLKPAGYDTQSSTKSADSYQKLMDSQARGPEK--SGVAKMVAQFISIMRKKFLYSRRNWAQLFTQ 1020          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Celegans
Match: ced-7 (ABC transporter ced-7 [Source:UniProtKB/Swiss-Prot;Acc:P34358])

HSP 1 Score: 76.2554 bits (186), Expect = 8.310e-14
Identity = 50/189 (26.46%), Postives = 106/189 (56.08%), Query Frame = 2
Query: 1547 QSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIF-YGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFL-IFPQYDLGRGMIDLSS 2107
            +ST   +L+   ++++ LA  +I   + + ++FV+FL+EER      QQF++GI+P  ++ ++ ++D + Y +  +I + +F+AF +       + LA ++L  F Y  + +P +Y  SF   +PS A V+L  + +++     ++ F++ +I + DE  +    IL  +F+ + P Y  G  +I +++
Sbjct: 1109 KSTSNSNLLPSQLIDVLLAPMLILIFAMVTSTFVMFLIEERTCQFAHQQFLTGISPITFYSASLIYDGILYSLICLIFLFMFLAFHWM-----YDHLAIVILFWFLYFFSSVPFIYAVSFLFQSPSKANVLLIIWQVVISGAALLAVFLIFMIFNIDEWLK---SILVNIFMFLLPSYAFGSAIITINT 1289          

HSP 2 Score: 56.6102 bits (135), Expect = 7.878e-8
Identity = 59/233 (25.32%), Postives = 100/233 (42.92%), Query Frame = 2
Query:    5 DRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISN----------SGDKLLQFIKSHIPDA-KMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFL-----DLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAE 655
            D + I+S GKL   G++ +LK+KFG GY L +V + N  K      +++           G+   Q I+  +P+A K E   + Q    +   +  S  F  +   L  ++  L   S+GLS  +LE+VFI + D   K     +N ++  ++ N           EP L     D +   + A   + L+        K   G   +  Q I +  K+F Y++RN   +F +
Sbjct:  745 DWVFIMSHGKLVASGTNQYLKQKFGTGYLLTVVLDHNGDKRKMAVILTDVCTHYVKEAERGEMHGQQIEIILPEARKKEFVPLFQALEAIQDRNYRSNVFDNMPNTLKSQLATLEMRSFGLSLNTLEQVFITIGDKVDKAIASRQNSRISHNSRNA---------SEPSLKPAGYDTQSSTKSADSYQKLMDSQARGPEK--SGVAKMVAQFISIMRKKFLYSRRNWAQLFTQ 966          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Fly
Match: CG34120 (gene:FBgn0083956 transcript:FBtr0343018)

HSP 1 Score: 90.8929 bits (224), Expect = 3.317e-18
Identity = 80/285 (28.07%), Postives = 141/285 (49.47%), Query Frame = 2
Query: 1274 ELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEM----SLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYI 2116
            E R F N SQ +++   LNS  + +Y ++ +  YG+  S   +W N+KGY SM A+ N  ++ LLR+ +N S     +  I   N P ++     F +L    IL      S+   ++     + AS  ++LV ERV+G K QQ + G++   YW+   +WD +  ++ +I+ +++ + F    ++  +  +  I L + +  A +P ++      S  S A V +   NL+V  +T     IL ++ D    +      L + FLIFP + LG G ++L  NY+
Sbjct: 1289 ECRVF-NTSQQSYDWV-LNS--WGEYSERRYGGYGLNGSGATVWYNNKGYHSMMAWLNDLNSELLRTTMNDS-----ESSILTLNEPWKL----GFAELSTSSILRQAGDGSMVFILLIAFGLVVASGSVYLVNERVNGEKLQQRLCGVSAVTYWLVALVWDYLVMVLGLIVCLVVILMFGMPVFVDRQQLVGIIGLSLAFSFACVPSVHVAEKIFSDSSIAIVSIFCANLIVPLVTMGIILILGVVGD-GPAWDDWRHALNQAFLIFPIHALGDGFLELCKNYM 1559          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Fly
Match: CG34120 (gene:FBgn0083956 transcript:FBtr0299591)

HSP 1 Score: 90.8929 bits (224), Expect = 3.484e-18
Identity = 80/285 (28.07%), Postives = 141/285 (49.47%), Query Frame = 2
Query: 1274 ELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEM----SLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYI 2116
            E R F N SQ +++   LNS  + +Y ++ +  YG+  S   +W N+KGY SM A+ N  ++ LLR+ +N S     +  I   N P ++     F +L    IL      S+   ++     + AS  ++LV ERV+G K QQ + G++   YW+   +WD +  ++ +I+ +++ + F    ++  +  +  I L + +  A +P ++      S  S A V +   NL+V  +T     IL ++ D    +      L + FLIFP + LG G ++L  NY+
Sbjct: 1272 ECRVF-NTSQQSYDWV-LNS--WGEYSERRYGGYGLNGSGATVWYNNKGYHSMMAWLNDLNSELLRTTMNDS-----ESSILTLNEPWKL----GFAELSTSSILRQAGDGSMVFILLIAFGLVVASGSVYLVNERVNGEKLQQRLCGVSAVTYWLVALVWDYLVMVLGLIVCLVVILMFGMPVFVDRQQLVGIIGLSLAFSFACVPSVHVAEKIFSDSSIAIVSIFCANLIVPLVTMGIILILGVVGD-GPAWDDWRHALNQAFLIFPIHALGDGFLELCKNYM 1542          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Fly
Match: CG34120 (gene:FBgn0083956 transcript:FBtr0110827)

HSP 1 Score: 90.8929 bits (224), Expect = 3.491e-18
Identity = 80/285 (28.07%), Postives = 141/285 (49.47%), Query Frame = 2
Query: 1274 ELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEM----SLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYI 2116
            E R F N SQ +++   LNS  + +Y ++ +  YG+  S   +W N+KGY SM A+ N  ++ LLR+ +N S     +  I   N P ++     F +L    IL      S+   ++     + AS  ++LV ERV+G K QQ + G++   YW+   +WD +  ++ +I+ +++ + F    ++  +  +  I L + +  A +P ++      S  S A V +   NL+V  +T     IL ++ D    +      L + FLIFP + LG G ++L  NY+
Sbjct: 1288 ECRVF-NTSQQSYDWV-LNS--WGEYSERRYGGYGLNGSGATVWYNNKGYHSMMAWLNDLNSELLRTTMNDS-----ESSILTLNEPWKL----GFAELSTSSILRQAGDGSMVFILLIAFGLVVASGSVYLVNERVNGEKLQQRLCGVSAVTYWLVALVWDYLVMVLGLIVCLVVILMFGMPVFVDRQQLVGIIGLSLAFSFACVPSVHVAEKIFSDSSIAIVSIFCANLIVPLVTMGIILILGVVGD-GPAWDDWRHALNQAFLIFPIHALGDGFLELCKNYM 1558          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Fly
Match: ABCA (gene:FBgn0031170 transcript:FBtr0332488)

HSP 1 Score: 87.4261 bits (215), Expect = 3.672e-17
Identity = 70/212 (33.02%), Postives = 104/212 (49.06%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNK 637
             DRIAI+  G+L+C G+S FLK+++G GYRLI VK  + +            +++   +  +IP  K E +   + S+ LP  DS S KF  +F  L+E+ D L+   YG+  TS+EEVF++V  +               DN   I    +I N       ED N+    D       F+ N +LL+G  LL  Q   + +K+F Y  RNK
Sbjct:  712 GDRIAIMCDGELKCQGTSFFLKKQYGSGYRLICVKRDDCET-----------NEVTALLNKYIPGLKPECDIGAELSYQLP--DSASAKFEEMFGQLEEQSDELHLNGYGVGITSMEEVFMKVGAE--------------KDNTGNIKDQHEIMNGGSGFRGEDDNESVQSDGI-----FSENRRLLQGLQLLSNQWKAMLLKKFLYTWRNK 891          

HSP 2 Score: 77.0258 bits (188), Expect = 5.673e-14
Identity = 78/296 (26.35%), Postives = 136/296 (45.95%), Query Frame = 2
Query: 1280 RDFVNASQANHNQSNLNSLKFIDY---LQKTFKI-----YGIKTSFTR----IWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETF--RPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYN 2125
             D   +  +N+      +  F DY   L KT ++     Y +  + T      W N++   + P   N+  N +       S+VK     I V+N P+    ST    L     L   LA  + F + F+ + +++FL++ER S +K  QFV G+  + +W+S F+ D   YI+  +I++I  + F             + LLL+ +G A++P +Y  S F   P+T F  ++  N+  G    M+ FI+ ++  + E F  + T +IL  +F IFP + L   +  + +N    N
Sbjct:  956 EDLARSYGSNYGLELTGTQGFEDYILDLGKTIQVRINSRYLVAATITESKITAWLNNQALHTAPLTVNMVHNAIADKLF-GSSVK-----IQVTNAPLPYTTSTLLSQLSTGNNLGTQLASNLCFCMCFVSSIYILFLIKERESRAKLLQFVGGVKVWTFWLSQFICDFASYIVTALIVVITIVCFQETGLSTFGELGRYYLLLLLFGFAVLPFIYIMSLFFREPATGFARVSIVNIFCG----MALFIVVVVM-SSELFDTKDTADILGWIFRIFPHFSLAMSLNKVYTNTATRN 1240          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Fly
Match: ABCA (gene:FBgn0031170 transcript:FBtr0332489)

HSP 1 Score: 87.4261 bits (215), Expect = 3.822e-17
Identity = 70/212 (33.02%), Postives = 104/212 (49.06%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNK 637
             DRIAI+  G+L+C G+S FLK+++G GYRLI VK  + +            +++   +  +IP  K E +   + S+ LP  DS S KF  +F  L+E+ D L+   YG+  TS+EEVF++V  +               DN   I    +I N       ED N+    D       F+ N +LL+G  LL  Q   + +K+F Y  RNK
Sbjct:  712 GDRIAIMCDGELKCQGTSFFLKKQYGSGYRLICVKRDDCET-----------NEVTALLNKYIPGLKPECDIGAELSYQLP--DSASAKFEEMFGQLEEQSDELHLNGYGVGITSMEEVFMKVGAE--------------KDNTGNIKDQHEIMNGGSGFRGEDDNESVQSDGI-----FSENRRLLQGLQLLSNQWKAMLLKKFLYTWRNK 891          

HSP 2 Score: 76.6406 bits (187), Expect = 7.243e-14
Identity = 78/296 (26.35%), Postives = 136/296 (45.95%), Query Frame = 2
Query: 1280 RDFVNASQANHNQSNLNSLKFIDY---LQKTFKI-----YGIKTSFTR----IWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETF--RPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYN 2125
             D   +  +N+      +  F DY   L KT ++     Y +  + T      W N++   + P   N+  N +       S+VK     I V+N P+    ST    L     L   LA  + F + F+ + +++FL++ER S +K  QFV G+  + +W+S F+ D   YI+  +I++I  + F             + LLL+ +G A++P +Y  S F   P+T F  ++  N+  G    M+ FI+ ++  + E F  + T +IL  +F IFP + L   +  + +N    N
Sbjct:  956 EDLARSYGSNYGLELTGTQGFEDYILDLGKTIQVRINSRYLVAATITESKITAWLNNQALHTAPLTVNMVHNAIADKLF-GSSVK-----IQVTNAPLPYTTSTLLSQLSTGNNLGTQLASNLCFCMCFVSSIYILFLIKERESRAKLLQFVGGVKVWTFWLSQFICDFASYIVTALIVVITIVCFQETGLSTFGELGRYYLLLLLFGFAVLPFIYIMSLFFREPATGFARVSIVNIFCG----MALFIVVVVM-SSELFDTKDTADILGWIFRIFPHFSLAMSLNKVYTNTATRN 1240          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Zebrafish
Match: abca4a (ATP-binding cassette, sub-family A (ABC1), member 4a [Source:ZFIN;Acc:ZDB-GENE-050517-3])

HSP 1 Score: 317.775 bits (813), Expect = 2.138e-91
Identity = 248/876 (28.31%), Postives = 416/876 (47.49%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRK-GISNSGD--------------------------------KLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADD--PAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINP------LTDRLESEYRSD--LGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIPNGNIPLISPECDCNT----TGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSR-----------KLYGGFQF--VLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLK-FIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKY------DAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKKT----EDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTF 2416
            SDR+AIISQG+L CCGS +FLK   G G+ L LV+    Q    RK G  +  D                                 +   +  H+P+A++      + +F+LP        ++ LF  L+E + ++   S+G+SDTSLEEVF++V  D   A IN  +  ++    + N  +   ++ ++E                        R  + ++GF L+ +Q   L IKRFH+  R+ K   A+++LP   + + +    +V P    P++ +SPW+     R     TF+  E Q+        G      P      + D    EY  +    E  +  +NP +             N++W+ I        SP C C+T    T   +C +   G PP   RI ++ D L +LTG NISDYL+K +P L R           + YGG      LP       K I ++    ++   +N +   +++  L+    F+ Y++    +        ++W N+KG+ +M A+ N+ +N  +        V   +YGI+  N P+ + +       V    ++  +AI VIF +SF+PA FV++L++ERV+ +K  QFVSG++P VYW +NF WD++ Y +   +++ IFIAFD + Y    N  A I LL+ YG ++ P MYP S+  + PSTA+V L+  NL +G  ++  TFILD+ + T+  ++  N++LKK  L+FP + LGRG+ID++ N     + D YA++      D F W+   E L  + +   +++         ++N ++     + ++ +  KK     ED D++ E+ R+      +D+LQ+ +L+K Y  TF
Sbjct: 1145 SDRVAIISQGRLYCCGSPLFLKNCLGAGFYLTLVRRIKEQPAPVRKEGQCDCTDDCSCKCSLCTKFKASDTEKPRVSERQMEGNIESITALVHHHVPEARLIEVIGQELTFLLPSRAFKHRSYASLFRELEETLADMGLSSFGVSDTSLEEVFLKVTADGEAAHINTASDTDR---SHANGQSNSANVISKE-----------------------GRGSQQVKGFFLVVKQFFALLIKRFHHTTRSGKDFLAQIVLPASFVFISLMFTLIVPPFGEYPSLTLSPWMY---GRQF---TFFSNE-QMQSPDMRYFGEVLLNRPGFGTRCMVDEPLEEYPCNNITTEWEMPLVNPMLIEM--------LSNSEWTDISP------SPSCQCSTPNKLTMLPVCPEGAGGLPPPQ-RIQSTGDMLMDLTGRNISDYLVKTYPNLIRTSLKSKYWVNEQRYGGISVGGRLP-VLNLDPKSIQNAA--AQIGRLLNVTGGRYSKLALDEFATFLRYMETENNV--------KVWFNNKGWHAMVAFMNV-ANNAILRANLPPGVDLNEYGITAINHPLNLTKEQLSEVTVLTTSVDAVVAINVIFAMSFVPAGFVLYLIQERVTQAKHLQFVSGVSPLVYWTANFFWDMINYSVSAAMVVGIFIAFDKKCYTSPGNLQALIALLMLYGWSVTPMMYPMSYIFNVPSTAYVSLSCINLFIGINSSAITFILDLFDSTEALYK-CNQVLKKALLVFPHFCLGRGLIDMAMNQA---VMDVYARFGEDFSLDPFSWDFVGENLTFMAVEGFVYF---------ILNILIQYRFFLDHWMSDFKKPPITDEDVDVAKERERIYKGGSSNDILQIKDLSKTYTGTF 1947          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Zebrafish
Match: abca4b (ATP-binding cassette, sub-family A (ABC1), member 4b [Source:ZFIN;Acc:ZDB-GENE-050517-4])

HSP 1 Score: 312.383 bits (799), Expect = 1.293e-89
Identity = 252/872 (28.90%), Postives = 419/872 (48.05%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQ--KENF--------------------------RKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQA-FVDKSLIS-LNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCF------------PEYKNNKWSPIPNGNIPLISPECDCNT----TGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKL-----------SRKLYGGFQFVLPSTFGWSSKLIGDSP-----FWEELRDFVNASQANHNQSNLNSLK-FIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKY------DAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNR 2410
            SDR+AIIS+GKL C GS +FLK  FG G+ L LV+    Q  KEN                            + +  + + +   I  H+P+AK+      + +++LP        ++ LF  L+E + ++   S+G+SDTSLEE+F++V  D      E  N  + P+      +    +N   F+    L + A  V  SL S  +  R  + ++GF L+ +Q   L +KRFH+A R+ K   A+++LP   + + +    +V P    P + ++PW+  P               Q  F     + N+   +P           D G  G RCM      +  + C             PE  N   SP  +   P  SP C+C+T    T   +C     G PP   R   + D L ++T  NISDYL+K + KL           + + YGG       + G    ++   P      + +L   +N     +++S ++ L+ F+ Y++  + +        ++W N+KG+ +M ++ N+ +N +LR+ L   A    DYGI+  N P+ + +       V    ++  +AI VIF +SFIPASFV++L++ERV+ +K  QFVSG++P VYW +NF WD++ Y +   +++ IF+ FD + Y    N  A I LL  YG ++ P MYP S+  + PSTA+V L+  NL +G  ++  TFIL++ E+ + +    NE+LKKV L+FP + LGRG+ID++ N     +TD YA++      D F W    + L  + +   +++I  +     +I    +    +S +   +   ED D++ E+ R+      +D+L + +L+K Y R
Sbjct: 1178 SDRVAIISKGKLHCSGSPLFLKNCFGVGFYLTLVRRMKDQRKKENECDCASECSCTCSTCTRYKEESQALQPERVLDGNVESITTLIHHHVPEAKLIEMIGQEMTYLLPNKGFKYRAYASLFRELEETLGDMGLSSFGISDTSLEEIFLKVTAD-----GEAANSSVTPEQW----MLQQRKNGNGFMKDTGLAEDANGVGASLESDSSEGRASRQVKGFSLVLKQFHALLVKRFHHATRSHKDFLAQIVLPASFVLIALVFTMIVPPFGEYPCLTLTPWMYGP---------------QFTF-----ISNEQPSHPKMKHFIQTLLKDPG-MGTRCMANQPLENI-FTCLNSSSDWEVPPVSPEVSNILSSPEWDSRNP--SPSCECSTDLKLTMLPMCPAGAGGLPPRQ-RKEPTGDILLDMTNRNISDYLVKTYTKLIKTSLKSKYWVNEQRYGGI------SVGGRLPILDVDPEEIQNIFSQLGRMMNIRGGRYSKSAMDELETFLHYMESEYNV--------KVWYNNKGWHAMASFLNVANNAILRAYLPPHA-NPSDYGITAINHPLNLTKEQLSEVTVLTTSVDAVVAICVIFAMSFIPASFVLYLIQERVTKAKHLQFVSGVSPLVYWFANFFWDMLNYSVSTAMVVAIFVGFDKKCYTSPTNLPALIALLCLYGWSVTPMMYPLSYMFNVPSTAYVSLSCINLFIGINSSAITFILELFEN-NRSLLMFNEVLKKVLLVFPHFCLGRGLIDMAMNQA---VTDVYARFGEEFSMDPFRWNFVGKNLFCMAVEGFVYFIFNL-----LIQYKFFLHHWISDYGMSLGTDEDDDVAQERERIYKGGNKNDILLIRDLSKTYRR 1991          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Zebrafish
Match: abca1b (ATP-binding cassette, sub-family A (ABC1), member 1B [Source:ZFIN;Acc:ZDB-GENE-030131-9826])

HSP 1 Score: 301.597 bits (771), Expect = 4.785e-86
Identity = 263/915 (28.74%), Postives = 446/915 (48.74%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK-----------------NFNAQKENFRKGISNSG---DK-------------LLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQ--EPFL--DLEDLNQQAFVDKS----LISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCM-NPSIYRSTHYRCFPEYKNNKWSP--IPNGNIPLI----------SPECDCNTTGYQI----CNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRK-----------LYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIY--GIKT-SFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIK--------KTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFNFRSVCCKNKNNDVENENQKFAVNNLC 2497
             DRIAIIS GKL C GSS+FLK + G GY L LVK                 +F  + +N  +  S++G   D+             + + I  H+P A+M  +   + ++VLP   + +  F  LF +LD+ + +L   SYG+SDT+LEE+F++VA+D + ++ E  ++  +P    R   +G       +P    D  D N+     +S     +S +  +    ++G+ L +QQ + L  KR  YA+R++KG FA+++LP + + + +    +V P    P++ ++PW+                E Q  F            +  T +L      D G  G RCM   SI  +    C     + +WS   +P   I ++          SP C+C+  G +     C     G PP   +I + ++ L NLTG NISDYL+K + ++  K            YGGF     ST     +++   P  EE+ D ++  +    Q   +S    D   K+   +  G+ T +  +IW N+KG+ S+ A+ N+ +N +LR+ L        ++GI+  N P+ + +       +    +++ ++I VIF +SF+PASFV+FL++ERV+ +K  QF+SG+ PY+YW++NFLWD+  Y++P  ++I+IF+ F  ++Y+ + N     LLL+ YG +I P MYP SF    PSTA+VVL + N+L+G   ++STF++++  + +      N+ILK V LIFP + LGRG+ID+  N    +  + + +       +W++  + L ++ +              GV+  ++  +++  +F               ED D++ E+ R+ S     D+L++  LTK+Y R                    QK AV+ LC
Sbjct: 1100 GDRIAIISHGKLCCVGSSLFLKTQLGTGYYLTLVKKNTEPSLSSCRNSSSTVSFVKKDDNASESSSDAGLGSDQESEAATAIVDVTIISRLILKHVPAARMVEDQGHEITYVLPYESAKNGAFVELFHDLDDRLADLGISSYGVSDTTLEEIFLKVAED-SGVDTEMLSDGTLPVRRQRRHAFGADHQSCLKPLTEDDSFDCNESEGDPESKETDYLSGSDGKGSYQVKGWSLKRQQFVALLWKRLLYARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLALNPWMY---------------EEQFMF-----FSEDAPYDVSTHKLLRALFDDPG-FGTRCMKGESIPDAP---C--TMGDEEWSTPEVPESIIEILTTRNWTMNDPSPACECSCNGKKKMLPECPAGAGGLPPPQIKI-SETETLQNLTGRNISDYLVKTYAQIIGKSLKNKIWVNEFRYGGFSLGARST-----QVL---PPAEEIDDAISRVREIF-QLGKDSGSAADRFLKSLSAFINGLDTKNNVKIWFNNKGWHSIGAFLNVMNNGILRANLPPGKDPS-EFGITAYNHPLNLTKEQLSQVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPYLYWLANFLWDMCNYVVPATLVILIFVCFQQKAYVSATNLPVLALLLLLYGWSITPLMYPASFLFKIPSTAYVVLTSVNILIGINGSISTFVMELFGNHE--IGGINDILKNVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFRSPLEWDMVGKNLFAMAV-------------EGVVFFIITVLIQYRFFFEPKSLCPKLSPIGEEDEDVARERQRIMSGAGQGDILELRQLTKVYKR-------------------KQKPAVDRLC 1942          

HSP 2 Score: 51.2174 bits (121), Expect = 5.862e-6
Identity = 34/122 (27.87%), Postives = 60/122 (49.18%), Query Frame = 2
Query:    8 RIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVA 373
            R+AI+  G+ +C GS   LK +FGDGY +IL             G       +++FI+S +P + ++ +      + LP   S+    + +F  L +  + L    Y +S T+L++VF+  A
Sbjct: 2122 RMAIMVNGRFRCLGSVQHLKNRFGDGYTIILRV----------AGPDPDLQPVMKFIESELPGSTLKEKHRNMLQYQLP---SSLTSLAHIFSILAKNKEFLRIEDYSVSQTTLDQVFVNFA 2230          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Zebrafish
Match: abca4b (ATP-binding cassette, sub-family A (ABC1), member 4b [Source:ZFIN;Acc:ZDB-GENE-050517-4])

HSP 1 Score: 300.056 bits (767), Expect = 1.590e-85
Identity = 243/853 (28.49%), Postives = 398/853 (46.66%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQ--KENF--------------------------RKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCF------------PEYKNNKWSPIPNGNIPLISPECDCNT----TGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKY------DAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNR 2410
            SDR+AIIS+GKL C GS +FLK  FG G+ L LV+    Q  KEN                            + +  + + +   I  H+P+AK+      + +++LP        ++ LF  L+E + ++   S+G+SDTSLEE+F++V  D    N        +  + N +    + ++ E                        R  + ++GF L+ +Q   L +KRFH+A R+ K   A+++LP   + + +    +V P    P + ++PW+  P               Q  F     + N+   +P           D G  G RCM      +  + C             PE  N   SP  +   P  SP C+C+T    T   +C     G PP   R   + D L ++T  NISDYL+K + KL +       +V    +G  S + G  P  +     V+  +  +  S L          +   I G       +W N+KG+ +M ++ N+ +N +LR+ L   A    DYGI+  N P+ + +       V    ++  +AI VIF +SFIPASFV++L++ERV+ +K  QFVSG++P VYW +NF WD++ Y +   +++ IF+ FD + Y    N  A I LL  YG ++ P MYP S+  + PSTA+V L+  NL +G  ++  TFIL++ E+ + +    NE+LKKV L+FP + LGRG+ID++ N     +TD YA++      D F W    + L  + +   +++I  +     +I    +    +S +   +   ED D++ E+ R+      +D+L + +L+K Y R
Sbjct: 1097 SDRVAIISKGKLHCSGSPLFLKNCFGVGFYLTLVRRMKDQRKKENECDCASECSCTCSTCTRYKEESQALQPERVLDGNVESITTLIHHHVPEAKLIEMIGQEMTYLLPNKGFKYRAYASLFRELEETLGDMGLSSFGISDTSLEEIFLKVTADGEAANSSIMCVSGLVTDANGVGASLESDSSE-----------------------GRASRQVKGFSLVLKQFHALLVKRFHHATRSHKDFLAQIVLPASFVLIALVFTMIVPPFGEYPCLTLTPWMYGP---------------QFTF-----ISNEQPSHPKMKHFIQTLLKDPG-MGTRCMANQPLENI-FTCLNSSSDWEVPPVSPEVSNILSSPEWDSRNP--SPSCECSTDLKLTMLPMCPAGAGGLPPRQ-RKEPTGDILLDMTNRNISDYLVKTYTKLIKTSLKSKYWVNEQRYGGIS-VGGRLPILD-----VDPEEIQNIFSQLG---------RMMNIRGAFNVLLYVWYNNKGWHAMASFLNVANNAILRAYLPPHA-NPSDYGITAINHPLNLTKEQLSEVTVLTTSVDAVVAICVIFAMSFIPASFVLYLIQERVTKAKHLQFVSGVSPLVYWFANFFWDMLNYSVSTAMVVAIFVGFDKKCYTSPTNLPALIALLCLYGWSVTPMMYPLSYMFNVPSTAYVSLSCINLFIGINSSAITFILELFEN-NRSLLMFNEVLKKVLLVFPHFCLGRGLIDMAMN---QAVTDVYARFGEEFSMDPFRWNFVGKNLFCMAVEGFVYFIFNL-----LIQYKFFLHHWISDYGMSLGTDEDDDVAQERERIYKGGNKNDILLIRDLSKTYRR 1876          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Zebrafish
Match: abca1b (ATP-binding cassette, sub-family A (ABC1), member 1B [Source:ZFIN;Acc:ZDB-GENE-030131-9826])

HSP 1 Score: 297.36 bits (760), Expect = 1.282e-84
Identity = 263/926 (28.40%), Postives = 446/926 (48.16%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK-----------------NFNAQKENFRKGISNSG---DK------------------------LLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQ--EPFL--DLEDLNQQAFVDKS----LISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCM-NPSIYRSTHYRCFPEYKNNKWSP--IPNGNIPLI----------SPECDCNTTGYQI----CNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRK-----------LYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIY--GIKT-SFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIK--------KTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFNFRSVCCKNKNNDVENENQKFAVNNLC 2497
             DRIAIIS GKL C GSS+FLK + G GY L LVK                 +F  + +N  +  S++G   D+                        + + I  H+P A+M  +   + ++VLP   + +  F  LF +LD+ + +L   SYG+SDT+LEE+F++VA+D + ++ E  ++  +P    R   +G       +P    D  D N+     +S     +S +  +    ++G+ L +QQ + L  KR  YA+R++KG FA+++LP + + + +    +V P    P++ ++PW+                E Q  F            +  T +L      D G  G RCM   SI  +    C     + +WS   +P   I ++          SP C+C+  G +     C     G PP   +I + ++ L NLTG NISDYL+K + ++  K            YGGF     ST     +++   P  EE+ D ++  +    Q   +S    D   K+   +  G+ T +  +IW N+KG+ S+ A+ N+ +N +LR+ L        ++GI+  N P+ + +       +    +++ ++I VIF +SF+PASFV+FL++ERV+ +K  QF+SG+ PY+YW++NFLWD+  Y++P  ++I+IF+ F  ++Y+ + N     LLL+ YG +I P MYP SF    PSTA+VVL + N+L+G   ++STF++++  + +      N+ILK V LIFP + LGRG+ID+  N    +  + + +       +W++  + L ++ +              GV+  ++  +++  +F               ED D++ E+ R+ S     D+L++  LTK+Y R                    QK AV+ LC
Sbjct: 1100 GDRIAIISHGKLCCVGSSLFLKTQLGTGYYLTLVKKNTEPSLSSCRNSSSTVSFVKKDDNASESSSDAGLGSDQESEAATAIGTSWPESPVVPVDVTIISRLILKHVPAARMVEDQGHEITYVLPYESAKNGAFVELFHDLDDRLADLGISSYGVSDTTLEEIFLKVAED-SGVDTEMLSDGTLPVRRQRRHAFGADHQSCLKPLTEDDSFDCNESEGDPESKETDYLSGSDGKGSYQVKGWSLKRQQFVALLWKRLLYARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLALNPWMY---------------EEQFMF-----FSEDAPYDVSTHKLLRALFDDPG-FGTRCMKGESIPDAP---C--TMGDEEWSTPEVPESIIEILTTRNWTMNDPSPACECSCNGKKKMLPECPAGAGGLPPPQIKI-SETETLQNLTGRNISDYLVKTYAQIIGKSLKNKIWVNEFRYGGFSLGARST-----QVL---PPAEEIDDAISRVREIF-QLGKDSGSAADRFLKSLSAFINGLDTKNNVKIWFNNKGWHSIGAFLNVMNNGILRANLPPGKDPS-EFGITAYNHPLNLTKEQLSQVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPYLYWLANFLWDMCNYVVPATLVILIFVCFQQKAYVSATNLPVLALLLLLYGWSITPLMYPASFLFKIPSTAYVVLTSVNILIGINGSISTFVMELFGNHE--IGGINDILKNVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFRSPLEWDMVGKNLFAMAV-------------EGVVFFIITVLIQYRFFFEPKSLCPKLSPIGEEDEDVARERQRIMSGAGQGDILELRQLTKVYKR-------------------KQKPAVDRLC 1953          

HSP 2 Score: 51.6026 bits (122), Expect = 5.622e-6
Identity = 34/122 (27.87%), Postives = 60/122 (49.18%), Query Frame = 2
Query:    8 RIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVA 373
            R+AI+  G+ +C GS   LK +FGDGY +IL             G       +++FI+S +P + ++ +      + LP   S+    + +F  L +  + L    Y +S T+L++VF+  A
Sbjct: 2133 RMAIMVNGRFRCLGSVQHLKNRFGDGYTIILRV----------AGPDPDLQPVMKFIESELPGSTLKEKHRNMLQYQLP---SSLTSLAHIFSILAKNKEFLRIEDYSVSQTTLDQVFVNFA 2241          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Xenopus
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:NCBI gene;Acc:100491942])

HSP 1 Score: 316.235 bits (809), Expect = 7.709e-91
Identity = 255/867 (29.41%), Postives = 432/867 (49.83%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFN-----------------AQKENFRKGISNSG---------------------DKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIEN-QEPFLDLE-------DLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIR--CMNPSIYRSTHY---RCFPEYKNNKWSPIPNGNIPLISPECDCNTTGYQ----ICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYF------NNKIKKT--EDFDISLEKNRMNSEQKFDDVLQVINLTKIY 2404
             DRIAIIS GKL C GSS+FLK + G GY L LVK  N                  ++++  +  S++G                       +   I  H+P+A++  +   + ++VLP   +    F  LF  +D+ + +L   SYG++DT+LEE+F++VADD   ++ ET +  L P    R A +GD ++   PF + +       D++ ++     L  ++   +++L + + L++QQ   L  KR  YAKR++KG FA+++LP + + + +    +V P    P++E+ PW+   +       TF+  +        +  G +  +  L D+         G S ++  C       ST +        + N  W+      +   SP C+C++   +    IC  P +GG P   R   +SD L NLTG NISDYL+K + ++  K YGGF                           + AS +     N   +  I++++K  ++  ++  ++ +W N+KG+ ++ A+ N+ +N +LRS+L +       YGI+  N P+ + +       +    +++ ++I VIF +SF+PASFV+FL++ERVS +K  Q +SG+ P +YW++NF+WD+  Y++P  ++IIIFI F   SY+ S N     LLL+ YG +I P MYP SF    PSTA+VVL + NL +G   +++TF+L++   T+      NEILK V LIFP + LGRG+ID+  N    +  + + +        W++    L ++ +              GV+   +  M++  +F      N K+     ED D++ E+ R+N E   +D+L++  LTKIY
Sbjct: 1052 GDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKRDNDSSLSSCRNSSSTMSYLKKEDSVSQSSSDAGLGSDHESDTMTIGKYKSLTDVSAISNLINKHVPEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGIADTTLEEIFLKVADDTG-VDAETSDGTL-PARRKRYA-FGDHQSCLRPFTEDDAFDTNDSDMDPESRETDYLSGIDGKGSYQL-KSWNLMRQQFTALLWKRLLYAKRSRKGFFAQIVLPAVFVLIALVFSLIVPPFGKYPSLELEPWMYDEQY------TFFSNDA------PDDQGTQALLKALIDKPGFGTACMEGHSVMKVSCSGEEEEWSTQFVSQSVMDLFLNGNWT------MENPSPSCECSSDKRKKMLPIC-PPGAGGLPPFQRRQNTSDILQNLTGRNISDYLVKTYSQIIEKRYGGFS--------------------------LGASNSPALPPNEEVVASINHIKKRLELPQVEYLYSVVWFNNKGWHAVGAFLNVMNNAILRSKL-REGEDPASYGITAFNHPLNLTKEQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHMQCISGVKPVIYWLANFVWDMCNYVVPATLVIIIFICFQQDSYVSSSNLPVLALLLLLYGWSITPLMYPASFIFKIPSTAYVVLTSVNLFIGINGSVATFVLELF--TNNKLSNINEILKSVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPMSWDLVGRNLFAMAV-------------EGVVFFAITLMIQYRFFIKPRPVNAKLPPVVDEDEDVARERQRIN-EGGRNDILELKGLTKIY 1852          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Xenopus
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:NCBI gene;Acc:100491942])

HSP 1 Score: 315.849 bits (808), Expect = 1.145e-90
Identity = 262/866 (30.25%), Postives = 436/866 (50.35%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFN-----------------AQKENFRKGISNSG--------------DKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIEN-QEPFLDLE-------DLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIR--CMNPSIYRSTHY---RCFPEYKNNKWSPIPNGNIPLISPECDCNTTGYQ----ICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLN------SLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYF------NNKIKKT--EDFDISLEKNRMNSEQKFDDVLQVINLTKIY 2404
             DRIAIIS GKL C GSS+FLK + G GY L LVK  N                  ++++  +  S++G                +   I  H+P+A++  +   + ++VLP   +    F  LF  +D+ + +L   SYG++DT+LEE+F++VADD   ++ ET +  L P    R A +GD ++   PF + +       D++ ++     L  ++   +++L + + L++QQ   L  KR  YAKR++KG FA+++LP + + + +    +V P    P++E+ PW+   +       TF+  +        +  G +  +  L D+         G S ++  C       ST +        + N  W+      +   SP C+C++   +    IC  P +GG P   R   +SD L NLTG NISDYL+K + ++  K YGGF      + G S     +SP      + V  +  NH +  L       + +F+D      K    K +  ++W N+KG+ ++ A+ N+ +N +LRS+L +       YGI+  N P+ + +       +    +++ ++I VIF +SF+PASFV+FL++ERVS +K  Q +SG+ P +YW++NF+WD+  Y++P  ++IIIFI F   SY+ S N     LLL+ YG +I P MYP SF    PSTA+VVL + NL +G   +++TF+L++   T+      NEILK V LIFP + LGRG+ID+  N    +  + + +        W++    L ++ +              GV+   +  M++  +F      N K+     ED D++ E+ R+N E   +D+L++  LTKIY
Sbjct: 1097 GDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKRDNDSSLSSCRNSSSTMSYLKKEDSVSQSSSDAGLGSDHESDTMTIDVSAISNLINKHVPEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGIADTTLEEIFLKVADDTG-VDAETSDGTL-PARRKRYA-FGDHQSCLRPFTEDDAFDTNDSDMDPESRETDYLSGIDGKGSYQL-KSWNLMRQQFTALLWKRLLYAKRSRKGFFAQIVLPAVFVLIALVFSLIVPPFGKYPSLELEPWMYDEQY------TFFSND------APDDQGTQALLKALIDKPGFGTACMEGHSVMKVSCSGEEEEWSTQFVSQSVMDLFLNGNWT------MENPSPSCECSSDKRKKMLPIC-PPGAGGLPPFQRRQNTSDILQNLTGRNISDYLVKTYSQIIEKRYGGF------SLGAS-----NSPALPPNEEVV--ASINHIKKRLELPQNGAANRFLDSFGAFMKGLDTKDN-VKVWFNNKGWHAVGAFLNVMNNAILRSKL-REGEDPASYGITAFNHPLNLTKEQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHMQCISGVKPVIYWLANFVWDMCNYVVPATLVIIIFICFQQDSYVSSSNLPVLALLLLLYGWSITPLMYPASFIFKIPSTAYVVLTSVNLFIGINGSVATFVLELF--TNNKLSNINEILKSVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPMSWDLVGRNLFAMAV-------------EGVVFFAITLMIQYRFFIKPRPVNAKLPPVVDEDEDVARERQRIN-EGGRNDILELKGLTKIY 1908          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Xenopus
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:NCBI gene;Acc:100491942])

HSP 1 Score: 315.079 bits (806), Expect = 2.162e-90
Identity = 254/863 (29.43%), Postives = 430/863 (49.83%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFN-----------------AQKENFRKGISNSG-----------------DKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIEN-QEPFLDLE-------DLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIR--CMNPSIYRSTHY---RCFPEYKNNKWSPIPNGNIPLISPECDCNTTGYQ----ICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYF------NNKIKKT--EDFDISLEKNRMNSEQKFDDVLQVINLTKIY 2404
             DRIAIIS GKL C GSS+FLK + G GY L LVK  N                  ++++  +  S++G                   +   I  H+P+A++  +   + ++VLP   +    F  LF  +D+ + +L   SYG++DT+LEE+F++VADD   ++ ET +  L P    R A +GD ++   PF + +       D++ ++     L  ++   +++L + + L++QQ   L  KR  YAKR++KG FA+++LP + + + +    +V P    P++E+ PW+   +       TF+  +        +  G +  +  L D+         G S ++  C       ST +        + N  W+      +   SP C+C++   +    IC  P +GG P   R   +SD L NLTG NISDYL+K + ++  K YGGF                           + AS +     N   +  I++++K  ++  ++  ++ +W N+KG+ ++ A+ N+ +N +LRS+L +       YGI+  N P+ + +       +    +++ ++I VIF +SF+PASFV+FL++ERVS +K  Q +SG+ P +YW++NF+WD+  Y++P  ++IIIFI F   SY+ S N     LLL+ YG +I P MYP SF    PSTA+VVL + NL +G   +++TF+L++          TN ILK V LIFP + LGRG+ID+  N    +  + + +        W++    L ++ +              GV+   +  M++  +F      N K+     ED D++ E+ R+N E   +D+L++  LTKIY
Sbjct: 1067 GDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKRDNDSSLSSCRNSSSTMSYLKKEDSVSQSSSDAGLGSDHESDTMTIGLTDVSAISNLINKHVPEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGIADTTLEEIFLKVADDTG-VDAETSDGTL-PARRKRYA-FGDHQSCLRPFTEDDAFDTNDSDMDPESRETDYLSGIDGKGSYQL-KSWNLMRQQFTALLWKRLLYAKRSRKGFFAQIVLPAVFVLIALVFSLIVPPFGKYPSLELEPWMYDEQY------TFFSNDA------PDDQGTQALLKALIDKPGFGTACMEGHSVMKVSCSGEEEEWSTQFVSQSVMDLFLNGNWT------MENPSPSCECSSDKRKKMLPIC-PPGAGGLPPFQRRQNTSDILQNLTGRNISDYLVKTYSQIIEKRYGGFS--------------------------LGASNSPALPPNEEVVASINHIKKRLELPQVEYLYSVVWFNNKGWHAVGAFLNVMNNAILRSKL-REGEDPASYGITAFNHPLNLTKEQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHMQCISGVKPVIYWLANFVWDMCNYVVPATLVIIIFICFQQDSYVSSSNLPVLALLLLLYGWSITPLMYPASFIFKIPSTAYVVLTSVNLFIGINGSVATFVLELF---------TNNILKSVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPMSWDLVGRNLFAMAV-------------EGVVFFAITLMIQYRFFIKPRPVNAKLPPVVDEDEDVARERQRIN-EGGRNDILELKGLTKIY 1856          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Xenopus
Match: klf9 (Kruppel-like factor 9 [Source:Xenbase;Acc:XB-GENE-483889])

HSP 1 Score: 313.153 bits (801), Expect = 1.048e-89
Identity = 262/885 (29.60%), Postives = 426/885 (48.14%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISN-------------------------SGD--KLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISL-------NFN------RNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWS-PIPNGNIPLI-----------SPECDCNTTGYQI----CNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSR-----------KLYGGFQF--VLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLK-FIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKY------DAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVL-----YRMLKVSYFNNKIK---KTEDFDISLEKNRMNSEQKFDDVLQVINLTKIY 2404
             DRIAI+SQGKL C GS +FLK  FG G+ L LV+     K+  +K  ++                          GD   L + I  H+P+AK+      +  ++LP  D     ++ LF  L+E + +L   S+G+SDT LEE+F++V  D +    ET  E ++    +R ++   ++NQ   +++++  Q++ + K            N N      R  + ++G  LL+QQ   L IKRF +A R+ K  FA+++LP   + L +    +V P    P++ + PW+                  Q  F    Q GN+           + + +  G  G RCM      S  Y+C     +N+W+ P  + ++  +           SP C C++    +    C +   G PP   RI  SS+ + +LT  NISD+LLK +P L R           + YGG      LP        ++    F+ ++    N +     ++    L+ F+  L+    I        ++W N+KG+ SM  + N+ +N  +      +     ++GI+  N P+ + +       V    +++ +AI VIF +SFIPASFV++L++ERVS +K  QFVSG+ P +YW++NF WDI+ Y I + +++IIFIAFD ++Y  S N  A I LL FYG A+IP MYP S+  + PSTA+V L+  NL +G  ++  TFILD+ E+ + +    NE LK + LIFP + LGRG+IDL+ N     +TD YA++      + F WE     + ++ +              GV+   L     +R    ++F+   K   + ED D++ E+ R+      +D+L++  LTK Y
Sbjct: 1195 GDRIAIVSQGKLFCSGSPLFLKNCFGTGFYLTLVRRMRNIKDTGKKDSASCQSDCSCPCSSCTPKVKENLLEQELDGDVSGLTELIHHHVPEAKLLESIGQELIYLLPSKDFKFRAYASLFRELEETLGDLGLSSFGISDTPLEEIFLKVTAD-SVTGTETPEEWMLQQRKSRTSL--GVDNQTTVINIDNKGQESSIRKDSHHCKAEKNPPNINDREADGRGSRQIKGTELLQQQFNALIIKRFKHATRSHKDFFAQIVLPASFVLLALVFTLIVPPFGEYPSLTLHPWIY---------------GQQFVFFSNEQPGNEQMAT-----FSNAFLNSPG-LGTRCMKDQPL-SKKYQC--TNTSNEWTMPAVSPSVTNMLLSQEWTRDNPSPSCTCSSRSKLMMLPECPEGAGGRPPPQ-RIQPSSEIIQDLTERNISDFLLKTYPDLIRSSMKSKYWVNEQRYGGISVGGKLPVLHVKGGDIVS---FFSQVGQMTNVTAGTTTKAISQELQTFLQNLETEDNI--------KVWFNNKGWHSMVIFINV-ANNAILRANLGADKDPEEFGITTMNHPLNLTKDQLSEVTVLTTSVDVVVAICVIFAMSFIPASFVLYLIQERVSNAKHLQFVSGVTPAIYWLTNFAWDIINYAISVAMVVIIFIAFDKKAYTSSSNLPALIALLFFYGWAVIPMMYPASYLFNVPSTAYVALSCINLFIGINSSAITFILDLFEN-NRSLLKFNEKLKDLLLIFPHFCLGRGLIDLAMNQA---VTDVYARFGEEHVSNPFQWEFLGRNIFAMAV-------------EGVVYFTLNLLIQHRFFFSTWFSEPPKGLVEGEDEDVAQERQRVIKGGGKNDILKLKELTKTY 2022          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Xenopus
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:NCBI gene;Acc:100491942])

HSP 1 Score: 311.612 bits (797), Expect = 2.701e-89
Identity = 257/864 (29.75%), Postives = 423/864 (48.96%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFN-----------------AQKENFRKGISNSG--------------DKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIEN-QEPFLDLE-------DLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHY---RCFPEYKNNKWSPIPNGNIPLISPECDCNTTGYQ----ICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQF------VLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYF------NNKIKKT--EDFDISLEKNRMNSEQKFDDVLQVINLTKIY 2404
             DRIAIIS GKL C GSS+FLK + G GY L LVK  N                  ++++  +  S++G                +   I  H+P+A++  +   + ++VLP   +    F  LF  +D+ + +L   SYG++DT+LEE+F++VADD   ++ ET +  L P    R A +GD ++   PF + +       D++ ++     L  ++   +++L + + L++QQ   L  KR  YAKR++KG FA+++LP + + + +    +V P    P++E+ PW+   +       TF+  +        +  G +  +  L D+         G +   C       ST +        + N  W+      +   SP C+C++   +    IC  P +GG P   R   +SD L NLTG NISDYL+K + ++  K YGGF         LPS  G   K+ G          F+       N                           ++W N+KG+ ++ A+ N+ +N +LRS+L +       YGI+  N P+ + +       +    +++ ++I VIF +SF+PASFV+FL++ERVS +K  Q +SG+ P +YW++NF+WD+  Y++P  ++IIIFI F   SY+ S N     LLL+ YG +I P MYP SF    PSTA+VVL + NL +G   +++TF+L++   T+      NEILK V LIFP + LGRG+ID+  N    +  + + +        W++    L ++ +              GV+   +  M++  +F      N K+     ED D++ E+ R+N E   +D+L++  LTKIY
Sbjct: 1064 GDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKRDNDSSLSSCRNSSSTMSYLKKEDSVSQSSSDAGLGSDHESDTMTIDVSAISNLINKHVPEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGIADTTLEEIFLKVADDTG-VDAETSDGTL-PARRKRYA-FGDHQSCLRPFTEDDAFDTNDSDMDPESRETDYLSGIDGKGSYQL-KSWNLMRQQFTALLWKRLLYAKRSRKGFFAQIVLPAVFVLIALVFSLIVPPFGKYPSLELEPWMYDEQY------TFFSNDA------PDDQGTQALLKALIDK------PGFG-TAFSCSGEEEEWSTQFVSQSVMDLFLNGNWT------MENPSPSCECSSDKRKKMLPIC-PPGAGGLPPFQRRQNTSDILQNLTGRNISDYLVKTYSQIIEKRYGGFSLGASNSPALPSVVGKLLKIFGA---------FMKGLDTKDN--------------------------VKVWFNNKGWHAVGAFLNVMNNAILRSKL-REGEDPASYGITAFNHPLNLTKEQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHMQCISGVKPVIYWLANFVWDMCNYVVPATLVIIIFICFQQDSYVSSSNLPVLALLLLLYGWSITPLMYPASFIFKIPSTAYVVLTSVNLFIGINGSVATFVLELF--TNNKLSNINEILKSVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPMSWDLVGRNLFAMAV-------------EGVVFFAITLMIQYRFFIKPRPVNAKLPPVVDEDEDVARERQRIN-EGGRNDILELKGLTKIY 1845          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Mouse
Match: Abca1 (ATP-binding cassette, sub-family A (ABC1), member 1 [Source:MGI Symbol;Acc:MGI:99607])

HSP 1 Score: 296.59 bits (758), Expect = 3.071e-84
Identity = 257/879 (29.24%), Postives = 438/879 (49.83%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK-----------------NFNAQKENFRKGISNSG--------------DKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIEN-QEPFL--DLEDLNQQAFVDKS----LISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIP--------NGNIPL--ISPECDCNTTGYQ----ICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRK-----------LYGGFQFVLPSTFGWS-SKLIGDSPFWEELRDFVNASQANHNQSNLNSL-KFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYF--NNKIKKT------EDFDISLEKNRMNSEQKFDDVLQVINLTKIYNR 2410
             DRIAIIS GKL C GSS+FLK + G GY L LVK                 +   ++++  +  S++G                +   I+ H+ +A++  +   + ++VLP   +    F  LF  +D+ + +L   SYG+S+T+LEE+F++VA++ + ++ ET +  L P   NR A +GD ++   PF   D  D N      +S    L+S    +    L+G+ L +QQ + L  KR   A+R++KG FA+++LP + + + +    +V P    P++E+ PW+            +  +   ++      +G +  +N LT         D G  G RCM  +    T   C    ++   SP+P        NGN  +   SP C C++   +    +C     G P    R   ++D L NLTG NISDYL+K + ++  K            YGGF   + ++     S  + D+   ++++  +  ++ +     L+SL +F+  L     +        ++W N+KG+ ++ ++ N+ +N +LR+ L K       YGI+  N P+ + +       +    +++ ++I VIF +SF+PASFV+FL++ERVS +K  QF+SG+ P +YW+SNF+WD+  Y++P  ++IIIFI F  +SY+ S N     LLL+ YG +I P MYP SF    PSTA+VVL + NL +G   +++TF+L++   T+      N+ILK VFLIFP + LGRG+ID+  N    +  + + +        W++    L ++ +              GV+  ++  +++  +F     +K        ED D+  E+ R+      +D+L++  LTKIY R
Sbjct: 1098 GDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSCLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEE-SGVDAETSDGTL-PARRNRRA-FGDKQSCLHPFTEDDAVDPNDSDIDPESRETDLLSGMDGKGSYQLKGWKLTQQQFVALLWKRLLIARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLELQPWM------------YNEQYTFVSNDAPEDMGTQELLNALT--------KDPG-FGTRCMEGNPIPDTP--CLAGEEDWTISPVPQSIVDLFQNGNWTMKNPSPACQCSSDKIKKMLPVCPPGAGGLP-PPQRKQKTADILQNLTGRNISDYLVKTYVQIIAKSLKNKIWVNEFRYGGFSLGVSNSQALPPSHEVNDAI--KQMKKLLKLTKDSSADRFLSSLGRFMAGLDTKNNV--------KVWFNNKGWHAISSFLNVINNAILRANLQKGE-NPSQYGITAFNHPLNLTKQQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHLQFISGVKPVIYWLSNFVWDMCNYVVPATLVIIIFICFQQKSYVSSTNLPVLALLLLLYGWSITPLMYPASFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELF--TNNKLNDINDILKSVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPLSWDLVGRNLFAMAV-------------EGVVFFLITVLIQYRFFIRPRPVKAKLPPLNDEDEDVRRERQRILDGGGQNDILEIKELTKIYRR 1923          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Mouse
Match: Abca4 (ATP-binding cassette, sub-family A (ABC1), member 4 [Source:MGI Symbol;Acc:MGI:109424])

HSP 1 Score: 295.819 bits (756), Expect = 5.904e-84
Identity = 248/886 (27.99%), Postives = 421/886 (47.52%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILV---KNFNAQKENFR-------KGISN---------------SGD--KLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPA----------KINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIR--------CMNPSIYRS-------THYRCFPEYKNNKWSPIPNGNIPLISPECDCNT----TGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSR-----------KLYGGFQF--VLPSTFGWSSKLIGDSPFWEELRDFVNASQAN-HNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKY------DAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKKT--------EDFDISLEKNRMNSEQKFDDVLQVINLTKIYN 2407
             DRIAIISQG+L C G+ +FLK  FG G+ L LV   KN  +Q+           KG S                 GD  +L+  +  H+P+AK+      +  F+LP  +     ++ LF  L+E + +L   S+G+SDT LEE+F++V +D            +  E+            ++  Y    +      ++    Q   +     + FN   +L+       Q +  L +KRFH+  R++K   A+++LP   + L + L  +V P    PA+ + PW+                 +Q  F   ++  N++ +  L D L +  R   G   ++        C+N + +++       TH      ++  KW+          SP C C+T    T    C +  +GG P   R   S++ L +LT  NISDYL+K +P L R           + YGG      LP+       L+G   F   L   +N S      +++   L F+ +L+ T  I        ++W N+KG+ ++ ++ N+  N +LR+ L +      +YGI+V + P+ + +       V    ++  +AI VIF +SF+PASFV++L++ERV+ +K  QF+SG++P  YW++NFLWDIM Y +   +++ IFI F  ++Y    N  A + LL+ YG A+IP MYP SF    PSTA+V L+  NL +G  ++  TF+L++ E+     R  N +L+K+ ++FP + LGRG+IDL+   +   +TD YA++      + F W++  + L ++ +              GV+  +L  +++  +F  +            ED D++ E+ R+ S     D+L++  LTK+Y+
Sbjct: 1127 GDRIAIISQGRLYCSGTPLFLKNCFGTGFYLTLVRKMKNIQSQRGGCEGVCSCTSKGFSTRCPTRVDEITEEQVLDGDVQELMDLVYHHVPEAKLVECIGQELIFLLPNKNFKQRAYASLFRELEETLADLGLSSFGISDTPLEEIFLKVTEDAGAGSMFVGGAQQKREQAGLRHPCSAPTEKLRQYAQAPHTCSPGQVDPPKGQPSPEPEDPGVPFNTGARLIL------QHVQALLVKRFHHTIRSRKDFVAQIVLPATFVFLALMLSIIVPPFGEFPALTLHPWMY---------------GHQYTFFSMDEPNNEH-LEVLADVLLN--RPGFGNRCLKEEWLPEYPCINATSWKTPSVSPNITHL-----FQKQKWTAAHP------SPSCKCSTREKLTMLPECPE-GAGGLPPPQRTQRSTEVLQDLTNRNISDYLVKTYPALIRSSLKSKFWVNEQRYGGISIGGKLPAIPISGEALVG---FLSGLGQMMNVSGGPVTREASKEMLDFLKHLETTDNI--------KVWFNNKGWHALVSFLNVAHNAILRASLPRDRDP-EEYGITVISQPLNLTKEQLSDITVLTTSVDAVVAICVIFAMSFVPASFVLYLIQERVTKAKHLQFISGVSPTTYWLTNFLWDIMNYAVSAGLVVGIFIGFQKKAYTSPDNLPALVSLLMLYGWAVIPMMYPASFLFEVPSTAYVALSCANLFIGINSSAITFVLELFENNRTLLR-FNAMLRKLLIVFPHFCLGRGLIDLA---LSQAVTDVYAQFGEEYSANPFQWDLIGKNLVAMAI-------------EGVVYFLLTLLIQHHFFLTRWIAEPAREPVFDEDDDVAEERQRVMSGGNKTDILKLNELTKVYS 1947          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Mouse
Match: Abca7 (ATP-binding cassette, sub-family A (ABC1), member 7 [Source:MGI Symbol;Acc:MGI:1351646])

HSP 1 Score: 272.707 bits (696), Expect = 2.613e-76
Identity = 249/890 (27.98%), Postives = 422/890 (47.42%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK-------------------------NFNAQKENFRKGISN---------------SGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIY-------RSTH----YRCFPEYKNNKWSPIPNGN-IP-LISPECDCNTTGYQI----CNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRK-----------LYGGFQFV-----LPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFT-RIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKY------DAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVL----YRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFN 2419
             DR+A+++ G L CCGS +FL+R  G GY L LVK                         N       F +G S+               S  ++L+ ++ H+P A++  +   +   VLP   +    F+ +F  LD++++ L    YG+SDT+LEE+F++V +D  +   +++ +     +L           +   L+  +L  Q              N   ++G+ L  QQ+  L  KRF  A+R+++G+FA+++LP L + L +    +V P    P +++SP +  P               Q++F   +  G+ N +  L         + LGE+G++   PS+          TH    Y   PE   +  S + +GN  P   SP C C+  G +     C     G P     +    + + NLTG N+SD+L+K +P L R+            YGGF        LP+       L        E+R  ++    N     LN+L        T    G+    + +IW N+KG+ +M A+ N  +N LL + L    V+   + I+  N P+ + +       +    +++ ++I V+F +SF+PASF + L+EER++ +K  Q VSG+   +YW+ NFLWD+  Y++ + I++ IF+AF  ++Y+  +N  A +LLL+ YG +I P MYP SFF S PSTA+VVL   NL +G  ++M+TF+L+++  +D+  +  + ILK+VFLIFP + LGRG+ID+  N     M D + +           W++  + L +++    L+ +I ++++    NR+L     R+L            ED D++ E+ R+       DVL + +LTK+Y    N
Sbjct: 1002 GDRVAMVAGGSLCCCGSPLFLRRHLGCGYYLTLVKSSQSLVTHDAKGDSEDPRREKKSDGNGRTSDTAFTRGTSDKSNQAPAPGAVPITPSTARILELVQQHVPGAQLVEDLPHELLLVLPYAGALDGSFAMVFQELDQQLELLGLTGYGISDTNLEEIFLKVVEDAHREGGDSRPQL----HLRTCTPQPPTGPEASVLENGELAPQGLAP----------NAAQVQGWTLTCQQLRALLHKRFLLARRSRRGLFAQVVLPALFVGLALFFSLIVPPFGQYPPLQLSPAMYGP---------------QVSFFSEDAPGDPNRMKLL--------EALLGEAGLQ--EPSMQDKDARGSECTHSLACYFTVPEVPPDVASILASGNWTPESPSPACQCSQPGARRLLPDCPAGAGGPP-PPQAVAGLGEVVQNLTGRNVSDFLVKTYPSLVRRGLKTKKWVDEVRYGGFSLGGRDPDLPTGHEVVRTL-------AEIRALLSPQPGNALDRILNNL--------TQWALGLDARNSLKIWFNNKGWHAMVAFVNRANNGLLHALLPSGPVRHA-HSITTLNHPLNLTKEQLSEATLIASSVDVLVSICVVFAMSFVPASFTLVLIEERITRAKHLQLVSGLPQTLYWLGNFLWDMCNYLVAVCIVVFIFLAFQQRAYVAPENLPALLLLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINSSMATFVLELL--SDQNLQEVSRILKQVFLIFPHFCLGRGLIDMVRN---QAMADAFERLGDKQFQSPLRWDIIGKNLLAMMAQGPLFLLITLLLQH--RNRLLPQSKPRLLPP-------LGEEDEDVAQERERVTKGATQGDVLVLRDLTKVYRGQRN 1821          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Mouse
Match: Abca7 (ATP-binding cassette, sub-family A (ABC1), member 7 [Source:MGI Symbol;Acc:MGI:1351646])

HSP 1 Score: 272.707 bits (696), Expect = 2.613e-76
Identity = 249/890 (27.98%), Postives = 422/890 (47.42%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK-------------------------NFNAQKENFRKGISN---------------SGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIY-------RSTH----YRCFPEYKNNKWSPIPNGN-IP-LISPECDCNTTGYQI----CNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRK-----------LYGGFQFV-----LPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFT-RIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKY------DAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVL----YRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFN 2419
             DR+A+++ G L CCGS +FL+R  G GY L LVK                         N       F +G S+               S  ++L+ ++ H+P A++  +   +   VLP   +    F+ +F  LD++++ L    YG+SDT+LEE+F++V +D  +   +++ +     +L           +   L+  +L  Q              N   ++G+ L  QQ+  L  KRF  A+R+++G+FA+++LP L + L +    +V P    P +++SP +  P               Q++F   +  G+ N +  L         + LGE+G++   PS+          TH    Y   PE   +  S + +GN  P   SP C C+  G +     C     G P     +    + + NLTG N+SD+L+K +P L R+            YGGF        LP+       L        E+R  ++    N     LN+L        T    G+    + +IW N+KG+ +M A+ N  +N LL + L    V+   + I+  N P+ + +       +    +++ ++I V+F +SF+PASF + L+EER++ +K  Q VSG+   +YW+ NFLWD+  Y++ + I++ IF+AF  ++Y+  +N  A +LLL+ YG +I P MYP SFF S PSTA+VVL   NL +G  ++M+TF+L+++  +D+  +  + ILK+VFLIFP + LGRG+ID+  N     M D + +           W++  + L +++    L+ +I ++++    NR+L     R+L            ED D++ E+ R+       DVL + +LTK+Y    N
Sbjct: 1002 GDRVAMVAGGSLCCCGSPLFLRRHLGCGYYLTLVKSSQSLVTHDAKGDSEDPRREKKSDGNGRTSDTAFTRGTSDKSNQAPAPGAVPITPSTARILELVQQHVPGAQLVEDLPHELLLVLPYAGALDGSFAMVFQELDQQLELLGLTGYGISDTNLEEIFLKVVEDAHREGGDSRPQL----HLRTCTPQPPTGPEASVLENGELAPQGLAP----------NAAQVQGWTLTCQQLRALLHKRFLLARRSRRGLFAQVVLPALFVGLALFFSLIVPPFGQYPPLQLSPAMYGP---------------QVSFFSEDAPGDPNRMKLL--------EALLGEAGLQ--EPSMQDKDARGSECTHSLACYFTVPEVPPDVASILASGNWTPESPSPACQCSQPGARRLLPDCPAGAGGPP-PPQAVAGLGEVVQNLTGRNVSDFLVKTYPSLVRRGLKTKKWVDEVRYGGFSLGGRDPDLPTGHEVVRTL-------AEIRALLSPQPGNALDRILNNL--------TQWALGLDARNSLKIWFNNKGWHAMVAFVNRANNGLLHALLPSGPVRHA-HSITTLNHPLNLTKEQLSEATLIASSVDVLVSICVVFAMSFVPASFTLVLIEERITRAKHLQLVSGLPQTLYWLGNFLWDMCNYLVAVCIVVFIFLAFQQRAYVAPENLPALLLLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINSSMATFVLELL--SDQNLQEVSRILKQVFLIFPHFCLGRGLIDMVRN---QAMADAFERLGDKQFQSPLRWDIIGKNLLAMMAQGPLFLLITLLLQH--RNRLLPQSKPRLLPP-------LGEEDEDVAQERERVTKGATQGDVLVLRDLTKVYRGQRN 1821          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Mouse
Match: Abca7 (ATP-binding cassette, sub-family A (ABC1), member 7 [Source:MGI Symbol;Acc:MGI:1351646])

HSP 1 Score: 271.937 bits (694), Expect = 5.009e-76
Identity = 251/890 (28.20%), Postives = 421/890 (47.30%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK-------------------------NFNAQKENFRKGISN---------------SGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIY-------RSTH----YRCFPEYKNNKWSPIPNGN-IP-LISPECDCNTTGYQI----CNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRK-----------LYGGFQFV-----LPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFT-RIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKY------DAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVL----YRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFN 2419
             DR+A+++ G L CCGS +FL+R  G GY L LVK                         N       F +G S+               S  ++L+ ++ H+P A++  +   +   VLP   +    F+ +F  LD++++ L    YG+SDT+LEE+F++V +D  +   +++     P    R          E  + LE+      V           N   ++G+ L  QQ+  L  KRF  A+R+++G+FA+++LP L + L +    +V P    P +++SP +  P               Q++F   +  G+ N +  L         + LGE+G++   PS+          TH    Y   PE   +  S + +GN  P   SP C C+  G +     C     G P     +    + + NLTG N+SD+L+K +P L R+            YGGF        LP+       L        E+R  ++    N     LN+L        T    G+    + +IW N+KG+ +M A+ N  +N LL + L    V+   + I+  N P+ + +       +    +++ ++I V+F +SF+PASF + L+EER++ +K  Q VSG+   +YW+ NFLWD+  Y++ + I++ IF+AF  ++Y+  +N  A +LLL+ YG +I P MYP SFF S PSTA+VVL   NL +G  ++M+TF+L+++  +D+  +  + ILK+VFLIFP + LGRG+ID+  N     M D + +           W++  + L +++    L+ +I ++++    NR+L     R+L            ED D++ E+ R+       DVL + +LTK+Y    N
Sbjct: 1002 GDRVAMVAGGSLCCCGSPLFLRRHLGCGYYLTLVKSSQSLVTHDAKGDSEDPRREKKSDGNGRTSDTAFTRGTSDKSNQAPAPGAVPITPSTARILELVQQHVPGAQLVEDLPHELLLVLPYAGALDGSFAMVFQELDQQLELLGLTGYGISDTNLEEIFLKVVEDAHREGGDSR-----PQLHLRTCTPQPPTGPEASV-LENGELAKLVLDPQAPQGLAPNAAQVQGWTLTCQQLRALLHKRFLLARRSRRGLFAQVVLPALFVGLALFFSLIVPPFGQYPPLQLSPAMYGP---------------QVSFFSEDAPGDPNRMKLL--------EALLGEAGLQ--EPSMQDKDARGSECTHSLACYFTVPEVPPDVASILASGNWTPESPSPACQCSQPGARRLLPDCPAGAGGPP-PPQAVAGLGEVVQNLTGRNVSDFLVKTYPSLVRRGLKTKKWVDEVRYGGFSLGGRDPDLPTGHEVVRTL-------AEIRALLSPQPGNALDRILNNL--------TQWALGLDARNSLKIWFNNKGWHAMVAFVNRANNGLLHALLPSGPVRHA-HSITTLNHPLNLTKEQLSEATLIASSVDVLVSICVVFAMSFVPASFTLVLIEERITRAKHLQLVSGLPQTLYWLGNFLWDMCNYLVAVCIVVFIFLAFQQRAYVAPENLPALLLLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINSSMATFVLELL--SDQNLQEVSRILKQVFLIFPHFCLGRGLIDMVRN---QAMADAFERLGDKQFQSPLRWDIIGKNLLAMMAQGPLFLLITLLLQH--RNRLLPQSKPRLLPP-------LGEEDEDVAQERERVTKGATQGDVLVLRDLTKVYRGQRN 1829          
BLAST of ATP-binding cassette sub-family A member 1 vs. UniProt/SwissProt
Match: sp|O95477|ABCA1_HUMAN (Phospholipid-transporting ATPase ABCA1 OS=Homo sapiens OX=9606 GN=ABCA1 PE=1 SV=3)

HSP 1 Score: 298.13 bits (762), Expect = 6.509e-84
Identity = 259/881 (29.40%), Postives = 440/881 (49.94%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK-----------------NFNAQKENFRKGISNSG--------------DKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIEN-QEPFL--DLEDLNQQAFVDKS----LISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKW--SPIP--------NGNIPL--ISPECDCNTTGYQ----ICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRK-----------LYGGFQFVLPSTFGWS-SKLIGDSPFWEELRDFVNASQANHNQSNLNSL-KFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYF------NNKIKKT--EDFDISLEKNRMNSEQKFDDVLQVINLTKIYNR 2410
             DRIAIIS GKL C GSS+FLK + G GY L LVK                 ++  ++++  +  S++G                +   I+ H+ +A++  +   + ++VLP   +    F  LF  +D+ + +L   SYG+S+T+LEE+F++VA++ + ++ ET +  L P   NR A +GD ++   PF   D  D N      +S    L+S    +    ++G+ L +QQ + L  KR   A+R++KG FA+++LP + + + +    +V P    P++E+ PW+            +  +   ++       G    +N LT         D G  G RCM  +    T  +   E    +W  +P+P        NGN  +   SP C C++   +    +C     G P    R   ++D L +LTG NISDYL+K + ++  K            YGGF   + +T     S+ + D+   ++++  +  ++ +     LNSL +F+  L     +        ++W N+KG+ ++ ++ N+ +N +LR+ L K       YGI+  N P+ + +       +    +++ ++I VIF +SF+PASFV+FL++ERVS +K  QF+SG+ P +YW+SNF+WD+  Y++P  ++IIIFI F  +SY+ S N     LLL+ YG +I P MYP SF    PSTA+VVL + NL +G   +++TF+L++   TD      N+ILK VFLIFP + LGRG+ID+  N    +  + + +        W++    L ++ +              GV+  ++  +++  +F      N K+     ED D+  E+ R+      +D+L++  LTKIY R
Sbjct: 1098 GDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSYLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEE-SGVDAETSDGTL-PARRNRRA-FGDKQSCLRPFTEDDAADPNDSDIDPESRETDLLSGMDGKGSYQVKGWKLTQQQFVALLWKRLLIARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLELQPWM------------YNEQYTFVSNDAPEDTGTLELLNALT--------KDPG-FGTRCMEGNPIPDTPCQAGEE----EWTTAPVPQTIMDLFQNGNWTMQNPSPACQCSSDKIKKMLPVCPPGAGGLP-PPQRKQNTADILQDLTGRNISDYLVKTYVQIIAKSLKNKIWVNEFRYGGFSLGVSNTQALPPSQEVNDAI--KQMKKHLKLAKDSSADRFLNSLGRFMTGLDTKNNV--------KVWFNNKGWHAISSFLNVINNAILRANLQKGE-NPSHYGITAFNHPLNLTKQQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHLQFISGVKPVIYWLSNFVWDMCNYVVPATLVIIIFICFQQKSYVSSTNLPVLALLLLLYGWSITPLMYPASFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELF--TDNKLNNINDILKSVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPLSWDLVGRNLFAMAV-------------EGVVFFLITVLIQYRFFIRPRPVNAKLSPLNDEDEDVRRERQRILDGGGQNDILEIKELTKIYRR 1923          
BLAST of ATP-binding cassette sub-family A member 1 vs. UniProt/SwissProt
Match: sp|P41233|ABCA1_MOUSE (Phospholipid-transporting ATPase ABCA1 OS=Mus musculus OX=10090 GN=Abca1 PE=1 SV=4)

HSP 1 Score: 296.59 bits (758), Expect = 2.148e-83
Identity = 257/879 (29.24%), Postives = 438/879 (49.83%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK-----------------NFNAQKENFRKGISNSG--------------DKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIEN-QEPFL--DLEDLNQQAFVDKS----LISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIP--------NGNIPL--ISPECDCNTTGYQ----ICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRK-----------LYGGFQFVLPSTFGWS-SKLIGDSPFWEELRDFVNASQANHNQSNLNSL-KFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYF--NNKIKKT------EDFDISLEKNRMNSEQKFDDVLQVINLTKIYNR 2410
             DRIAIIS GKL C GSS+FLK + G GY L LVK                 +   ++++  +  S++G                +   I+ H+ +A++  +   + ++VLP   +    F  LF  +D+ + +L   SYG+S+T+LEE+F++VA++ + ++ ET +  L P   NR A +GD ++   PF   D  D N      +S    L+S    +    L+G+ L +QQ + L  KR   A+R++KG FA+++LP + + + +    +V P    P++E+ PW+            +  +   ++      +G +  +N LT         D G  G RCM  +    T   C    ++   SP+P        NGN  +   SP C C++   +    +C     G P    R   ++D L NLTG NISDYL+K + ++  K            YGGF   + ++     S  + D+   ++++  +  ++ +     L+SL +F+  L     +        ++W N+KG+ ++ ++ N+ +N +LR+ L K       YGI+  N P+ + +       +    +++ ++I VIF +SF+PASFV+FL++ERVS +K  QF+SG+ P +YW+SNF+WD+  Y++P  ++IIIFI F  +SY+ S N     LLL+ YG +I P MYP SF    PSTA+VVL + NL +G   +++TF+L++   T+      N+ILK VFLIFP + LGRG+ID+  N    +  + + +        W++    L ++ +              GV+  ++  +++  +F     +K        ED D+  E+ R+      +D+L++  LTKIY R
Sbjct: 1098 GDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSCLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEE-SGVDAETSDGTL-PARRNRRA-FGDKQSCLHPFTEDDAVDPNDSDIDPESRETDLLSGMDGKGSYQLKGWKLTQQQFVALLWKRLLIARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLELQPWM------------YNEQYTFVSNDAPEDMGTQELLNALT--------KDPG-FGTRCMEGNPIPDTP--CLAGEEDWTISPVPQSIVDLFQNGNWTMKNPSPACQCSSDKIKKMLPVCPPGAGGLP-PPQRKQKTADILQNLTGRNISDYLVKTYVQIIAKSLKNKIWVNEFRYGGFSLGVSNSQALPPSHEVNDAI--KQMKKLLKLTKDSSADRFLSSLGRFMAGLDTKNNV--------KVWFNNKGWHAISSFLNVINNAILRANLQKGE-NPSQYGITAFNHPLNLTKQQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHLQFISGVKPVIYWLSNFVWDMCNYVVPATLVIIIFICFQQKSYVSSTNLPVLALLLLLYGWSITPLMYPASFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELF--TNNKLNDINDILKSVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPLSWDLVGRNLFAMAV-------------EGVVFFLITVLIQYRFFIRPRPVKAKLPPLNDEDEDVRRERQRILDGGGQNDILEIKELTKIYRR 1923          
BLAST of ATP-binding cassette sub-family A member 1 vs. UniProt/SwissProt
Match: sp|O35600|ABCA4_MOUSE (Retinal-specific phospholipid-transporting ATPase ABCA4 OS=Mus musculus OX=10090 GN=Abca4 PE=2 SV=1)

HSP 1 Score: 295.819 bits (756), Expect = 4.130e-83
Identity = 248/886 (27.99%), Postives = 421/886 (47.52%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILV---KNFNAQKENFR-------KGISN---------------SGD--KLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPA----------KINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIR--------CMNPSIYRS-------THYRCFPEYKNNKWSPIPNGNIPLISPECDCNT----TGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSR-----------KLYGGFQF--VLPSTFGWSSKLIGDSPFWEELRDFVNASQAN-HNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKY------DAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKKT--------EDFDISLEKNRMNSEQKFDDVLQVINLTKIYN 2407
             DRIAIISQG+L C G+ +FLK  FG G+ L LV   KN  +Q+           KG S                 GD  +L+  +  H+P+AK+      +  F+LP  +     ++ LF  L+E + +L   S+G+SDT LEE+F++V +D            +  E+            ++  Y    +      ++    Q   +     + FN   +L+       Q +  L +KRFH+  R++K   A+++LP   + L + L  +V P    PA+ + PW+                 +Q  F   ++  N++ +  L D L +  R   G   ++        C+N + +++       TH      ++  KW+          SP C C+T    T    C +  +GG P   R   S++ L +LT  NISDYL+K +P L R           + YGG      LP+       L+G   F   L   +N S      +++   L F+ +L+ T  I        ++W N+KG+ ++ ++ N+  N +LR+ L +      +YGI+V + P+ + +       V    ++  +AI VIF +SF+PASFV++L++ERV+ +K  QF+SG++P  YW++NFLWDIM Y +   +++ IFI F  ++Y    N  A + LL+ YG A+IP MYP SF    PSTA+V L+  NL +G  ++  TF+L++ E+     R  N +L+K+ ++FP + LGRG+IDL+   +   +TD YA++      + F W++  + L ++ +              GV+  +L  +++  +F  +            ED D++ E+ R+ S     D+L++  LTK+Y+
Sbjct: 1127 GDRIAIISQGRLYCSGTPLFLKNCFGTGFYLTLVRKMKNIQSQRGGCEGVCSCTSKGFSTRCPTRVDEITEEQVLDGDVQELMDLVYHHVPEAKLVECIGQELIFLLPNKNFKQRAYASLFRELEETLADLGLSSFGISDTPLEEIFLKVTEDAGAGSMFVGGAQQKREQAGLRHPCSAPTEKLRQYAQAPHTCSPGQVDPPKGQPSPEPEDPGVPFNTGARLIL------QHVQALLVKRFHHTIRSRKDFVAQIVLPATFVFLALMLSIIVPPFGEFPALTLHPWMY---------------GHQYTFFSMDEPNNEH-LEVLADVLLN--RPGFGNRCLKEEWLPEYPCINATSWKTPSVSPNITHL-----FQKQKWTAAHP------SPSCKCSTREKLTMLPECPE-GAGGLPPPQRTQRSTEVLQDLTNRNISDYLVKTYPALIRSSLKSKFWVNEQRYGGISIGGKLPAIPISGEALVG---FLSGLGQMMNVSGGPVTREASKEMLDFLKHLETTDNI--------KVWFNNKGWHALVSFLNVAHNAILRASLPRDRDP-EEYGITVISQPLNLTKEQLSDITVLTTSVDAVVAICVIFAMSFVPASFVLYLIQERVTKAKHLQFISGVSPTTYWLTNFLWDIMNYAVSAGLVVGIFIGFQKKAYTSPDNLPALVSLLMLYGWAVIPMMYPASFLFEVPSTAYVALSCANLFIGINSSAITFVLELFENNRTLLR-FNAMLRKLLIVFPHFCLGRGLIDLA---LSQAVTDVYAQFGEEYSANPFQWDLIGKNLVAMAI-------------EGVVYFLLTLLIQHHFFLTRWIAEPAREPVFDEDDDVAEERQRVMSGGNKTDILKLNELTKVYS 1947          
BLAST of ATP-binding cassette sub-family A member 1 vs. UniProt/SwissProt
Match: sp|Q8IZY2|ABCA7_HUMAN (Phospholipid-transporting ATPase ABCA7 OS=Homo sapiens OX=9606 GN=ABCA7 PE=1 SV=3)

HSP 1 Score: 286.96 bits (733), Expect = 3.112e-80
Identity = 250/857 (29.17%), Postives = 412/857 (48.07%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK-------------------NFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAK---INEETKNEKL--------IPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIPNGN-IP-LISPECDCNTTGYQI----CNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRK-----------LYGGFQFVLPSTFGWSSKLIGDS--PFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKY------DAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYN 2407
             DR+A+++ G+L CCGS +FL+R  G GY L LVK                   +   +K+N  +G      +LL  ++  +P A++  E   +   VLP   ++   F+ LF  LD  +  L    YG+SDTSLEE+F++V ++ A    + + +  + L        +   L        +EN EP     + +Q +  D         R    ++G+ L +QQ+  L +KRF  A+R+++G+FA+++LP L + L +    +V P    PA+ +SP             T Y    Q++F   +  G+      L   L+        E+G+    P +  S+H    PE        + +GN  P   SP C C+  G +     C     G P     +  S + + NLTG N+SD+L+K +P+L R+            YGGF          S + +G S    W  L      +  +    NL +       Q + KI          W N+KG+ SM A+ N  SN +LR+ L     +   + I+  N P+ + +       +    +++ ++I V+F +SF+PASF + L+EERV+ +K  Q + G++P +YW+ NFLWD+  Y++P  I+++IF+AF  ++Y+   N  A +LLL+ YG +I P MYP SFF S PSTA+VVL   NL +G   +M+TF+L++   +D+  +  + ILK+VFLIFP + LGRG+ID+  N     M D + +           WEV  + L ++++   L+ +  ++++       L    +V      +   ED D++ E+ R+       DVL + NLTK+Y 
Sbjct: 1005 GDRVAVVAGGRLCCCGSPLFLRRHLGSGYYLTLVKARLPLTTNEKADTDMEGSVDTRQEKKNGSQGSRVGTPQLLALVQHWVPGARLVEELPHELVLVLPYTGAHDGSFATLFRELDTRLAELRLTGYGISDTSLEEIFLKVVEECAADTDMEDGSCGQHLCTGIAGLDVTLRLKMPPQETALENGEPAGSAPETDQGSGPDA------VGR----VQGWALTRQQLQALLLKRFLLARRSRRGLFAQIVLPALFVGLALVFSLIVPPFGHYPALRLSP-------------TMYGA--QVSFFSEDAPGDPGRARLLEALLQ--------EAGLE--EPPVQHSSHRFSAPEVPAEVAKVLASGNWTPESPSPACQCSRPGARRLLPDCPAAAGGPP-PPQAVTGSGEVVQNLTGRNLSDFLVKTYPRLVRQGLKTKKWVNEVRYGGFSLGGRDPGLPSGQELGRSVEELWALLSPLPGGA-LDRVLKNLTAWAHSLDAQDSLKI----------WFNNKGWHSMVAFVNRASNAILRAHLPPGPARHA-HSITTLNHPLNLTKEQLSEGALMASSVDVLVSICVVFAMSFVPASFTLVLIEERVTRAKHLQLMGGLSPTLYWLGNFLWDMCNYLVPACIVVLIFLAFQQRAYVAPANLPALLLLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINGSMATFVLELF--SDQKLQEVSRILKQVFLIFPHFCLGRGLIDMVRN---QAMADAFERLGDRQFQSPLRWEVVGKNLLAMVIQGPLFLLFTLLLQH---RSQLLPQPRVRSL--PLLGEEDEDVARERERVVQGATQGDVLVLRNLTKVYR 1803          
BLAST of ATP-binding cassette sub-family A member 1 vs. UniProt/SwissProt
Match: sp|P78363|ABCA4_HUMAN (Retinal-specific phospholipid-transporting ATPase ABCA4 OS=Homo sapiens OX=9606 GN=ABCA4 PE=1 SV=3)

HSP 1 Score: 278.87 bits (712), Expect = 1.731e-77
Identity = 253/885 (28.59%), Postives = 424/885 (47.91%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILV---KNFNAQKENFR-------KGISNS---------------GD--KLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHK--------------LLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKE-NQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYR--STHYRCFPEYKNNKWSPIPNGNIPLISPECDCNT----TGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSR-----------KLYGGFQF-----VLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLK-FIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEM--EQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKY------DAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKKT--------EDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRT 2413
             DRIAII+QG+L C G+ +FLK  FG G  L LV   KN  +Q++          KG S +               GD  +L+  +  H+P+AK+      +  F+LP  +     ++ LF  L+E + +L   S+G+SDT LEE+F++V +D           +   +N+N          + P L   +   Q   D ++ S      H               L  G  L+ Q +  L +KRF +  R+ K   A+++LP   + L + L  ++ P    PA+ + PW+   +    +++    ++   L   + N+ G  N    L +    EY          C N + ++  S        ++  KW+ +        SP C C+T    T    C +  +GG P   R   S++ L +LT  NISD+L+K +P L R           + YGG        V+P T      L+G   F  +L   +N S     +     +  F+ +L+    I        ++W N+KG+ ++ ++ N+  N +LR+ L K      +YGI+V + P+ +  EQ ++   L   +  +  +AI VIF +SF+PASFV++L++ERV+ SK  QF+SG++P  YWV+NFLWDIM Y +   +++ IFI F  ++Y   +N  A + LL+ YG A+IP MYP SF    PSTA+V L+  NL +G  ++  TFIL++ E+     R  N +L+K+ ++FP + LGRG+IDL+   +   +TD YA++      + F W++  + L ++++              GV+  +L  +++  +F ++            ED D++ E+ R+ +     D+L++  LTKIY  T
Sbjct: 1127 GDRIAIIAQGRLYCSGTPLFLKNCFGTGLYLTLVRKMKNIQSQRKGSEGTCSCSSKGFSTTCPAHVDDLTPEQVLDGDVNELMDVVLHHVPEAKLVECIGQELIFLLPNKNFKHRAYASLFRELEETLADLGLSSFGISDTPLEEIFLKVTEDSDSGPLFAGGAQQKRENVN---------PRHPCLGPREKAGQTPQDSNVCSPGAPAAHPEGQPPPEPECPGPQLNTGTQLVLQHVQALLVKRFQHTIRSHKDFLAQIVLPATFVFLALMLSIVIPPFGEYPALTLHPWIYGQQYTFFSMDEPGSEQFTVLADVLLNKPGFGNRC--LKEGWLPEYP---------CGNSTPWKTPSVSPNITQLFQKQKWTQVNP------SPSCRCSTREKLTMLPECPE-GAGGLPPPQRTQRSTEILQDLTDRNISDFLVKTYPALIRSSLKSKFWVNEQRYGGISIGGKLPVVPIT---GEALVG---FLSDLGRIMNVSGGPITREASKEIPDFLKHLETEDNI--------KVWFNNKGWHALVSFLNVAHNAILRASLPKDRSPE-EYGITVISQPLNLTKEQLSEITVLTTSV--DAVVAICVIFSMSFVPASFVLYLIQERVNKSKHLQFISGVSPTTYWVTNFLWDIMNYSVSAGLVVGIFIGFQKKAYTSPENLPALVALLLLYGWAVIPMMYPASFLFDVPSTAYVALSCANLFIGINSSAITFILELFENNRTLLR-FNAVLRKLLIVFPHFCLGRGLIDLA---LSQAVTDVYARFGEEHSANPFHWDLIGKNLFAMVV-------------EGVVYFLLTLLVQRHFFLSQWIAEPTKEPIVDEDDDVAEERQRIITGGNKTDILRLHELTKIYPGT 1950          
BLAST of ATP-binding cassette sub-family A member 1 vs. TrEMBL
Match: A0A1S3JVH4 (LOW QUALITY PROTEIN: ATP-binding cassette sub-family A member 1-like OS=Lingula unguis OX=7574 GN=LOC106176500 PE=4 SV=2)

HSP 1 Score: 412.149 bits (1058), Expect = 1.712e-120
Identity = 297/926 (32.07%), Postives = 468/926 (50.54%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK-------------------------NFNAQKENFRKGISNSGDK----------------------------LLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPA--KINEETKNEKL--------IPDNLNRIAVYGD----IENQEPFLDLEDLNQQAFVD----KSLISLNFNR---------NHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRS-INLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIP--NGNIPLISPECDCNTTGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLI--GDSPFWEELRDFVNASQANHNQSNLNS----LKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTD----GYAKYDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFNFRSVCCKNKNNDVENENQKFAVNNLCF 2500
             DRIAIIS GKL+CCGSS+FLK K+G GY L +VK                          F ++K+     +S++G K                            +  F++  IP AK+  +  T+  F LP+  +++  F  LF  L+  +  L   SYG+SDT+LEEVF++VA++     +NEE     L        I   + R++         +  +P L++ D N+    D     S+ S+  +          +HK+  G    K Q + L +KRFH+ +R+ KG   E++LP + + + +   K++  ++  PA+E+ PW+ +P + +  +L  FY               N    + L D LE + RS LG  G RCMN S+Y    Y C P     +W+P P   GN  L SP C C+T GYQ C  P +GGP  S R+M ++D+L N+TG N+SD+L+K      ++ YGG+      + G  ++L+    S  ++ +     A   N+ Q  LN        ID L K   +     +  ++W N+KG+ +M +Y N  +N++LRS+L         YGI+VSN P+         D +N   + + +AI VIF +SFIPASFV++L+EERVS SK  QFVSG+N   YWVS+  WDIM Y + +++ I++F+AF+ +SY+   NA   +LLL  YG A+IP M+PF++    PSTAFV L   N+ +G  +T+ST++L+   D D+     N +L++VFLI P Y LGRG+ID+++N +  ++      G A  D F+W+     L +L +    W+   +     +I    +   ++S   N +   ED D++ E+ R  S +   D+L+V NLTK++++                  + +  AV+ LCF
Sbjct:  796 GDRIAIISLGKLRCCGSSLFLKNKYGSGYYLTMVKANSDEKPADRPVTALSNRTVSDIKAQFVSEKDEGVADMSDTGSKSEHSDSDQSATPPPEYEDPVPCVKDSSDVAVFVQKFIPSAKLVEDMGTELCFQLPEEGTHTGAFEALFRALESNLTKLGITSYGISDTTLEEVFLKVAEESGVDDVNEEQTRNALERYTEGGKIARPVTRLSFRKKKLDFFKKSKPVLNISDTNELVDSDFEDADSVASMPVSEVSTAQGGAGSHKV-TGLAHTKDQFLALFVKRFHHVRRSYKGFVCEILLPAIFVCIAMIFTKIIPVIKENPALELQPWMYVPITGTNPHLTVFYT--------------NDAPGSMLADSLERQIRSPLG-IGTRCMNSSVYSIRGYPCTPASSAERWTPSPAVTGNTSLDSPSCSCDT-GYQTC-PPGAGGPLGSSRVMDNTDRLVNMTGRNVSDWLVKTMEDYKKRRYGGY------SLGERNQLVQLNSSQLYQVVDRLSRA--VNNGQPVLNGNESIWSDIDALIKNVAV----QNNVKVWFNNKGWAAMASYMNAMNNVILRSKLPPGK-DPAQYGITVSNHPMAPTNKQIERDTLNSAWISVLVAIGVIFAMSFIPASFVLYLIEERVSNSKHLQFVSGVNRVTYWVSHLAWDIMNYSVSMVLCILLFLAFNERSYVSPTNAPCLVLLLFLYGWAMIPMMFPFNYLFKVPSTAFVALACVNVFLGVTSTLSTYVLEFFSD-DQELVQINTVLRQVFLILPHYCLGRGLIDMAANQLIADVAGIYVAGTAVKDPFEWDQVGRNLFALAVSGAAWFGFTL-----LIEYKFFCTSRLSSNENAVDDNEDIDVARERRRAMSAEARSDILRVENLTKVFHK----------------RRKGKFVAVDRLCF 1668          
BLAST of ATP-binding cassette sub-family A member 1 vs. TrEMBL
Match: V4ABB8 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_212836 PE=4 SV=1)

HSP 1 Score: 392.889 bits (1008), Expect = 1.086e-113
Identity = 298/865 (34.45%), Postives = 451/865 (52.14%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKN-----FNAQKENFRKGI------------------------------SNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNF-------NRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNN----KWSPIP--NGNIPLISPECDCNTTGYQICNDPR-SGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLS--------RKLYGGFQF--VLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGY---AK-YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYR-MLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIY 2404
             DRIAIIS GKL CCGSS+FLK KFG GY L LVK       N   ++   G+                              S S  ++  F++ ++ +A++  +  T+  + LP    +S  F  LF  L+     L   S+GLSDTSLEEVF+ VAD+    N +   ++   +N  +   +  + N+   ++  +L +    + S+ S          N   + L G+ L+  Q + L IKRFH+ +R+KKG   E+ILP   + L IA   ++ PL + P +E+ PWL +PK    NL  FY               N N  + L + LE    S     G RCMNP +Y    Y C  E  +N    KW+  P   GN+ + SP CDC + G+  C  P+ +GGP  S   + ++D L N+T  NISD+LL + P  S           Y G  F  + P     SS+++        L +  N  Q   N S L     ID L + F    +  +  ++W N+KG+ S  +Y N+ +N++LRS+L  +     DYGI+  N P+   Q     + +   ++++ +AI VIF +SFIPASF+IFL+EERVS SK  QFVSGINP +YW+S F WD++ Y++P  + ++IF+AFD +SY+ + N    + LL  YG AIIP MYPFS   S  S+AFV ++  N+ +G ++T+STFI++++E +D+     N ILK VFL+ P Y LGRG+ID++ N ++Y++T  +   AK  +   W++    L SL +L + ++I+  +IE        YR  +K  Y        ED D+S EK R+ S +  +DVL + NL+K++
Sbjct: 1088 GDRIAIISHGKLCCCGSSLFLKSKFGSGYYLTLVKQDGNGAVNVDDDDDEDGLKKALNDDDGLRPSTADVDEGFGESNGSTTGSLSVGRITGFVQKYVKNAQLVEDNSTELCYQLPTEAMSSGDFEALFTQLERSHHELGIDSFGLSDTSLEEVFLAVADE---TNVDDLTDEATRNNFRKKKKFNFLRNRRSRIEHTELVEDTDDNVSIASSTLENRVGFANSGVQKLHGWSLIFNQFLALFIKRFHHVRRSKKGFVCEIILPAGFVALAIAFSLILPPLVTEPPLELHPWLYVPKKSEPNLYMFY--------------SNDNPRSTLANSLEQALLSK-PWVGTRCMNPDVYSIDGYPC--EGSSNSQYLKWTERPKMTGNLTIDSPSCDC-SRGFPDC--PKGAGGPTPSMSYLPTTDYLYNMTARNISDWLLAHIPSFSICFDMFIFHYRYAGISFGDINPLADVNSSQIVD---IINRLSEAANGGQPIVNNSFLTD---IDTLARGF----LTRNVAKVWYNNKGWASSVSYMNVLNNMILRSKLPANKDP-ADYGITTINHPMAYNQKQFSAEAILTSVIDLIVAICVIFAMSFIPASFLIFLIEERVSDSKHMQFVSGINPTIYWISTFAWDMVNYLVPATLCVLIFLAFDQESYVSASNFPCLLALLFLYGWAIIPLMYPFSRLFSVSSSAFVTISCANVFLGVVSTLSTFIVELLEQSDKELADINTILKSVFLVLPHYCLGRGLIDMTRNQLQYDLTKQFFPDAKPSNILAWDLVGRNLFSLAMLGIFFFILNWLIE--------YRFFIKPRYVKESEDTNEDIDVSREKQRVLSGEADNDVLVLKNLSKVF 1910          
BLAST of ATP-binding cassette sub-family A member 1 vs. TrEMBL
Match: N1PB02 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_226736 PE=4 SV=1)

HSP 1 Score: 368.237 bits (944), Expect = 3.158e-105
Identity = 278/840 (33.10%), Postives = 438/840 (52.14%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKN---------FNAQKENFRKGISNSGD-KLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNE-KLIPDNLNRIAVYG-----------------DIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMP-KSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIPNG-NIPLISPECDCNTTGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKI------KKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIY 2404
             DRIAII+QGKL C GSS+FLK  FG GY L LVK+          + + EN  +   N+G+     FI   +P+A +      + ++ LP + S++  F  LF +LD  + +L  LSYG+SDT+LEEVF++VA++  + N  ++ + +   + L    +Y                  D E+ E  LD  D N  + V  + IS N   ++K+  G  L+ +Q + + IKRF+Y +R+KK   ++                        PAMEI PWLM P K +  +L TF+          +N L ++     + D L  +        G+RCM+P +Y    +RC  + ++++WS +    + P    EC C + GYQ C    +G   + Y ++ ++D++ N+TG NISD++LK   +  ++ YGG  F   +    ++    DS F +     +  + A  + +N+     I  L+   K    K +  +IW N+KGYVSM AY NI +NL+LR+ L         YGIS+ N P+    S  +   +   I+++ +++ VIF +  IPASFV+FL+EERVSGSK  QFVSG+NP VYWV+NF WD++ Y++  I+ I+IF+AF   +Y+   NA   + LL+ YG A  P MYP S F + PS+AFV+L   N+ +G I+T+STFIL+     ++     N I+ KVFL+ P Y LGRG+ID++ N +  ++ +   +      F W++    L SL +L + ++ + I IE       +Y M  +S    +I         ED D+  E+ R+       D+L +  LTK+Y
Sbjct: 1093 GDRIAIINQGKLCCVGSSLFLKSNFGGGYYLTLVKDERKGDSASTSDVKVENATED-GNAGEISTTAFIMERVPEAVLVESIGIEMTYQLPNDKSHTASFEKLFRDLDAHLSSLGLLSYGVSDTTLEEVFLKVANESEEANHLSEEDVRQGTERLTDGGMYARPVTRLSFRKRNFFASKDRESNE-LLD-ADGNPDSAVSTASISCNGTGSYKV-TGLSLIPRQFLAIFIKRFNYLRRSKKAFISQE-----------------------PAMEIHPWLMSPSKLQDSHLFTFF----------SNDLPSEAWTQAIEDLLTQK-----PGLGVRCMDPDVYSLKGFRCV-DAEDSQWSNVEEDFDEP---EECSCES-GYQRCPKGAAGAEASKY-LLPTTDEMYNMTGRNISDWILKTSQEYIKRRYGGLTFGERNDLLRANDTEVDSIFAQ-----LATAAAGDDTNNVTLPGLILDLENLIKNIATKRN-AKIWFNNKGYVSMVAYMNIMNNLVLRAHLPPDTDPS-RYGISLINHPMNRTSSQLYAYTLKASIVDVMISVSVIFAMCLIPASFVLFLIEERVSGSKHLQFVSGVNPVVYWVANFTWDMLNYLVSGILCILIFVAFQQNAYVSQTNAPCLVSLLLLYGWAATPMMYPASHFFNVPSSAFVILGCMNIFLGIISTLSTFILEAF--MEQELDEINAIIMKVFLVLPHYCLGRGLIDMTRNQLVADIFENLGETFFQSPFTWDIVGRNLLSLSILGVFFFFLNICIEYKFW---IYSMKCISPCKEQIPVNVEETDEEDIDVVRERERVTLGAASGDILTLEGLTKVY 1872          
BLAST of ATP-binding cassette sub-family A member 1 vs. TrEMBL
Match: A0A3P9HY39 (Uncharacterized protein OS=Oryzias latipes OX=8090 PE=4 SV=1)

HSP 1 Score: 350.517 bits (898), Expect = 2.464e-99
Identity = 267/872 (30.62%), Postives = 448/872 (51.38%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKN----FNAQKENFRKGI---------------------------SNSGD--KLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINE-ETKNEKLIPD-----------NLNRI---AVYGDIENQ---EPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMN----PSIYRSTHYRCF--PEYKNNKWSPIPNGNIPLI--SPECDCNTTGYQI----CNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKT---FKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNR 2410
             DRIAIIS GK++CCGSS+FLK+ FG GY L LV++      AQ+     GI                           SN  D   + QF++ H+P+A        + +F+LP   +    F+ LF  LD+ +D L   SYG+SDT+LEE+F++VA+D     E     E ++ D           +++R    A  G+++++   +    +ED    A V+         R   ++ G+ L++QQ + L IKRFH+A+R++KG+ A+++LP + + L +    +V    + P++E+ PW+   ++      TFY          +N +    +++ + + L      D    G RCM     P +  S+    +  P    +      NGN  +   SP C C+T G  I    C     G P    R+  ++D L NLT  N++D+LLK +    +K YGG      S  G +S+++            +   +     +NL    + D +QK     K  G + +  ++W  +KG+ SM ++ ++ +N +LR  L +       YG+SVSN P+ + +    L  +     ++ ++I VIF +SFIPASFV+FL++ERVS +K  QFVSG+NP VYWV++F+WDI  YIIP  +++ IFI F  ++Y+  +N  A ILLL+ YG AI P MYP SF  + PSTA+VVL   NL +G   +++TF++++ +  DE+    N I+K+V LIFP + LGRG++D++ N    N+   + +    D   W +  + L ++ +   + +   +     +I    +   ++S    + ++ ED D++ E++R++  +  +DVL++ +LTK+Y R
Sbjct:  753 GDRIAIISHGKMRCCGSSIFLKKSFGSGYYLTLVRSGTEVMTAQRSGIISGIAEEKPTESDCPSSSSLDEDGGCQSSDNSNPADLKHVTQFVRRHVPEAVFLESIGQEITFILPYARARDGTFATLFQELDKVMDKLGLTSYGVSDTTLEEIFLKVAEDTGVDKELSPTKEPVVKDYKKDSRESKRRSMSRFHGKAAKGNMKDELKKKLSNKVEDFKNSASVN--------GRGSVVITGWKLIRQQFLALFIKRFHHARRSRKGLIAQVVLPAIFVCLALVFSLIVPSFTAYPSLELQPWMYDSQT------TFY----------SNDMPEDANVSRVVETL-----VDNPGFGTRCMEGNPIPRLPCSSGASDWFSPSVDQSVADIFLNGNWSMSNPSPSCQCSTPGRTIIMPDCPPGAGGLP-PPQRVQNTTDTLLNLTSINMTDFLLKTYEHAGKKRYGGI-----SVGGINSQVL------------LTEVEIEEAFANLEPPGYGDTIQKAEMVLKKLGTRNN-VKVWFYNKGWHSMVSFLSVVNNGILRGYLPEGQ-DLRQYGLSVSNHPLNLSKEQLSLSAMATTSSDVVVSICVIFAMSFIPASFVLFLIQERVSKAKHLQFVSGVNPTVYWVASFVWDICNYIIPCFLVVGIFICFQQKAYVSPQNLPALILLLVMYGWAITPMMYPASFIFTVPSTAYVVLTCLNLFIGINGSVATFVMELFK--DESITKINNIVKQVLLIFPHFCLGRGLMDMARNQAMANVFSNFGEDRFEDPLSWNMVGKNLIAMSIQGAVMFAFTL-----LIQHKFFYKPRLSLPKVQSEEKEDVDVARERHRVHEGRANNDVLRICDLTKVYPR 1568          
BLAST of ATP-binding cassette sub-family A member 1 vs. TrEMBL
Match: A0A3P9HY72 (Uncharacterized protein OS=Oryzias latipes OX=8090 PE=4 SV=1)

HSP 1 Score: 350.517 bits (898), Expect = 2.684e-99
Identity = 267/872 (30.62%), Postives = 448/872 (51.38%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKN----FNAQKENFRKGI---------------------------SNSGD--KLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINE-ETKNEKLIPD-----------NLNRI---AVYGDIENQ---EPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMN----PSIYRSTHYRCF--PEYKNNKWSPIPNGNIPLI--SPECDCNTTGYQI----CNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKT---FKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNR 2410
             DRIAIIS GK++CCGSS+FLK+ FG GY L LV++      AQ+     GI                           SN  D   + QF++ H+P+A        + +F+LP   +    F+ LF  LD+ +D L   SYG+SDT+LEE+F++VA+D     E     E ++ D           +++R    A  G+++++   +    +ED    A V+         R   ++ G+ L++QQ + L IKRFH+A+R++KG+ A+++LP + + L +    +V    + P++E+ PW+   ++      TFY          +N +    +++ + + L      D    G RCM     P +  S+    +  P    +      NGN  +   SP C C+T G  I    C     G P    R+  ++D L NLT  N++D+LLK +    +K YGG      S  G +S+++            +   +     +NL    + D +QK     K  G + +  ++W  +KG+ SM ++ ++ +N +LR  L +       YG+SVSN P+ + +    L  +     ++ ++I VIF +SFIPASFV+FL++ERVS +K  QFVSG+NP VYWV++F+WDI  YIIP  +++ IFI F  ++Y+  +N  A ILLL+ YG AI P MYP SF  + PSTA+VVL   NL +G   +++TF++++ +  DE+    N I+K+V LIFP + LGRG++D++ N    N+   + +    D   W +  + L ++ +   + +   +     +I    +   ++S    + ++ ED D++ E++R++  +  +DVL++ +LTK+Y R
Sbjct:  753 GDRIAIISHGKMRCCGSSIFLKKSFGSGYYLTLVRSGTEVMTAQRSGIISGIAEEKPTESDCPSSSSLDEDGGCQSSDNSNPADLKHVTQFVRRHVPEAVFLESIGQEITFILPYARARDGTFATLFQELDKVMDKLGLTSYGVSDTTLEEIFLKVAEDTGVDKELSPTKEPVVKDYKKDSRESKRRSMSRFHGKAAKGNMKDELKKKLSNKVEDFKNSASVN--------GRGSVVITGWKLIRQQFLALFIKRFHHARRSRKGLIAQVVLPAIFVCLALVFSLIVPSFTAYPSLELQPWMYDSQT------TFY----------SNDMPEDANVSRVVETL-----VDNPGFGTRCMEGNPIPRLPCSSGASDWFSPSVDQSVADIFLNGNWSMSNPSPSCQCSTPGRTIIMPDCPPGAGGLP-PPQRVQNTTDTLLNLTSINMTDFLLKTYEHAGKKRYGGI-----SVGGINSQVL------------LTEVEIEEAFANLEPPGYGDTIQKAEMVLKKLGTRNN-VKVWFYNKGWHSMVSFLSVVNNGILRGYLPEGQ-DLRQYGLSVSNHPLNLSKEQLSLSAMATTSSDVVVSICVIFAMSFIPASFVLFLIQERVSKAKHLQFVSGVNPTVYWVASFVWDICNYIIPCFLVVGIFICFQQKAYVSPQNLPALILLLVMYGWAITPMMYPASFIFTVPSTAYVVLTCLNLFIGINGSVATFVMELFK--DESITKINNIVKQVLLIFPHFCLGRGLMDMARNQAMANVFSNFGEDRFEDPLSWNMVGKNLIAMSIQGAVMFAFTL-----LIQHKFFYKPRLSLPKVQSEEKEDVDVARERHRVHEGRANNDVLRICDLTKVYPR 1568          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Cavefish
Match: abca4a (retinal-specific ATP-binding cassette transporter-like [Source:NCBI gene;Acc:103024609])

HSP 1 Score: 327.791 bits (839), Expect = 6.324e-95
Identity = 264/889 (29.70%), Postives = 429/889 (48.26%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRK-------------------------------GISNSGD--KLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRV-ADDPAKINEETKNEKLIPDNLNRIAVYGD----IENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNN---KWS-PIPNGNIPLI-----------SPECDCNT----TGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSR-----------KLYGGFQF--VLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNL-NSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMI--LEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKY------DAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYF--------NNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYN 2407
            SDR+AIISQG+L CCGS +FLK   G G+ L LV+         RK                               G    GD   +   +  H+P+A++      + +F+LP        ++ LF  L+E + ++   S+G+SDTSLEE+F++V AD    + +   + + + +  +R +V+ D    +  +EP       N Q        S    +  + ++G  L+ +Q + L IKRFH+  R+ K  FA+++LP   + + +    +V P    P++ +SPW+     R     TF+  E       +   G K   + L +R            G RCM         Y C     NN   +W  P+ N  +  +           SP+C C+T    T   +C +  +GG P   RI ++ D L +LTG NISDYL+K +P L R           + YGG      LP   G S K I D+   E+L    N +   H +  L ++  F+ Y++  + +        ++W N+KG+ +MPA+ N+ +N +LR+ L  +A    +YG++V N P+ + +    L  VN +   ++  +A+ VIF +SF+PASFV++L++ERV+ +K  QFVSG++P VYW +NFLWD++ Y +   +++ IFI FD + Y    N  A I LL+ YG ++ P MYP S+  S PSTA+V L+  NL +G  ++  TFILD+  D+  T    N++LK+V LIFP + LGRG+ID++   I   + D YA++      D F W    + +  +                G I  +L  +++  +F           +   ED D++ E+ R+       D+L + +L+K Y+
Sbjct: 1177 SDRVAIISQGRLHCCGSPLFLKSMLGAGFYLTLVRRMKDDTPPTRKEGQCDCKDDCSCKCSICTEYKESTCGQTKSAGRQMDGDVETITNLVHHHVPEARLVEAVGQELTFLLPSRGFKHRAYASLFRELEETLADIGLSSFGVSDTSLEEIFLKVTADGETSLGKSAADLRALQET-SRSSVFRDTTVTVNTEEPEDKKACANGQP--TAGGSSSGEGQGSRQVKGVSLVVKQFLALLIKRFHHTTRSGKDFFAQIVLPASFVLVSLMFTLIVPPFGEYPSLTLSPWIY---GRQF---TFFSNEQ------SEMEGMKYFADVLLNR---------PGFGTRCMVDEPLE--EYPC-----NNITTEWEKPLVNPALVDVLNKSQWTELRPSPDCQCSTPTKLTMLPVCPE-GAGGLPLPQRIQSTGDVLIDLTGRNISDYLVKTYPTLIRTSLKSKYWVNEQRYGGISVGGRLP-VVGLSPKTIQDTA--EQLGGIFNITAGKHVKRALRDTGTFLRYMETEYNV--------KVWYNNKGWHAMPAFLNVANNAILRAHLPTNA-NPSEYGVTVINHPLNLTKEQ--LSEVNVLTTSVDAVVAMCVIFAMSFVPASFVLYLIQERVTQAKHLQFVSGVSPLVYWTANFLWDMISYSVSAALVVQIFINFDKKCYTSPANLHALIALLMLYGWSVTPMMYPMSYVFSVPSTAYVSLSCLNLFIGINSSAITFILDLF-DSSTTLYMFNQVLKRVLLIFPHFCLGRGLIDMA---INQAVMDVYAQFGEDYSLDPFSWNFVGKNVVCMAA-------------EGFIYFILNILIQYRFFLEHWMPDSKKPLIVDEDLDVAKERERIYRGGSSSDILHIRDLSKTYS 2002          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Cavefish
Match: ENSAMXT00000022236.2 (pep primary_assembly:Astyanax_mexicanus-2.0:21:13397857:13560117:1 gene:ENSAMXG00000021540.2 transcript:ENSAMXT00000022236.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 323.553 bits (828), Expect = 1.522e-93
Identity = 265/849 (31.21%), Postives = 432/849 (50.88%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILV--------KNFNAQKENFR--KGISNSG----DKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPD------NLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGI--RCM--NPSIYRSTHYRCFPEYKNNKWSPIPNGNIPLI-----------SPECDCNTTGYQI----CNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXE-RGVINRVLYRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFN 2419
             DRIAIIS G++ CCGSS+FLK+ +G GY L LV        +   +Q ++F   +GI +S       L   ++ H+P+A        +  ++LP   S    F+ LF  LD E + L   SYG+SDTSLEEV          ++ + K + L+ D           ++   +E +E      D  +Q+      + LN  +   ++ G+PL++ Q + L IKRFH+A+R++KGI A+++LP   + L +    +V P    P++E+ PW M  K +    NTFY  +     ++T                 S  RS L E G   RCM  NP       Y C P    +  +P  +  I  I           SP+C C+T    I    C     G PP   R  +++D L+NLT YN++D+LLK + K  +  YGG      S  G +S+++            +N S+     S+  +L     + +T     + TS + +W  ++G+ ++ ++ N+ ++  +      S ++   YGIS  N P+ + +      +      ++ ++I VIF +SFIPASFV+FL++ERVS +K  QFVSG+NP  YWV+NF WD+  YI+P +I+IIIF+ F  +SY+   N  A ILLLI YG +I P MYP SF  S PSTA+VVL   NL +G   +++TF++++ +D + T    N+I+K+V LIFP + LGRG+ID++ N     +     +    D   W++  + L ++ +  ++ +   ++I+ +      L + L VS         ED D++ E+ R++     +D+L++ +LTK+   +F+
Sbjct:  859 GDRIAIISHGRVCCCGSSLFLKKTYGSGYYLTLVQANQERGARKHQSQCDDFSLDEGIGSSSLSNVADLSALVRRHVPEAVFLEVLGQELVYILPYTGSKDGSFASLFKELDLEKERLGISSYGISDTSLEEVHTLAQTHTHTLSIQYK-DTLVRDWKRSSRESRTHSISSAMEQKEKESSKCDDQRQS------VCLN-GKGSSVMSGWPLIRHQFLALFIKRFHHARRSRKGIIAQVVLPAFFVCLSLIFSLIVPPFVEYPSLELQPW-MYGKPQ----NTFYSTDRPTEAAVT-----------------SVTRSLLNEPGFGTRCMESNPI----PKYPCVPAGATDWSTPAVDPAILKIFQDGNWTMQNPSPDCQCSTPERNIMLPDCQPGAGGLPPP--RTQSTTDTLHNLTSYNMTDFLLKTYAKSGKIRYGGI-----SVGGVNSQVM------------LNESEIIAAVSDFKALFNSTQVSQT-----LCTSLSLVWFYNQGWHAIASFLNV-ASNAILRASLPSRLQPKLYGISAFNHPLNLTKQ----QMSAAFSTDVVVSICVIFAMSFIPASFVLFLIQERVSKAKHLQFVSGVNPAGYWVANFTWDMCNYIVPCLIVIIIFLCFQQKSYVSPPNLPALILLLILYGWSITPMMYPASFLFSVPSTAYVVLTCINLFIGINGSVATFVMELFDDPNIT--RINDIMKQVLLIFPHFCLGRGLIDMAKNQAMATLFSSLGEDRFKDPLGWDMVGKNLFAMAVEGVVMFGFTLLIQYKFCWKPGLVKGLPVSL------GQEDEDVARERERVHKGGAENDLLRICDLTKVLLLSFS 1636          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Cavefish
Match: abca4a (retinal-specific ATP-binding cassette transporter-like [Source:NCBI gene;Acc:103024609])

HSP 1 Score: 321.242 bits (822), Expect = 1.181e-92
Identity = 252/874 (28.83%), Postives = 418/874 (47.83%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRK-------------------------------GISNSGD--KLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRV-ADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINP--LTDRLESEYRSD--LGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIPNGNIPLISPECDCNT----TGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSR-----------KLYGGFQF--VLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNL-NSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMI--LEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKY------DAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYF--------NNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYN 2407
            SDR+AIISQG+L CCGS +FLK   G G+ L LV+         RK                               G    GD   +   +  H+P+A++      + +F+LP        ++ LF  L+E + ++   S+G+SDTSLEE+F++V AD    + +   ++K                N +P                  S    +  + ++G  L+ +Q + L IKRFH+  R+ K  FA+++LP   + + +    +V P    P++ +SPW+     R     +  + E +      + L N+       + D    EY  +    E     +NP++    +         ++W+ +        SP+C C+T    T   +C +  +GG P   RI ++ D L +LTG NISDYL+K +P L R           + YGG      LP   G S K I D+   E+L    N +   H +  L ++  F+ Y++  + +        ++W N+KG+ +MPA+ N+ +N +LR+ L  +A    +YG++V N P+ + +    L  VN +   ++  +A+ VIF +SF+PASFV++L++ERV+ +K  QFVSG++P VYW +NFLWD++ Y +   +++ IFI FD + Y    N  A I LL+ YG ++ P MYP S+  S PSTA+V L+  NL +G  ++  TFILD+  D+  T    N++LK+V LIFP + LGRG+ID++   I   + D YA++      D F W    + +  +                G I  +L  +++  +F           +   ED D++ E+ R+       D+L + +L+K Y+
Sbjct: 1177 SDRVAIISQGRLHCCGSPLFLKSMLGAGFYLTLVRRMKDDTPPTRKEGQCDCKDDCSCKCSICTEYKESTCGQTKSAGRQMDGDVETITNLVHHHVPEARLVEAVGQELTFLLPSRGFKHRAYASLFRELEETLADIGLSSFGVSDTSLEEIFLKVTADGETSLGKSAADKK-------------ACANGQP-------------TAGGSSSGEGQGSRQVKGVSLVVKQFLALLIKRFHHTTRSGKDFFAQIVLPASFVLVSLMFTLIVPPFGEYPSLTLSPWIY---GRQFTFFSNEQSEMEGMKYFADVLLNRPGFGTRCMVDEPLEEYPCNNITTEWEKPLVNPALVDVLN--------KSQWTELRP------SPDCQCSTPTKLTMLPVCPE-GAGGLPLPQRIQSTGDVLIDLTGRNISDYLVKTYPTLIRTSLKSKYWVNEQRYGGISVGGRLP-VVGLSPKTIQDTA--EQLGGIFNITAGKHVKRALRDTGTFLRYMETEYNV--------KVWYNNKGWHAMPAFLNVANNAILRAHLPTNA-NPSEYGVTVINHPLNLTKEQ--LSEVNVLTTSVDAVVAMCVIFAMSFVPASFVLYLIQERVTQAKHLQFVSGVSPLVYWTANFLWDMISYSVSAALVVQIFINFDKKCYTSPANLHALIALLMLYGWSVTPMMYPMSYVFSVPSTAYVSLSCLNLFIGINSSAITFILDLF-DSSTTLYMFNQVLKRVLLIFPHFCLGRGLIDMA---INQAVMDVYAQFGEDYSLDPFSWNFVGKNVVCMAA-------------EGFIYFILNILIQYRFFLEHWMPDSKKPLIVDEDLDVAKERERIYRGGSSSDILHIRDLSKTYS 1975          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Cavefish
Match: zgc:172302 (zgc:172302 [Source:ZFIN;Acc:ZDB-GENE-081205-5])

HSP 1 Score: 318.546 bits (815), Expect = 7.560e-92
Identity = 273/867 (31.49%), Postives = 424/867 (48.90%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDL--NQQAFVDKSLISLNFNRNHKL---------LRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCM--NPSIYRSTHYRCFPEYKNNKWSPIPNGNIPLISPECDCNTTGYQI----CNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRK-----------LYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSL-KFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKY---DAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKK--TEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFNFRSVCCKNKNNDVENENQKFAVNNLCF 2500
             DRIAIISQGKL CCGSS+FLK   G GY L  VK    ++   R   S SG+ L+   + ++  A++  +   +    LP   S     +     LD+       +SYGLSDT+LEE+F++VA++     E        PD           +  EP  D + +  NQQ     SL+         L         L G+ L  QQ+  L  KR  YA R++KG  A+++LP L I + +    +V P+   PA+E+ PW+                  Q  F       N    +P    L S      G  G +C+  +P I  ST ++ F           PN  +   SP+C C+T   +     C +   G PP   + +T  D L NLTG NISDYL+K +P++ +K            YGGF          S  LIG      +L + V A +  +  +  +SL + +D L   F     + +  ++W N+KG+ +M ++ NI +N LLR+ L     +   +GI+  N P+ + +      ++    +++ L+I VIF +S +PASFV+FL+EERVS +K  QFVSG+ P +YW +NF+WD++ Y +P  ++++IFI F  Q+Y+  KN  A +LLL+ YG AI P MYP SF  S PSTA+V L + NL +G   +++TF+L++   T+E  R  N ILKKVFLIFP + LGRG+ID++ N    +      K        W+   + L ++ +  ++++I  I+++     R      ++ +F   +     ED D+  E++R+ + +  DD+L +I+L+K+Y                      +K AVN LC 
Sbjct: 1003 GDRIAIISQGKLCCCGSSLFLKSHLGTGYYLTAVK----KELQSRTPTSASGNGLVALAQHYVSGARLVEDVGREVVINLPHAASEDGTLALFLAELDKRQAEFGIISYGLSDTTLEEIFLKVAEETGVDAE--------PDEAATPPAVSPSQQGEPPEDRDAVLFNQQV----SLLYTEAQETDPLSGDGRGSVSLTGWGLTWQQLRALFTKRLLYATRSRKGFIAQIVLPALFILIDLLFSLIVPPMGKYPALELQPWMY---------------GEQFTF-----FSNDAPQDPAMQNLLSALLDPPG-FGTKCLFNSPQIPFST-WKLFNS---------PNWTMEHPSPDCMCSTEEVRRMLPDCPEGAGGLPPPQIKRLTG-DILQNLTGRNISDYLMKTYPQILKKSMKTKKWVNEFRYGGFSLGAKG----SQTLIGSL----QLEESVMAIRKQYKIAENSSLDQLLDRLPDLFTDLNSQNN-VKVWYNNKGWHAMVSFVNIMNNGLLRASLPPGPER-QKHGITAYNHPLNLTKEQLSDMVLMTTSVDVLLSISVIFAMSLVPASFVLFLIEERVSKAKHLQFVSGVKPILYWTANFVWDMLNYTVPATLVVLIFIGFQQQAYVSEKNLPALVLLLLLYGWAITPLMYPASFVFSVPSTAYVTLTSINLFIGINGSIATFVLELF--TNEHLREVNRILKKVFLIFPHFCLGRGLIDMAKNQAMADALQRLGKCHMPSPIVWDFVGKNLFAMAVEGVVFFIFTILLQYKFFIRC-----RLPWFEPVLPPLCAEDEDVGRERDRVKNGRTQDDILTLIDLSKVY-------------------KSGKKPAVNRLCL 1785          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Cavefish
Match: zgc:172302 (zgc:172302 [Source:ZFIN;Acc:ZDB-GENE-081205-5])

HSP 1 Score: 312.383 bits (799), Expect = 1.018e-89
Identity = 266/889 (29.92%), Postives = 419/889 (47.13%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKN--------------FNAQKENFRKGISNSGDK--------LLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPI--PNGNIPLISPECDCNTTGYQI----CNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRK-----------LYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSL-KFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK------YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRML--------KVSYFNNKIKK--TEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFNFRSVCCKNKNNDVENENQKFAVNNLCF 2500
             DRIAIISQGKL CCGSS+FLK   G GY L  VK                 A  ++ R   +  G +        L+   + ++  A++  +   +    LP   S     +     LD+       +SYGLSDT+LEE+F++VA++     E        PD           +  EP  D ++ +  +   +  +SL          G+ L  QQ+  L  KR  YA R++KG  A+++LP L I + +    +V P+   PA+E+ PW+                  Q  F       N    +P    L S      G  G +C+       T +   P+   + W     PN  +   SP+C C+T   +     C +   G PP   + +T  D L NLTG NISDYL+K +P++ +K            YGGF          S  LIG      +L + V A +  +  +  +SL + +D L   F     + +  ++W N+KG+ +M ++ NI +N LLR+ L     +   +GI+  N P+ + +      ++    +++ L+I VIF +S +PASFV+FL+EERVS +K  QFVSG+ P +YW +NF+WD++ Y +P  ++++IFI F  Q+Y+  KN  A +LLL+ YG AI P MYP SF  S PSTA+V L + NL +G   +++TF+L++   T+E  R  N ILKKVFLIFP + LGRG+ID++ N     M D   +       +  +W+   + L ++ +              GV+  +   +L        ++ +F   +     ED D+  E++R+ + +  DD+L +I+L+K+Y                      +K AVN LC 
Sbjct: 1055 GDRIAIISQGKLCCCGSSLFLKSHLGTGYYLTAVKKELQSRTPTSASGKLLAADTDSTRSDDTGLGSEVNSSVISGLVALAQHYVSGARLVEDVGREVVINLPHAASEDGTLALFLAELDKRQAEFGIISYGLSDTTLEEIFLKVAEETGVDAE--------PDEAATPPAVSPSQQGEPPEDRDETDPLSGDGRGSVSLT---------GWGLTWQQLRALFTKRLLYATRSRKGFIAQIVLPALFILIDLLFSLIVPPMGKYPALELQPWMY---------------GEQFTF-----FSNDAPQDPAMQNLLSALLDPPG-FGTKCLCTGENVGTKFNS-PQIPFSTWKLFNSPNWTMEHPSPDCMCSTEEVRRMLPDCPEGAGGLPPPQIKRLTG-DILQNLTGRNISDYLMKTYPQILKKSMKTKKWVNEFRYGGFSLGAKG----SQTLIGSL----QLEESVMAIRKQYKIAENSSLDQLLDRLPDLFTDLNSQNN-VKVWYNNKGWHAMVSFVNIMNNGLLRASLPPGPER-QKHGITAYNHPLNLTKEQLSDMVLMTTSVDVLLSISVIFAMSLVPASFVLFLIEERVSKAKHLQFVSGVKPILYWTANFVWDMLNYTVPATLVVLIFIGFQQQAYVSEKNLPALVLLLLLYGWAITPLMYPASFVFSVPSTAYVTLTSINLFIGINGSIATFVLELF--TNEHLREVNRILKKVFLIFPHFCLGRGLIDMAKNQA---MADALQRLGTKQTLEPLEWDFVGKNLFAMAV-------------EGVVFFIFTILLQYKFFIRCRLPWFEPVLPPLCAEDEDVGRERDRVKNGRTQDDILTLIDLSKVY-------------------KSGKKPAVNRLCL 1856          

HSP 2 Score: 55.0694 bits (131), Expect = 4.125e-7
Identity = 42/148 (28.38%), Postives = 69/148 (46.62%), Query Frame = 2
Query:    8 RIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVA----DDPAKINEETKNEKLIPDNLNR 439
            R+AI+  G+ QC GS   LK +FGDGY +IL    +A  ++           +  +IK+      ++        + LP   SNSC  + +F  L    + L    Y +S T+L++VF+  A    DD  +++  T N  L+    +R
Sbjct: 2035 RMAIMVNGRFQCLGSVQHLKNRFGDGYTIIL--RLSAPPKD--------PCPVDAYIKNSFTGIVLKERHHNVLQYQLP---SNSCSLARVFDVLSNNYEELGVTDYSISQTTLDQVFVNFAKEQTDDDDQLSGVTVNGGLVAAQTSR 2169          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002495.1 (pep scaffold:Pmarinus_7.0:GL480265:53:27909:1 gene:ENSPMAG00000002218.1 transcript:ENSPMAT00000002495.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 171.014 bits (432), Expect = 4.985e-44
Identity = 157/569 (27.59%), Postives = 262/569 (46.05%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK---------------------NFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAK-------INEETKNEK---LIPDNLNRIAVYGDIENQEP--FLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMN-PSIYRSTHYRCFPEYKNNKWSPI-------PNGNIPLISPECDCNTTGYQI----CNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSS---KLIGDSPFWEELR-DFVNASQANHNQSNLNSLKFIDYLQKTFK----IYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQ 1549
             DRIAIIS G+L+CCGSS+FLK  FG GY L +VK                      F + + N     +N    + + ++ H+PDA++      + +++LP + +    F+ LF  LDE++  L   SYG+SDT+LEE+F++VA++PA        +    +N K   L P +   I        + P    +LE LN+   +D         +  + + G  L+  Q   L IKRFH+A+R++KG  A++ILP + + L +    ++ P    P +++ PW+   +   ++ +     EN    S+ + L NK                     G RCMN  SI  +       E+     SP         N ++   SPEC C+  G ++    C +  +GGPP   R+  ++D L +L+G NISDYL+K +P+  RK      +V    +G  S   K +  S   +++   F N  +  H ++     K +D L    K      G K +  ++W N+KG+ ++ A+ N+ +N  +      +     DYGI+  N P+ + +
Sbjct:  561 GDRIAIISHGRLRCCGSSLFLKNAFGAGYYLTMVKRSGSGGSNSSCLAGLASSSDEGFGSDESNPDSIAANHVSSVTRLLQQHVPDARLIENFGQELTYLLPSHGAKDGTFALLFKELDEKLAELGVSSYGVSDTTLEEIFLKVAEEPAANSHFTNGVKLSARNSKYTYLQPVHAGCICKNYSTCKKAPAELGELEKLNE---LD--------GKGTQQISGVQLILLQFKALFIKRFHHARRSRKGFVAQIILPAVFVCLALVFSLIIPPFGKYPMLQLQPWMYGEQYTFLSNDA---PENVKTNSLYDALLNKPGF------------------GTRCMNGESIPDAACVETKSEWVQPPMSPAMARTMQSRNWSMEDPSPECRCSGEGRRVILPDCPE-GAGGPPPMQRVQNTTDTLEDLSGRNISDYLVKTYPQAIRKSLKHKYWVNEIRYGGLSVGKKKLSHSASPKDMDIVFTNVKRVFHIEN-----KAVDVLYSGVKDMVSFLGPKETI-KVWFNNKGWHAIVAFMNM-ANNAVLRSSLPAGTDPSDYGITAYNHPLNLTK 1089          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Sea Lamprey
Match: abca12 (ATP-binding cassette, sub-family A (ABC1), member 12 [Source:ZFIN;Acc:ZDB-GENE-030131-9790])

HSP 1 Score: 141.354 bits (355), Expect = 1.831e-34
Identity = 124/449 (27.62%), Postives = 212/449 (47.22%), Query Frame = 2
Query: 1130 NLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDII---EDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKYDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKKTE-------DFDISLEKNRMNSEQKF------DDVLQVINLTKIY---NRTFN 2419
            NL+G ++ +YL+    +   K YGG+ F LP +                              S+L  +     L K ++      +  ++W N +GY ++PAY N F+NLLL   L          GISV++ P   +Q ++  D++ Q + +  +AI ++ G S +  SF   +V ER++GSKR Q +SG++P  YW  NF +D++ Y +   + I +  AF   +Y  + N  A  LLLI +G A +P MY  S   S    AFV   + N+++G  T +STF+++ +    D+   +   N I++ +FL+FPQ+ LG G++ LS    K  + +   K    D      + +S   + +  W  + +   G++   L  +L  S+     +K         D D+  E++R+  + +       DD LQ++ L K Y   NR+F 
Sbjct: 1059 NLSGEDVEEYLMGTTCQYLLKRYGGWSFGLPHS----------------------------TTSDLEVVPDNRTLTKVWR------NHMKVWYNPEGYHALPAYVNSFNNLLLWDNLPDGEHPGDYKGISVNSKPYAGQQLSQ--DMILQNLGDTGVAICILLGFSILTGSFATAVVRERITGSKRLQQISGVSPTFYWAVNFTYDMVSYTVTTGLCIAVIAAFHLPAYTDNSNLGAVSLLLILFGFASLPWMYLISGVFSEEEMAFVTYISINIILGVSTIISTFLVNFLYLSSDSQSLYNAYN-IMRWLFLVFPQFCLGWGLVSLS----KQRLMEDIMKLLGSD-----PQESSSFAMDITGWPFVALAVNGIVCFTLRLVLTDSFIRWWRRKAVEPGQPELDTDVQAERSRVEEQSRVVDAATPDDTLQLVGLRKRYRLLNRSFT 1461          

HSP 2 Score: 71.633 bits (174), Expect = 6.187e-13
Identity = 44/141 (31.21%), Postives = 77/141 (54.61%), Query Frame = 2
Query:    5 DRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSG-DKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIP 424
            D++AI+  G+ +C G+   LK +FG+G+ + L           R    NS   ++ +FI SH P A ++ + ++Q  F +P   SN+ K S +F+ L++E ++L+   Y +S T+L++VFI  A     + EE+ N    P
Sbjct: 1652 DKLAIMVNGQFKCLGTLQHLKNRFGNGHMIKL-----------RLSSGNSKVTEVTEFITSHFPGAYLKEQHISQLEFQVP---SNAGKLSEIFIALEKEKESLSIQHYSISQTTLDQVFINFARQQIDMEEESSNADARP 1778          

HSP 3 Score: 70.0922 bits (170), Expect = 1.819e-12
Identity = 67/269 (24.91%), Postives = 109/269 (40.52%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFN----AQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWS------FVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFI---RVADDPAKINEETKNEKLIPDN----LNRIAVYG-------------------DIENQEPFLDLEDLNQQAFVDK-----------SLISLNFNRNHKL----LRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAE 655
            SDRIA++  GKL+CCGS  +LK  +G G  L L K       +Q            ++++  ++S +  A +++   +  +      F+LP +  N    S   V L+E ++ L    Y +SDT+LEEV +   RV  +PA +          P +    L +    G                   DI N+ P  +   +N +                 L SL     H +    + G  LL ++   L  KRFH+ +R+ KG  A+
Sbjct:  581 SDRIAVLEHGKLRCCGSPQYLKEIYGQGLTLTLTKKVRVLCLSQSVTLGSRPPFDPERVVSLVRSGVAGAALKSGEDSSGNRNADMVFLLPAHSQNVLGQS-FLVTLEENMEELGLSGYAISDTTLEEVCLRQQRVMSEPA-LGCSASARYFTPTSAASLLTKATQCGPGLYSCSQLVQEAEDQRLKDITNKSPEAESGSINSETAAPPDHTSPAASSILCLSSLWRTEKHLVKKERVTGIHLLVRKTQALIYKRFHHWRRDVKGAAAQ 847          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006988.1 (pep scaffold:Pmarinus_7.0:GL478499:147909:176415:-1 gene:ENSPMAG00000006318.1 transcript:ENSPMAT00000006988.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 1.146e-6
Identity = 21/36 (58.33%), Postives = 29/36 (80.56%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKN 109
            +D  A++SQG+L+C GSS+FLK KFG GYRL L+ +
Sbjct:  649 ADWKAVLSQGRLKCAGSSLFLKTKFGVGYRLTLITD 684          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006855.1 (pep scaffold:Pmarinus_7.0:GL486953:391:4596:1 gene:ENSPMAG00000006189.1 transcript:ENSPMAT00000006855.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 2.349e-6
Identity = 33/125 (26.40%), Postives = 59/125 (47.20%), Query Frame = 2
Query:    8 RIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLE---EVFIRVA 373
            R+AI+  G  +C GS   LK +FGDGY + +           R   +    ++L+F     PDA ++    T+  +   Q  S +   + +F  +++ +D L    Y +S T+L+   +VF+  A
Sbjct:  192 RLAIMVNGHFKCLGSIQHLKNRFGDGYMITI-----------RTRSTLHVKEVLRFFSRSFPDAVLKERHHTKVQY---QLKSETLSLAAVFTKMEQVLDVLGVEDYSVSQTTLDNDPQVFVNFA 302          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Nematostella
Match: EDO46878 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNL9])

HSP 1 Score: 321.242 bits (822), Expect = 2.818e-93
Identity = 265/839 (31.59%), Postives = 417/839 (49.70%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK-----NFNAQKENFRKGISNS------------GD---------KLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSL-ISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIPNGNIPLISPECDCNTTGYQICNDPRSGGPPNSYRIMTSSDK--LNNLTGYNISDYLLKNFPKLSRKLY-GGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNY-------IKYNMTDGYAKYDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKKTEDFDISLEKNRMNSE-QKFDDVLQVINLTKIY 2404
             DRIAIISQGKLQCCG+S+FLK  +G+GY L L K       ++   + R  + +             GD          +  FIKSHIP A +     T+ ++VLP + +   KF  +F  LD  +  L+  SYG+SDT+LEEVF++VA++    +EE      +P   +         +  P   L+   Q    + S+  SL F+       G  LL +Q   L +KRFH+ +RN+K   A+ I+   +   +  ++  + P    PA+E++P            + F ++E   N+ +     N +   PL   L   +    G  G  CM+ +  R       P       SP+P       SP+CDC +    +C     G PP ++   TS D   +  ++G NISDYLLK + K  +K Y    + ++   +G  S   GD+          N   AN   S+  +++ +           I     +IW N+KGY ++PA+ N  SN +LR++     +    YGI+  N P+   +     +   +  +++ +AI V+F LSF+PASFV+FLV ERVS +K    VSG+ PY+YW++N++WD+  Y IP ++ + IF+AF  +SY  + N      LL+ YG +I P MYP S F S  STA++VL + NL VG   T++TFIL++ ED D+     N +LK VFL+FP Y LGRG+IDL+ N           N+T      D F W++    + ++I+   +++ + ++IE     R   ++  V      +++ ED D+  E+ R+NS      D L+++NLTK+Y
Sbjct:  569 GDRIAIISQGKLQCCGTSLFLKSHYGNGYYLTLTKKTPGLGLDSVDASERDSLGSRSSDSDPISDSVLGDYSDVYCNEKSVTSFIKSHIPSASLVEHVGTELTYVLPSHAAKEGKFQDMFEELDRNLHKLHVGSYGVSDTTLEEVFLKVAEEAQ--SEEAGTSAEVPVRRSTFTF-----SSHPVKCLQPPAQGDSKNDSVDGSLEFDDRES---GLALLLRQFFALLVKRFHHCRRNRKAFIAQ-IILPAVFVCLAMIVAQIRPFYEKPALELTP------------HMFVKEEPYENYVL---YANDDPGEPLARNLSDAFLQYPG-LGTWCMSNNCSRK------PIAFQPSLSPVPTP-----SPDCDC-SEAMNVCPAGAGGPPPPTW---TSYDGNIIQKMSGRNISDYLLKTYMKFVKKRYINKIEIMIVREYGGLS--FGDN---------YNNLPANVRNSSDPAIRRL-----------ISPRNVKIWYNNKGYHALPAFLNTLSNTVLRAKAKARGLDPSQYGITAYNHPMNYTKEQLDDETFVKRAVDVLVAICVVFALSFVPASFVVFLVSERVSKAKHLHLVSGVKPYIYWLANYVWDMCNYFIPAMLCVFIFLAFGDESYTTAMNFPPTFCLLLLYGWSITPLMYPASHFFSVSSTAYIVLISINLFVGINCTLATFILELFED-DKELTDINTVLKSVFLVFPNYCLGRGLIDLAKNQFLGIFSRFGVNLTR-----DPFSWDITGRNIFAMIIEGFVFFTLTVLIEY----RFFIKLRPVKVVLKPVEE-EDDDVQRERQRVNSGLGHATDALRLMNLTKVY 1332          

HSP 2 Score: 55.8398 bits (133), Expect = 8.396e-8
Identity = 38/126 (30.16%), Postives = 61/126 (48.41%), Query Frame = 2
Query:    5 DRIAIISQGKLQCCGSSVFLKRKFGDGYRLIL-VKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADD 379
            +R+AI+  G+++C GS   LK KFGDGY +IL V   N   E           ++ QFI    P+A ++ +      + +P         S LF +L+      +   Y ++ T+L++VFI  A D
Sbjct: 1525 NRVAIMVNGQMKCLGSPQHLKNKFGDGYTVILRVAGSNPDTE-----------QVCQFIIQCFPNAVLKDKHHNMVEYQIP---CQGLSVSRLFGHLEANRKMFDIEDYSVTQTTLDQVFINFAKD 1636          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Nematostella
Match: EDO38879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBQ0])

HSP 1 Score: 291.582 bits (745), Expect = 3.739e-83
Identity = 260/891 (29.18%), Postives = 416/891 (46.69%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNF----NAQKENFRKGISN-------SGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINE-----ETKNEKLI----------PDNLNRI-------------------AVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRN---------HKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESL------PAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSIN-PLTDRLESEYRSDLGESGIRCMNPSIYRST-------------HYRCFPEYKNNKWSPIPNGNIPLISPECDCNTTG-YQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKF---LDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKYDA----FDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIK--------KTEDFDISLEKNRMNSEQKFDDVLQVINLTKIY 2404
             DRIAIIS GKL+C GS ++LKR+FG+GY L LVK      +    +FR+  S+       S +KL  FI SHI  A+++ +T  +++F+LP N      F  LF +L++ ID L   SYG++ T LEEVF++V D    +NE       + +KL           P +L  +                    V    E+ E  L  + L+       +L +   N +            L G  L  QQ   L +KRFHYA+RN KG+ ++++LP L I + + +   + P   L      P+M   P  +   + +  +N   ++  Q   ++++ +G    +  P  D L S  +  L +S +  M     R               H   +  Y N+  +   +       P C C+  G + +C+   +G  P     +T  D L N+TG N+S+YLL          YG   F                     +  FV         S L+S+  ID +++      I+ + ++ W N+KGY ++P Y N+ +N +LR+ + KS      YGI+  N P     ++      D + Q   ++ +AIFVI  +SF+PASFV+FLV ER + +K  QFVSG++P VYW+SN+LWD+  Y+IP +  I +   F   +Y    N  A + L + YG +I P MYP +F  S  S+A+V +   NL VG   T++TFIL +  D DE     N+++K + L FP Y LGRG++DL+ N           + D+    F+W + S  L  +++              G    +L  +++  +F  + +        +TED D++ E++R+      DD++++ NLTKIY
Sbjct:  801 GDRIAIISSGKLRCVGSPLYLKRRFGEGYNLTLVKKSISSPHGSIGSFRRSTSSNLEASRRSEEKLTSFITSHISSAQLKHKTNQEFTFILPDNSIKRGAFKKLFADLEQNIDVLGIDSYGITHTLLEEVFLKVTD--VSLNETGNMPHHRQDKLPTQLLQFPADKPGHLGHVLLSPPLPTLPTNEGLEMSDVVRNRGEDTERLLGYQPLSDSGTHQGNLYNEASNGHAAGLFEGVGSHTLTGSALQWQQFYALMLKRFHYARRNFKGVISQILLPALFICIAMTMALSLPPKPDLPPLELSPSMFYQPNYIPFGNEAKGMNILAKRLEQ-TLTLSSGIGATCCLRYPQYDLLNSTVK--LTKSQVALMFDKSCRKAIDEVSGVYLKPNKHRFSYIYYTNSSMNVSESVTHQKAGPGCRCSANGTWYLCDQGAAGKQPKELVTITR-DTLQNVTGRNMSEYLLYTTQTFRMHRYGALSF-------------------GNVVQFV--------PSRLDSVH-IDAVRRL----AIREA-SKSWYNNKGYHALPTYLNVMNNAILRASIPKSKGNPAAYGITAYNHPFPFNSTSAVHLSADYLRQGT-DLVIAIFVIIAMSFVPASFVVFLVTERSTKAKHLQFVSGVDPVVYWLSNYLWDMCNYLIPALACITLLYLFGVPAYASETNFPAVVGLFMLYGWSITPMMYPSAFCFSEASSAYVAMIVLNLFVGVTATVTTFILQLFPD-DEVLTDVNDVIKLISLGFPNYCLGRGLMDLAYNQYLSEYYRQIGEEDSIKSPFEWMIVSRNLVCMLM-------------EGFAFFILTILIEFKFFLKRRRIPVSQLPIETEDEDVAAERDRVLRGDADDDLVKIENLTKIY 1637          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Nematostella
Match: EDO48951 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI12])

HSP 1 Score: 102.449 bits (254), Expect = 3.356e-22
Identity = 70/209 (33.49%), Postives = 116/209 (55.50%), Query Frame = 2
Query: 1505 DYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITT----MSTFILDI--IEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNY 2113
            + GI  +N P+      K  D V   I  + LAIF+  G++F+ ASF+ FLV+ER S +K  QFVSG++ + YW + + WD + Y++P ++I+I+F AF  + +    +  +  LLLI +GL ++P +Y  SF   +   A+    A  + V SI +    ++ F+  I  +   DE      EI+  VF++ P Y +   +ID+S+NY
Sbjct: 1119 EQGIETTNHPLPNNAQNK-ADNVTSTISVLFLAIFMSMGMAFMAASFITFLVQERTSKAKHLQFVSGVDAFSYWSATYTWDFLNYLVPCLLILILFAAFQIEEF--ENDMGSVFLLLILFGLVVLPFIYVMSFAFKSQLIAY----AMTVFVLSIMSFGMLLAVFLCRIPSLNLLDEA-----EIMHYVFMLLPTYTVSYALIDMSTNY 1315          

HSP 2 Score: 95.5153 bits (236), Expect = 5.028e-20
Identity = 68/222 (30.63%), Postives = 108/222 (48.65%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNR----NHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAE 655
             DRIAI++ G+L+CCGSS+FLK ++G GY L LVK  +              + ++  ++  +P A++ +    +  FVL  N   S  F  LFV L+   ++    SYG+S T++EEVF++V +          +EK + D LN              L L  L+ Q+ +    I +   R    N+ L  GF L  Q    + +KRF  +KR+KK +  +
Sbjct:  699 GDRIAIMADGQLRCCGSSLFLKSRYGVGYHLTLVKKEDCDD-----------NAIINAVRETVPSAQVLSNVGAEIEFVL--NGEASKDFESLFVKLENNKEDYGIASYGVSCTTMEEVFMKVGEG---------SEKTVEDILN--------------LLLRILSSQSLLRYQNIKIKILRLLKSNYPLQTGFALQWQHYKAMLVKRFINSKRDKKSVVTQ 884          

HSP 3 Score: 56.9954 bits (136), Expect = 3.141e-8
Identity = 39/124 (31.45%), Postives = 65/124 (52.42%), Query Frame = 2
Query:    8 RIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADD 379
            R+AI+  G+ +C GS+  LK +FG GY L+L      + E     +SN+     QF+ S  P A++        ++   Q +S    +S +F  L+    +LN + Y +S TSLE+VF+ +A +
Sbjct: 1612 RLAIMVNGQFKCVGSAQHLKSRFGMGYTLML------KVEARLVPVSNTE----QFVSSTFPGAQLLESHNGMLTY---QINSTELSWSRIFGELERNRASLNIVDYSVSQTSLEQVFLNLAKE 1722          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Nematostella
Match: EDO32071 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW57])

HSP 1 Score: 55.8398 bits (133), Expect = 2.766e-8
Identity = 37/124 (29.84%), Postives = 63/124 (50.81%), Query Frame = 2
Query:    8 RIAIISQGKLQCCGSSVFLKRKFGDGYRL--ILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVA 373
            R+ I+ +G+L+C GS+  LK KFG GY L   L  +F +   +      +   +L+ F++   P+AK       +  + +P+  SN  K S  F  L+E   ++    Y  S ++LE+VF+  A
Sbjct:  184 RVGIMVKGQLKCLGSTQHLKSKFGSGYTLEIKLSPSFQSSDPDV-----DMQTQLVAFVEGLFPNAKRTESFGDRVIYKVPK--SNVSKLSSTFATLEEGKRSIGIEEYSFSQSTLEQVFLEFA 300          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Nematostella
Match: EDO28092 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7F9])

HSP 1 Score: 53.5286 bits (127), Expect = 4.536e-8
Identity = 37/117 (31.62%), Postives = 62/117 (52.99%), Query Frame = 2
Query:    8 RIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEV 358
            R+AI+  G+ +C GS+  LK +FG GY L+L      + E     +SN+ ++  QF+ S  P A++        ++   Q +S    +S +F  L+    +LN + Y +S TSLE+V
Sbjct:   76 RLAIMVNGQFKCVGSAQHLKSRFGMGYTLML------KVEARLVPVSNT-EQAQQFVSSTFPGAQLLESHNGMLTY---QINSTELSWSRIFGELERNRASLNIVDYSVSQTSLEQV 182          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Medaka
Match: ENSORLT00000045391.1 (ATP-binding cassette sub-family A member 1-like [Source:NCBI gene;Acc:101164844])

HSP 1 Score: 348.977 bits (894), Expect = 3.270e-102
Identity = 267/872 (30.62%), Postives = 442/872 (50.69%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKN----FNAQKENFRKGI---------------------------SNSGD--KLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINE-ETKNEKLIPD-----------NLNRIAVYGDIENQEPFLD------LEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMN----PSIYRSTHYRCF--PEYKNNKWSPIPNGNIPLI--SPECDCNTTGYQI----CNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKT---FKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNR 2410
             DRIAIIS GK++CCGSS+FLK+ FG GY L LV++      AQ+     GI                           SN  D   + QF++ H+P+A        + +F+LP   +    F+ LF  LD+ +D L   SYG+SDT+LEE+F++VA+D     E     E ++ D           +++R        N +  L       +ED  + A V+         R   ++ G+ L++QQ + L IKRFH+A+R++KG+ A+++LP + + L +    +V      P++E+ PW+   ++      TFY          +N +    +++ + + L      D    G RCM     P +  S+    +  P    +      NGN  +   SP C C+T G  I    C     G P    R+  ++D L NLT  N++D+LLK +    +K YGG      S  G +S+++            +   +     +NL    + D +QK     K  G + +  ++W  +KG+ SM ++ ++ +N +LR  L +       YG+SVSN P+ + +    L  +     ++ ++I VIF +SFIPASFV+FL++ERVS +K  QFVSG+NP VYWV++F+WDI  Y+IP  +++ IFI F  ++Y+  +N  A ILLL+ YG AI P MYP SF  + PSTA+VVL   NL +G   +++TF++++ E  DE+    N I+K+V LIFP + LGRG++D++ N    N+   + +    D   W +  + L ++ +   + +   +     +I    +   ++S    + ++ ED D++ E+ R++  +  +DVL++ +LTK+Y R
Sbjct:  753 GDRIAIISHGKMRCCGSSIFLKKSFGSGYYLTLVRSGTEVMTAQRSGIISGIAEEKPTESDCPSSSSLDEDRGCQSSDNSNPTDLKHVTQFVRRHVPEAVFLESIGQEITFILPYARARDGTFATLFQELDKVMDKLGLTSYGVSDTTLEEIFLKVAEDTGVDKELSPTKEPVVKDYKKDSRESKRRSMSRFHGKAAKGNTKDELKKKLSNKVEDFKKSASVN--------GRGSVVITGWKLIRQQFLALFIKRFHHARRSRKGLIAQVVLPAIFVCLALVFSLIVPSFTDYPSLELQPWMYNSQT------TFY----------SNDMPEDANVSRVVETL-----VDNPGFGTRCMEGNPIPRLPCSSGASDWFSPSVDQSVADIFLNGNWSMSNPSPSCQCSTPGRTIIMPDCPPGAGGLP-PPQRVQNTTDTLLNLTSINMTDFLLKTYEHSGKKRYGGI-----SVGGINSQVL------------LTEVEIEEAFANLEPPGYGDTIQKAEMVLKKLGTRNN-VKVWFYNKGWHSMVSFLSVVNNGILRGYLPEGQ-NLRQYGLSVSNHPLNLSKEQLSLSAMASTSSDVVVSICVIFAMSFIPASFVLFLIQERVSKAKHLQFVSGVNPTVYWVASFVWDICNYVIPCFLVVGIFICFQQKAYVSPQNLPALILLLVMYGWAITPMMYPASFIFTVPSTAYVVLTCLNLFIGINGSVATFVMELFE--DESITKINNIVKQVLLIFPHFCLGRGLMDMARNQAMANVFSNFGEDRFEDPLSWNMVGKNLIAMSIQGAVMFAFTL-----LIQYKFFYKPRLSLPKVQSEEKEDVDVARERQRVHEGRANNDVLRICDLTKVYPR 1568          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Medaka
Match: ENSORLT00000046301.1 (ATP-binding cassette sub-family A member 1-like [Source:NCBI gene;Acc:101164844])

HSP 1 Score: 348.591 bits (893), Expect = 4.183e-102
Identity = 267/872 (30.62%), Postives = 442/872 (50.69%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKN----FNAQKENFRKGI---------------------------SNSGD--KLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINE-ETKNEKLIPD-----------NLNRIAVYGDIENQEPFLD------LEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMN----PSIYRSTHYRCF--PEYKNNKWSPIPNGNIPLI--SPECDCNTTGYQI----CNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKT---FKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNR 2410
             DRIAIIS GK++CCGSS+FLK+ FG GY L LV++      AQ+     GI                           SN  D   + QF++ H+P+A        + +F+LP   +    F+ LF  LD+ +D L   SYG+SDT+LEE+F++VA+D     E     E ++ D           +++R        N +  L       +ED  + A V+         R   ++ G+ L++QQ + L IKRFH+A+R++KG+ A+++LP + + L +    +V      P++E+ PW+   ++      TFY          +N +    +++ + + L      D    G RCM     P +  S+    +  P    +      NGN  +   SP C C+T G  I    C     G P    R+  ++D L NLT  N++D+LLK +    +K YGG      S  G +S+++            +   +     +NL    + D +QK     K  G + +  ++W  +KG+ SM ++ ++ +N +LR  L +       YG+SVSN P+ + +    L  +     ++ ++I VIF +SFIPASFV+FL++ERVS +K  QFVSG+NP VYWV++F+WDI  Y+IP  +++ IFI F  ++Y+  +N  A ILLL+ YG AI P MYP SF  + PSTA+VVL   NL +G   +++TF++++ E  DE+    N I+K+V LIFP + LGRG++D++ N    N+   + +    D   W +  + L ++ +   + +   +     +I    +   ++S    + ++ ED D++ E+ R++  +  +DVL++ +LTK+Y R
Sbjct:  753 GDRIAIISHGKMRCCGSSIFLKKSFGSGYYLTLVRSGTEVMTAQRSGIISGIAEEKPTESDCPSSSSLDEDRGCQSSDNSNPTDLKHVTQFVRRHVPEAVFLESIGQEITFILPYARARDGTFATLFQELDKVMDKLGLTSYGVSDTTLEEIFLKVAEDTGVDKELSPTKEPVVKDYKKDSRESKRRSMSRFHGKAAKGNTKDELKKKLSNKVEDFKKSASVN--------GRGSVVITGWKLIRQQFLALFIKRFHHARRSRKGLIAQVVLPAIFVCLALVFSLIVPSFTDYPSLELQPWMYNSQT------TFY----------SNDMPEDANVSRVVETL-----VDNPGFGTRCMEGNPIPRLPCSSGASDWFSPSVDQSVADIFLNGNWSMSNPSPSCQCSTPGRTIIMPDCPPGAGGLP-PPQRVQNTTDTLLNLTSINMTDFLLKTYEHSGKKRYGGI-----SVGGINSQVL------------LTEVEIEEAFANLEPPGYGDTIQKAEMVLKKLGTRNN-VKVWFYNKGWHSMVSFLSVVNNGILRGYLPEGQ-NLRQYGLSVSNHPLNLSKEQLSLSAMASTSSDVVVSICVIFAMSFIPASFVLFLIQERVSKAKHLQFVSGVNPTVYWVASFVWDICNYVIPCFLVVGIFICFQQKAYVSPQNLPALILLLVMYGWAITPMMYPASFIFTVPSTAYVVLTCLNLFIGINGSVATFVMELFE--DESITKINNIVKQVLLIFPHFCLGRGLMDMARNQAMANVFSNFGEDRFEDPLSWNMVGKNLIAMSIQGAVMFAFTL-----LIQYKFFYKPRLSLPKVQSEEKEDVDVARERQRVHEGRANNDVLRICDLTKVYPR 1568          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Medaka
Match: zgc:172302 (ATP-binding cassette sub-family A member 1 [Source:NCBI gene;Acc:101162276])

HSP 1 Score: 316.62 bits (810), Expect = 3.963e-91
Identity = 273/912 (29.93%), Postives = 433/912 (47.48%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK------------------------------NFNAQKENFRKGISNSGD---KLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPS--------IYRSTHYRCFPEYKNNKWSPIPNGNIP--LISPECDCNTTGYQI----CNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKL-----------YGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHN---QSNLNSL--KFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK------YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNN----------KIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFNFRSVCCKNKNNDVENENQKFAVNNLCF 2500
             DRIAIIS+GKL CCGS +FLK + G GY L +VK                              + ++  E+   G   S      LL  ++ HIP A +  E+  +    LPQ  +     +     LD+ +  L   SYGLSD++LEE+F+RVA++   ++ E + E+L P   N     G+   ++P     +  +   ++  L+S +  R  + L G  L+ QQ+  L IKR+ YA+R+++G FA+++LP L + + +    +V P    P++E+ PW+   +       TF+  +   N ++ N L               E   D    G +CM           +     +R  P+   + W     GN      SPEC C+T         C +   G PP   + +T  D L NLT YN+SDYL+K + ++ +K            YGGF            K+       E + D V+A +  +     S+L+SL  K   +L+       +K     +W N+KG+ SM ++ N+ +N LLR+ L     +   +GIS  N P+ + +       +    +++ ++  VIF +SF+PASFV+FL+EER S +K  QFVSG+ P +YWV+NF+WD++ Y +P  ++++IFI F  +SY+  +N  A ILLL+FYG +I P MYP SF  + PSTA+VVL + NL +G   +M+TF+L++    D+     N +LKKVFLIFP + LGRG+ID++ N     M D + +       D F W+   + L  +                GV   +   +L+  +F +               ED D++ E+ R+ S +   D+L +INL+K+Y                      +K AVN LC 
Sbjct: 1127 GDRIAIISKGKLCCCGSPLFLKSQLGSGYYLTVVKREETNPNTPSGSSFSTSTSIITNKLPHAKDSESSLSEDTGLGSDESSSCVAALLALVQQHIPSASLVEESRREAVINLPQKAAKDGSLAIFLSKLDQRLPELGISSYGLSDSTLEEIFLRVAEE-TGVDAEPEQEELSP---NSQQPSGERVEEQP----AEQPEPEPLETDLLSGDC-RGGEPLSGSWLMWQQLKALFIKRWLYARRSRRGFFAQIVLPALFVLVALLFSLIVPPFGRYPSVELQPWMYGEQY------TFFSNDAPGNPAMENLL---------------EALLDQPGFGTKCMEKEEGNNTSCEVEGGGQFR-RPQVSFSMWQMFSKGNWSKERPSPECQCSTEDVSRMLPECPEGAGGLPPPQIKRVTG-DILQNLTSYNVSDYLVKTYAQILKKSLKTKKLVNEFRYGGFSL--------GGKVTQTEVDVEHVEDAVSAFRRRYQVTQNSSLDSLLNKLPAFLEGLHSKDNVK-----VWFNNKGWHSMVSFVNVMNNGLLRASLPPGPER-SKHGISAYNHPLNLTKDQLTEVALMATSVDVLISTCVIFAMSFVPASFVLFLIEERASKAKHLQFVSGVQPLLYWVANFIWDMLNYAVPAAMVVLIFIGFQQKSYVSEQNLPALILLLLFYGWSITPLMYPASFVFTVPSTAYVVLTSINLFIGINCSMATFVLELF--VDDNLNQINNVLKKVFLIFPHFCLGRGLIDMAKNQA---MADAFHRLGARPVLDPFQWDFVGKNLFCMAAS-------------GVFYFIFTILLQYKFFIHLKPWWTEPQLPPIGPEDEDVARERARVMSGKFHSDILTMINLSKVY-------------------KAGKKPAVNRLCL 1955          

HSP 2 Score: 54.299 bits (129), Expect = 6.558e-7
Identity = 34/125 (27.20%), Postives = 62/125 (49.60%), Query Frame = 2
Query:    8 RIAIISQGKLQCCGSSVFLKRKFGDGYRLIL-VKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADD 379
            R+AI+  G+ QC GS   LK +FGDGY +IL + +  +  E+           + +++    P+ +++ +      + LP   S+ C  + +F  L    + L    + +S T+L++VFI  A D
Sbjct: 2134 RMAIMVNGQFQCLGSVQHLKNRFGDGYTVILRLADTKSDTESC---------PVDEYMTKSFPNIELKEQHQNVLQYHLP---SHGCSLALIFDALANNCEELGVADFSVSQTTLDQVFISFAKD 2246          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Medaka
Match: ENSORLT00000025407.2 (ATP-binding cassette sub-family A member 1 [Source:NCBI gene;Acc:101163308])

HSP 1 Score: 302.753 bits (774), Expect = 1.831e-86
Identity = 272/927 (29.34%), Postives = 444/927 (47.90%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK-----------------NFNAQ-KENFRKGISNSG----------------------------DKLL--QFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFL-----DLEDLNQQA----FVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNP-SIYRST--------HYRCFPEYKNNKWSPIPNGNIPL--ISPECDCNTTGYQI----CNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRK-----------LYGGFQF------VLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLK-FIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERG--VINRVLYRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFNFRSVCCKNKNNDVENENQKFAVNNLC 2497
             DRIAIIS GKL C GSS++LK + G GY L LVK                 +FN + +EN     S++G                            D  L    I  H+P A++  +   + +++LP + + +  F  LF +LD ++  L   SYG+SDT+LEE+F++VA+D     E   +  L      R   +G  E+Q         D  D N         +   +S    +    + G+ L +QQ + L  KRF YA+R++KG FA+++LP + + + +    +V P    P++E+ PW+                E+Q+ F   +  G+ N    L   +E          G RCM+  SI  S         H    PE     +S   +GN  +   SP C C + G +     C     G PP   + ++++D L NLTG NISDYL+K + ++  K            YGGF        VLP      +  I D+   E +R+     +       L+SL  FI+ L     +        ++W N+KG+ S+PA+ N+ +N +LR+ L   A    +YGI   N P+ + +       +    +++ ++I VIF +SF+PASFV+FL++ERV+ +K  QF+SG+ P +YW +NFLWD+  Y +P  ++I+IF+ F  ++Y+ S N     LLL+ YG +I P MYP SFF + PSTA+VVL + N+L+G   ++STF++++  D +      N+ILK V LIFP + LGRG+ID+  N    +  + + +       +W++  + L ++ +  ++++II ++I+    +  R + ++ K+          ED D++ E+ R+       D+L++  LTK++ R                    QK AV+ LC
Sbjct: 1104 GDRIAIISHGKLCCVGSSLYLKNQLGSGYYLTLVKKDPETSLSSCRNSSSTISFNKKDEENTSVSSSDAGLGSEHESEAATIENGPAASICTVPFVPTDTSLVSALILRHVPTARLVEDLGHELTYILPYSAAKNGAFVELFKDLDLKLHELGISSYGVSDTTLEEIFLKVAEDNGVDTEVLSDGTLPVRARRRTHAFGGGEHQSCLKPISEDDTYDCNDSEGDPDCRETDWLSCTEGKGSYQVNGWSLRRQQFVALMWKRFLYARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLELQPWMY---------------EDQVTFISDDAPGDANMQKLLKSLMEPP------GFGTRCMDGYSIPESPCTMGDEDWHNPDVPESLQQLFS---SGNWTMENPSPSCFCASDGKKRMLPDCPVGAGGLPPPEMK-LSATDTLQNLTGRNISDYLVKTYAQIIGKSLNNKVWVNEFRYGGFSLGARSTQVLPP-----ANEIDDA--IERVRNIFELQKGAAADRFLDSLSNFINGLDTKNNV--------KVWFNNKGWHSVPAFMNVMNNAILRANLPPGADPS-NYGIMSFNHPLNLTKEQLSQVALVTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPLLYWTANFLWDMCNYFVPAALVILIFVCFQQKAYVSSANLPVLALLLLLYGWSITPLMYPASFFFTIPSTAYVVLTSVNILIGINGSISTFVMELFGDHE--IGGINDILKNVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFRSPLEWDMVGKNLFAMAVEGVVFFIITLLIQYKFCIKPRPISKLTKMGSLGE-----EDEDVARERQRIVQGLGQGDILELRQLTKVFKR-------------------KQKPAVDRLC 1963          

HSP 2 Score: 50.8322 bits (120), Expect = 6.480e-6
Identity = 34/124 (27.42%), Postives = 60/124 (48.39%), Query Frame = 2
Query:    8 RIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADD 379
            R+AI+  G+ +C GS   LK +FGDGY +IL             G       +++FI+S +  + ++ +      + LP   S+    + +F  L +  D L    Y ++ T+L++VF+  A D
Sbjct: 2143 RMAIMVNGRFRCLGSVQHLKNRFGDGYTIILRV----------AGPDPDLLPVMKFIESELSGSTLKEKHRNMLQYQLP---SSLTSLAHIFSILAKNKDTLRIEDYSVTQTTLDQVFVNFAKD 2253          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Medaka
Match: abca1a (ATP-binding cassette sub-family A member 1 [Source:NCBI gene;Acc:101163147])

HSP 1 Score: 301.212 bits (770), Expect = 6.792e-86
Identity = 262/900 (29.11%), Postives = 430/900 (47.78%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK-NFNAQKENFR------------------------KGISNSGDK---------LLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIEN-QEPFLDLE-DLN-QQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCM------NPSIYRSTHYRCFPEYKNNKWSPIPNGNIPL--ISPECDCNTTGYQI----CNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRK-----------LYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIF--XXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRML---KVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFNFRSVCCKNKNNDVENENQKFAVNNLC 2497
             DRIAIIS GKL C GSS+FLK   G GY L +VK +++   ++ R                         G+ +  D          +   I  H+ +A++  +   + ++VLP   +    F  LF  LD+ + +L   SYG+SDT+LEE+F++VA+D + ++    ++ ++P    R   +GD ++  +PF + E D N  +   +   +     +    ++G+ L +QQ + L  KRF YA+R++KG FA+++LP + + + +    +V P    P++ + P             + Y +  Q +F I+N + +    +P T++L        G  G RCM      N            PE   +       GN      SP C C+  G +     C D   G PP   RI +  D L NLTG N+SDYL+K + ++  K            YGGF     S+   S K   D    +  R F       H +    + +F   L    +    K +  +IW N+KG+ S+ ++ N+     L       K   KF   GI+  N P+ + +       +    +++ ++I VIF +SF+PASFV+FL++ERV+ +K  QF+SG+ P++YW++NF+WD+  YI+P  ++IIIF+ F   +Y+ S N     LLL+ YG +I P MYP SFF   PSTA+VVL + N+L+G   ++STF+L++    +      N+ILK VFLIFP + LGRG+ID+  N    +  + + +        W++  + L ++ +  ++++         +   + YR     + S  + K    ED D++ E+ R+ S     D+L++  LTKIY R                    QK AV+ LC
Sbjct: 1102 GDRIAIISHGKLCCVGSSLFLKTHLGTGYYLTMVKRDYDLALQSCRNSASTVSYSKKTEKEDSISESSSDAGLGSEPDSETTTIDVSLISNVIFKHVREARLVEDLGHELTYVLPYQSAKDGAFVELFHELDDRLTDLGISSYGISDTTLEEIFLKVAED-SGVDAVELSDGVVPTRTRRRHAFGDHQSCLKPFTEDEFDFNDSEESRETDWLGGADGKGSFQVKGWSLKRQQFVALLWKRFLYARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLALHP-------------SMYGE--QFSF-ISNDMPD----DPHTNKLLGALMEKPG-FGSRCMKGEPIPNTPCTAVEDEWAVPEVSESLRDIFAKGNWTRENPSPLCQCSCEGRKRMLPECPDGAGGLPPPQMRI-SDKDTLQNLTGRNVSDYLVKTYAQIIGKSLKNKIWVNEFRYGGFSLGARSSQFLSHKDDIDVAIAQLRRRF-------HLERGTAADRFFHSLSSFIQGLDSKNN-VKIWFNNKGWHSISSFLNVMNNGILRASLPAGKDPTKF---GITAYNHPLNLTKEQLSQVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPFLYWLANFVWDMCNYIVPATLVIIIFVCFQQDAYVSSTNLPVLALLLLLYGWSITPLMYPASFFFKIPSTAYVVLTSVNILIGINGSVSTFVLELFGSNE--IGGINDILKNVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFRSPLAWDMVGKNLFAMAVEGVVFFC--------ITVLIQYRFCITTRSSISHLKPIGEEDEDVARERQRVLSGSGQSDILELRELTKIYKR-------------------KQKPAVDRLC 1938          

HSP 2 Score: 51.9878 bits (123), Expect = 3.233e-6
Identity = 34/124 (27.42%), Postives = 60/124 (48.39%), Query Frame = 2
Query:    8 RIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADD 379
            R+AI+  G+ +C GS   LK +FGDGY +IL         + R         ++ FI+  +P + ++ +      + LP   S+    + +F  L +  + L    Y +S T+L++VF+  A D
Sbjct: 2118 RMAIMVNGRFRCLGSVQHLKNRFGDGYTIIL--RVAGPDPDLR--------PVMGFIERELPGSTLKEKHRNMLQYQLP---SSLTSLARIFSLLSKNKETLCIEDYSVSQTTLDQVFVNFAKD 2228          
BLAST of ATP-binding cassette sub-family A member 1 vs. Planmine SMEST
Match: SMESG000029534.1 (SMESG000029534.1)

HSP 1 Score: 1401.34 bits (3626), Expect = 0.000e+0
Identity = 746/835 (89.34%), Postives = 782/835 (93.65%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIPNGNIPLISPECDCNTTGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKYDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNN-KIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFNFRSVCC-KNKNNDVENENQKFAVNNLCF 2500
            SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAELILPILMITLMIALLKLVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIPNGNIPLISPECDCNTTGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNF KLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIW NSKGYVSMPAYANIFSNLLLRSRLNKSAVKFIDYGISVSNFPIEMEQSTKFLDLV QMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYIIPIIIIIIIFIAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLN YNLLVG+ITT+STFILDI+E   E  +  N+ILKKVFLIFPQ++LGRG++DL  NY   + +    +Y+A  W++A EKL SL  L + WWI+LIIIE G++NR++   LK SY    +I+ TEDFD++LE+ RM+S+QK DDVL+VINLTKIYN    F+  C  K K+N ++N+ ++ AVNNLCF
Sbjct:  947 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAELILPILMITLMIALLKLVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIPNGNIPLISPECDCNTTGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFRKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWVNSKGYVSMPAYANIFSNLLLRSRLNKSAVKFIDYGISVSNFPIEMEQSTKFLDLVIQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYIIPIIIIIIIFIAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNVYNLLVGTITTISTFILDILEGNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCF 1781          
BLAST of ATP-binding cassette sub-family A member 1 vs. Planmine SMEST
Match: SMESG000029537.1 (SMESG000029537.1)

HSP 1 Score: 1023.85 bits (2646), Expect = 0.000e+0
Identity = 585/836 (69.98%), Postives = 669/836 (80.02%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPA-KINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLE-DLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXX-XXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIPNGNIPLISPECDCNTTGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKYDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFNFRSVCCKNKNNDVENENQKFAVNNLCF 2500
            SDR+AIISQGKLQCCGS VFLKRKFG+GY L L+KN N    + R     +G+ +L+F+K +I DA+M  E+  QW+ VLPQND NS KF+ LF NLD+ +  ++ +SYGLSDTSLEEVF++VADDP  K+  + K+      N+ ++ +  +    E FL+   D  Q  F+D+S        +H LL+GFPLL+QQII L IKR+HYAKR+ KG  AELIL  ++++ +++ L   + P + +P M+ISPWLMM K    NLNTFYRKEN         LG       L ++LESEYRSDLGESGIRCMNPSIYR  +Y+CF   +NN WSP    +IP++SPECDC+ TG QICND RSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNF +LSRK++GG+QF+LP+ F  SSKLI  SP W+ +RD VN SQ      NL  L+F+ Y Q+ F       +F+RIW NSKGY SMPAYANI SNLLLRSR+  S   + +YGISV+N+PI  +  TK     N ++LE++LAI+VI  LSFI ASFVIFL++ER+SGSKRQQFVSGINPYVYWVSNFLWDIMKYIIPIIIIIIIFIAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKYDAFDWEVASEKLASLILLFLLWWIILIIIERGVINRVLYRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFNFRSVCCKNKNNDVENENQKFAVNNLCF
Sbjct:  899 SDRVAIISQGKLQCCGSLVFLKRKFGEGYYLSLLKNQNNHSNSNR-----NGENILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQS--------DH-LLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAELILPVLMILFIILFLKISILPKKQIP-MQISPWLMMSKMGKENLNTFYRKENI-------SLG-------LINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPASILDIPMVSPECDCSKTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQ----NLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSW-NYGISVTNYPIA-DSETKISQFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYIIPIIIIIIIFIAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKYDAFDWEVASEKLASLILLFLLWWIILIIIERGVINRVLYRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFNFRSVCCKNKNNDVENENQKFAVNNLCF 1699          
BLAST of ATP-binding cassette sub-family A member 1 vs. Planmine SMEST
Match: SMESG000032861.1 (SMESG000032861.1)

HSP 1 Score: 851.277 bits (2198), Expect = 0.000e+0
Identity = 485/837 (57.95%), Postives = 615/837 (73.48%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQ-QAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIPNGNIPLISPECDCNTTGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKYDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKKT--EDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFNFRSVCCKNKNND-VENENQKFAVNNLCF 2500
            SDRIAIISQGKLQCCGSSVFLK++FGDGY LILVKN  +Q+E+FR GIS+SG+K+L FI++HI DAKM  ET TQW+ VLPQN+ NS KFS LF ++D  +  LN +SYGLSDTSLEEVF++VADDPA   EE K++++  ++L+ +   G+       L      +   F D + I         LL G  LL+QQ++GLQ+KRFHY KRN KG  AEL+LPIL+I +MIA  K+ + L   P MEISPWLMMPK+RS+NLNTFYRKEN              S N L D+L   YRSDL E+G RCMN S+YR   Y C      N+W+  P   IPL++  CDCNTTG+Q+C++  SGGP NSYR+M S+DKLNNLTGYNISD+L+K F    +K YGGFQF+LPS FG S KLIG  P W+ +R   + S ++++ SN + L F++Y Q+ F + GIKT+FTRIW NSKGY S+PAY NIFSNLL+R+R   +     +YGISV+N+P++  QS     L  QM +E+SLA+FVIFGLSFIPASFVIFL+EER++GSKRQQ VSG+NPYVYW+SNFLWDI+KYI+PI II++IF+AFDYQSYIGSKN  AFI LLIFYGLAIIPHMYPFSF +STPSTAFVVL+AYNLL+GSITT+STF LD+++  DET +P N++LKKVFL+FPQY LGRGM+DLS NY+ +N+++G   YD F W    EKL SL +LF+ WWI++ IIE G+INR+L   +K      K  K   ED D+++E+ R+ SE+  DDVL+VI LTK+YN++ N ++ CCK    D +ENE +K AVNNLCF
Sbjct:  883 SDRIAIISQGKLQCCGSSVFLKKEFGDGYYLILVKNSRSQEEDFRSGISSSGEKVLNFIRAHITDAKMIEETRTQWTIVLPQNEINSGKFSDLFADIDRSLSGLNIVSYGLSDTSLEEVFLKVADDPAGTVEEIKDKQITAEDLDSLTDDGNFPRPSSRLSFRCKREFPRFDDLNSIPYESGAPSSLLTGSALLRQQLLGLQVKRFHYTKRNIKGFVAELVLPILLIVVMIAFSKISSNLNYQPPMEISPWLMMPKARSLNLNTFYRKEN--------------SSNTLIDKLVEGYRSDLSEAGTRCMNQSVYRLDSYPCSSSI-GNQWTGNPPEPIPLLTAACDCNTTGFQLCSNSSSGGPQNSYRLMASTDKLNNLTGYNISDHLIKKFKSYIKKQYGGFQFLLPSPFGQSCKLIGSLPIWDAMR---SQSNSSNSSSNSDQLPFLNYFQEFFNLSGIKTNFTRIWINSKGYASLPAYGNIFSNLLMRTRFESNGS---NYGISVANYPLKYTQSDLLSKLNTQMFVEVSLAVFVIFGLSFIPASFVIFLIEERITGSKRQQIVSGVNPYVYWMSNFLWDILKYIVPIFIIVLIFVAFDYQSYIGSKNLGAFITLLIFYGLAIIPHMYPFSFLLSTPSTAFVVLDAYNLLLGSITTISTFFLDLLQQDDETLKPVNDVLKKVFLLFPQYGLGRGMMDLSFNYLTFNISNGKQDYDPFGWSTTGEKLCSLSVLFVGWWIVVFIIESGIINRMLCGKIKNRNLKAKEMKDEFEDVDVAVERERIISEKISDDVLKVIKLTKVYNQSLNVKNTCCKKVVKDTLENEKRKLAVNNLCF 1698          
BLAST of ATP-binding cassette sub-family A member 1 vs. Planmine SMEST
Match: SMESG000032891.1 (SMESG000032891.1)

HSP 1 Score: 846.269 bits (2185), Expect = 0.000e+0
Identity = 484/837 (57.83%), Postives = 612/837 (73.12%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQ-QAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIPNGNIPLISPECDCNTTGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKYDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKKT--EDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFNFRSVCCKNKNND-VENENQKFAVNNLCF 2500
            SDRIAIISQGKLQCCGSSVFLK++FGDGY LILVKN  +Q+E+FR GIS+SG+K+L FI++HI DAKM  ET TQW+ VL QN+ N+ KFS LF ++D  +  LN +SYGLSDTSLEEVF++VADDPA   EE K++++  ++L+ +   G+       L   D  +   F D + I         LL G  LL QQ++GLQ+KRFHY KRN KG  AEL+LPIL+I +MIA  K+ + L   P MEISPWLMMPK+RS+NLNTFYRKEN              S N L D+L   YRSDL E+G RCMN S+YR   Y C      N+W+  P   IPL++  CDC  TGYQ+C++  SGGP NSYR+M S+DKLNNLTGYNISD+L+K F    +K YGG+QF+LPS FG S KLIG  P W+ +R   + S ++++ SN + L F++Y Q+ F + GIKT+FTRIW NSKGY S+PAY NIFSNLLLR+R   +     +YGISV+N+P++  QS     L  QM +E+SLA+FVIFGLSFIPASFVIFL+EER++GSKRQQ VSG+NPYVYW+SNFLWDI+KYI+PI II++IF+AFDYQSYIGSKN  AFI LLIFYGLAIIPHMYPFSF +STPSTAFVVL+AYNLLVGSITT+STF LD+++  DET +P N++LKKVFL+FPQY LGRGM+DLS NY+ +N+++G   YD F W    EKL SL +LF+ WWI+++IIE G+INR L   +K      K  K   ED D+++E+ R+ SE+  DDVL+VI LTK+YN++ N ++ CCK    D +ENE +K AVNNLCF
Sbjct:  873 SDRIAIISQGKLQCCGSSVFLKKEFGDGYYLILVKNSRSQEEDFRSGISSSGEKVLNFIRAHITDAKMIEETRTQWTIVLSQNEINNGKFSDLFADIDRSLSGLNIVSYGLSDTSLEEVFLKVADDPAGTVEEIKDKQITTEDLDSLTDDGNFPRPSSRLSFRDKREFPRFDDLNSIPYESGAPSSLLTGSALLCQQLLGLQVKRFHYTKRNIKGFVAELVLPILLIVIMIAFSKISSNLNYQPPMEISPWLMMPKARSLNLNTFYRKEN--------------SSNTLIDKLVEGYRSDLSEAGTRCMNQSVYRLDSYPC-SSRTGNQWTGNPPEPIPLLTAACDCKKTGYQMCSNSSSGGPQNSYRLMASTDKLNNLTGYNISDHLIKKFKSYIKKQYGGYQFLLPSPFGQSCKLIGSLPIWDAIR---SQSNSSNSSSNSDQLPFLNYFQEFFNLSGIKTNFTRIWINSKGYASLPAYGNIFSNLLLRTRFESNGS---NYGISVANYPLKYTQSDLLSKLNTQMFIEVSLAVFVIFGLSFIPASFVIFLIEERITGSKRQQIVSGVNPYVYWMSNFLWDILKYIVPIFIIVLIFVAFDYQSYIGSKNLGAFITLLIFYGLAIIPHMYPFSFLLSTPSTAFVVLDAYNLLVGSITTISTFFLDLLQKDDETLKPVNDVLKKVFLLFPQYGLGRGMMDLSFNYLTFNISNGKQDYDPFGWSTTGEKLCSLSVLFVGWWIVVLIIESGIINRTLCGKIKNRNLKAKEIKDEFEDVDVAVERERIISEKISDDVLKVIKLTKVYNQSLNVKNTCCKKVVKDALENEKRKLAVNNLCF 1688          
BLAST of ATP-binding cassette sub-family A member 1 vs. Planmine SMEST
Match: SMESG000068605.1 (SMESG000068605.1)

HSP 1 Score: 837.795 bits (2163), Expect = 0.000e+0
Identity = 461/836 (55.14%), Postives = 607/836 (72.61%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDK-SLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIPNGNIPLISPECDCNTTGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKYDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINR-VLYRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFNFRSVCCKNKNND-VENENQKFAVNNLCF 2500
            SDRIAIISQGKLQCCGSSVFLK++FG+GY LI+VK  + Q E+F+  +S SG   L+FI++H+PDAKM  ET +QW+  LPQ+++N  KF  LF NLD  +++L  ++YGLSDTSLEEVF++VADDP+      K +KL P+ L+ +   G+       L L D ++ A +++   +S      + +L G  L  QQIIGLQIKRFHY +RN K   AEL+LP+LMI ++I LL + +PL   P M ISPWLMMPK+R +NLNTFYRKE+                N + D +E+ YRSD+GESG+RCMN ++YR  +Y C+PE   N+WS IP+  I L SPECDC+ TG+Q C+DP SGGP  S RIMTSSD+L N+TGYNISDYLLK F    +K YGG+QF+LPS FG SS  IG SP W+ +     +S  N + +N NSL F++Y Q+ F   GIKT++TRIW NSKG+VSMPAY NIFSN+LLRS+L  S      YGISV+N+P++  Q+     L  QM LE+SLAIFVIFGLSFIPASFVIFL+EER+SG+KRQQFVSG+NPY+YW+SNF+WD++KYIIP+ I+++IF+ F+YQSYIG++NA AFI+LL+FYGLAIIPHMYPFSF +S PSTAFV+L+AYNLLVG+ITT++TF LD+++  D + +P N++LKK+FLIFPQYDLGRGM+DLS NY++YN++ G   YD F WE   +KL SLI+LF+ WW ++  IE G+INR +  R+        +++  ED D+ LE+ RM   ++  DVL+VINLTKIYN + N  + CCK    D + +E +K AVNN+CF
Sbjct:  909 SDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIALPQSENNCSKFPDLFDNLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFIAELVLPVLMILMIIGLLNISSPLSDAPPMVISPWLMMPKTRLVNLNTFYRKES--------------PSNAIIDSMENVYRSDVGESGVRCMNSAVYRLGNYSCYPENNVNQWSAIPSAPISLSSPECDCSKTGFQFCSDPLSGGPTISSRIMTSSDQLGNITGYNISDYLLKKFKTFIKKQYGGYQFLLPSNFGLSSNSIGSSPIWDGI-----SSYINSSPNNSNSLGFLNYSQRFFNQSGIKTNYTRIWVNSKGFVSMPAYENIFSNILLRSKL-NSFSDISKYGISVTNYPLKFSQTDLQSQLNTQMFLEVSLAIFVIFGLSFIPASFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNISGGKVTYDPFGWETTGQKLCSLIILFIAWWSVIFTIESGIINRSICGRIKNYKLKERELQHEEDTDVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICF 1724          

HSP 2 Score: 50.0618 bits (118), Expect = 9.008e-6
Identity = 41/133 (30.83%), Postives = 61/133 (45.86%), Query Frame = 2
Query:    8 RIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDA---KMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINE 397
            R++I+  G+++C G+   LK KFGD Y + +  NF          I N  DK+   +K+  P     K E     Q+ F      + S K S +F   +    N     Y +S TSL+EVFI  A + +  NE
Sbjct: 1904 RLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNF----------IENESDKIKAIMKTQFPQGVSLKDENFITLQYRF------NCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNKSSNNE 2020          
The following BLAST results are available for this feature:
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCA11.355e-8429.40ATP binding cassette subfamily A member 1 [Source:... [more]
ABCA76.480e-8129.17ATP binding cassette subfamily A member 7 [Source:... [more]
ABCA43.604e-7828.59ATP binding cassette subfamily A member 4 [Source:... [more]
ABCA41.724e-6827.90ATP binding cassette subfamily A member 4 [Source:... [more]
ABCA129.307e-5728.62ATP binding cassette subfamily A member 12 [Source... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abt-21.842e-1825.85ABC Transporter family [Source:UniProtKB/TrEMBL;A... [more]
abt-21.948e-1825.85ABC Transporter family [Source:UniProtKB/TrEMBL;A... [more]
abt-41.933e-1429.82ABC Transporter family [Source:UniProtKB/TrEMBL;A... [more]
ced-77.817e-1426.46ABC transporter ced-7 [Source:UniProtKB/Swiss-Pro... [more]
ced-78.310e-1426.46ABC transporter ced-7 [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG341203.317e-1828.07gene:FBgn0083956 transcript:FBtr0343018[more]
CG341203.484e-1828.07gene:FBgn0083956 transcript:FBtr0299591[more]
CG341203.491e-1828.07gene:FBgn0083956 transcript:FBtr0110827[more]
ABCA3.672e-1733.02gene:FBgn0031170 transcript:FBtr0332488[more]
ABCA3.822e-1733.02gene:FBgn0031170 transcript:FBtr0332489[more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abca4a2.138e-9128.31ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca4b1.293e-8928.90ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca1b4.785e-8628.74ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca4b1.590e-8528.49ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca1b1.282e-8428.40ATP-binding cassette, sub-family A (ABC1), member ... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCA17.709e-9129.41ATP binding cassette subfamily A member 1 [Source:... [more]
ABCA11.145e-9030.25ATP binding cassette subfamily A member 1 [Source:... [more]
ABCA12.162e-9029.43ATP binding cassette subfamily A member 1 [Source:... [more]
klf91.048e-8929.60Kruppel-like factor 9 [Source:Xenbase;Acc:XB-GENE-... [more]
ABCA12.701e-8929.75ATP binding cassette subfamily A member 1 [Source:... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Abca13.071e-8429.24ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca45.904e-8427.99ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca72.613e-7627.98ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca72.613e-7627.98ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca75.009e-7628.20ATP-binding cassette, sub-family A (ABC1), member ... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O95477|ABCA1_HUMAN6.509e-8429.40Phospholipid-transporting ATPase ABCA1 OS=Homo sap... [more]
sp|P41233|ABCA1_MOUSE2.148e-8329.24Phospholipid-transporting ATPase ABCA1 OS=Mus musc... [more]
sp|O35600|ABCA4_MOUSE4.130e-8327.99Retinal-specific phospholipid-transporting ATPase ... [more]
sp|Q8IZY2|ABCA7_HUMAN3.112e-8029.17Phospholipid-transporting ATPase ABCA7 OS=Homo sap... [more]
sp|P78363|ABCA4_HUMAN1.731e-7728.59Retinal-specific phospholipid-transporting ATPase ... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JVH41.712e-12032.07LOW QUALITY PROTEIN: ATP-binding cassette sub-fami... [more]
V4ABB81.086e-11334.45Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
N1PB023.158e-10533.10Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A3P9HY392.464e-9930.62Uncharacterized protein OS=Oryzias latipes OX=8090... [more]
A0A3P9HY722.684e-9930.62Uncharacterized protein OS=Oryzias latipes OX=8090... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abca4a6.324e-9529.70retinal-specific ATP-binding cassette transporter-... [more]
ENSAMXT00000022236.21.522e-9331.21pep primary_assembly:Astyanax_mexicanus-2.0:21:133... [more]
abca4a1.181e-9228.83retinal-specific ATP-binding cassette transporter-... [more]
zgc:1723027.560e-9231.49zgc:172302 [Source:ZFIN;Acc:ZDB-GENE-081205-5][more]
zgc:1723021.018e-8929.92zgc:172302 [Source:ZFIN;Acc:ZDB-GENE-081205-5][more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000002495.14.985e-4427.59pep scaffold:Pmarinus_7.0:GL480265:53:27909:1 gene... [more]
abca121.831e-3427.62ATP-binding cassette, sub-family A (ABC1), member ... [more]
ENSPMAT00000006988.11.146e-658.33pep scaffold:Pmarinus_7.0:GL478499:147909:176415:-... [more]
ENSPMAT00000006855.12.349e-626.40pep scaffold:Pmarinus_7.0:GL486953:391:4596:1 gene... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO468782.818e-9331.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388793.739e-8329.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO489513.356e-2233.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320712.766e-829.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO280924.536e-831.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000045391.13.270e-10230.62ATP-binding cassette sub-family A member 1-like [S... [more]
ENSORLT00000046301.14.183e-10230.62ATP-binding cassette sub-family A member 1-like [S... [more]
zgc:1723023.963e-9129.93ATP-binding cassette sub-family A member 1 [Source... [more]
ENSORLT00000025407.21.831e-8629.34ATP-binding cassette sub-family A member 1 [Source... [more]
abca1a6.792e-8629.11ATP-binding cassette sub-family A member 1 [Source... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029534.10.000e+089.34SMESG000029534.1[more]
SMESG000029537.10.000e+069.98SMESG000029537.1[more]
SMESG000032861.10.000e+057.95SMESG000032861.1[more]
SMESG000032891.10.000e+057.83SMESG000032891.1[more]
SMESG000068605.19.008e-655.14SMESG000068605.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023044 ID=SMED30023044|Name=ATP-binding cassette sub-family A member 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2501bp
CAGTGACAGAATTGCTATCATTTCCCAGGGAAAACTCCAATGTTGCGGCT
CATCAGTGTTTTTGAAACGGAAATTCGGCGATGGATATCGATTGATCCTG
GTAAAGAATTTCAACGCTCAAAAAGAAAATTTCCGCAAAGGAATTTCTAA
TTCCGGAGATAAGTTATTGCAATTTATCAAGTCCCATATTCCGGATGCGA
AGATGGAAACCGAAACAATGACTCAATGGAGCTTTGTTTTACCGCAAAAT
GATAGCAATAGTTGCAAATTCTCTGGGCTATTTGTGAATCTCGATGAAGA
AATTGACAACTTGAATGCGTTGTCATATGGATTGTCGGACACATCTCTTG
AGGAAGTGTTTATTAGGGTAGCTGATGATCCAGCAAAAATAAACGAGGAA
ACAAAGAATGAAAAACTGATTCCAGATAACTTGAATAGAATTGCTGTCTA
TGGTGACATAGAAAACCAGGAACCCTTTCTAGACCTCGAGGACCTCAATC
AGCAGGCGTTTGTTGATAAATCCTTGATTTCATTGAATTTTAATAGAAAT
CATAAATTATTAAGAGGATTTCCCCTATTAAAACAGCAAATAATTGGACT
GCAAATTAAAAGATTCCATTACGCAAAACGAAACAAAAAAGGGATTTTCG
CTGAATTGATATTACCGATTTTAATGATTACACTAATGATTGCTTTATTG
AAACTCGTAAATCCCCTGGAAAGCTTACCGGCAATGGAAATCAGTCCCTG
GTTGATGATGCCAAAATCTAGATCAATAAATTTAAATACATTTTATCGGA
AAGAAAATCAATTAAATTTTTCGATAACAAATCAATTGGGAAATAAAAAT
TCAATAAATCCTTTGACGGATCGATTGGAAAGCGAATATCGATCCGATCT
CGGTGAATCGGGAATCAGGTGCATGAATCCATCAATTTATCGATCAACCC
ATTATCGGTGTTTCCCTGAATATAAAAACAATAAATGGTCACCTATTCCT
AATGGAAACATTCCATTAATTAGCCCAGAATGTGATTGCAATACAACCGG
ATATCAGATCTGCAATGATCCTCGCAGCGGTGGTCCACCGAATTCATACC
GAATAATGACCAGTAGTGATAAACTGAACAATTTAACCGGATATAATATA
TCGGATTATTTATTGAAAAACTTTCCTAAACTATCACGAAAACTTTATGG
CGGTTTTCAATTTGTGCTACCCAGCACTTTTGGATGGTCATCGAAACTAA
TAGGAGACTCTCCGTTCTGGGAGGAATTACGCGATTTTGTGAATGCTTCC
CAGGCTAATCATAATCAATCGAATTTGAATTCATTGAAATTTATTGATTA
TCTTCAAAAAACCTTTAAGATATACGGAATAAAGACCTCATTCACTCGAA
TATGGGCCAATTCCAAAGGCTACGTGTCAATGCCAGCATATGCAAATATT
TTCAGCAATTTACTGCTGAGATCTAGATTGAATAAATCAGCAGTGAAATT
TATCGATTATGGAATCTCAGTGTCAAACTTCCCGATTGAAATGGAACAAT
CGACTAAATTTTTAGACCTAGTCAATCAGATGATTCTCGAAATGTCATTG
GCTATTTTCGTAATATTTGGACTATCTTTTATTCCGGCTAGTTTTGTGAT
ATTTTTAGTCGAAGAAAGGGTAAGTGGTTCCAAGCGGCAGCAATTCGTGT
CGGGAATTAACCCCTACGTGTATTGGGTATCCAATTTCTTGTGGGACATC
ATGAAATACATCATTCCCATTATTATCATCATAATAATTTTTATTGCCTT
TGATTATCAATCATATATCGGCAGTAAAAATGCTCTTGCTTTCATTCTTC
TTTTAATTTTCTACGGATTAGCTATTATTCCCCATATGTATCCATTTAGC
TTCTTCATTTCCACACCAAGCACCGCATTTGTGGTGTTAAATGCCTACAA
TTTATTAGTGGGTTCGATAACTACAATGTCCACTTTCATTCTAGACATAA
TAGAAGACACTGATGAAACGTTTAGGCCTACAAATGAAATCTTGAAGAAA
GTATTTTTGATATTTCCTCAATACGATTTAGGTAGAGGAATGATAGATTT
ATCTTCAAATTATATAAAGTACAACATGACGGATGGGTATGCAAAATATG
ATGCATTTGATTGGGAAGTTGCTAGTGAAAAGTTGGCATCTCTTATCTTA
TTATTTTTATTATGGTGGATCATTTTGATAATAATAGAAAGGGGCGTAAT
AAATCGAGTTCTTTACCGGATGTTAAAAGTATCTTATTTTAATAATAAGA
TTAAAAAAACAGAAGATTTCGATATTTCTTTGGAAAAAAATCGAATGAAT
TCTGAACAAAAGTTTGATGATGTGTTGCAAGTTATCAATTTGACTAAAAT
ATACAATAGGACTTTCAATTTTAGAAGTGTTTGTTGTAAAAATAAAAATA
ATGATGTCGAAAATGAAAATCAAAAATTTGCTGTTAATAATCTGTGTTTT
G
back to top

protein sequence of SMED30023044-orf-1

>SMED30023044-orf-1 ID=SMED30023044-orf-1|Name=SMED30023044-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=833bp
SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISN
SGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEE
IDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVY
GDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGL
QIKRFHYAKRNKKGIFAELILPILMITLMIALLKLVNPLESLPAMEISPW
LMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDL
GESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIPNGNIPLISPECDCNTTG
YQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYG
GFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDY
LQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFSNLLLRSRLNKSAVKF
IDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVI
FLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYIIPIIIIIIIFIAF
DYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYN
LLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDL
SSNYIKYNMTDGYAKYDAFDWEVASEKLASLILLFLLWWIILIIIERGVI
NRVLYRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKI
YNRTFNFRSVCCKNKNNDVENENQKFAVNNLCF
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0042626ATPase activity, coupled to transmembrane movement of substances
GO:0000166nucleotide binding
GO:0005215transporter activity
GO:0005524ATP binding
GO:0016887ATPase activity
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0006810transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR026082ABCA
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePFAMPF12698ABC2_membrane_3coord: 443..743
e-value: 1.8E-36
score: 125.9
NoneNo IPR availablePANTHERPTHR19229:SF185coord: 2..811
NoneNo IPR availableTMHMMTMhelixcoord: 576..598
NoneNo IPR availableTMHMMTMhelixcoord: 214..236
NoneNo IPR availableTMHMMTMhelixcoord: 613..635
NoneNo IPR availableTMHMMTMhelixcoord: 728..750
NoneNo IPR availableTMHMMTMhelixcoord: 531..553
NoneNo IPR availableTMHMMTMhelixcoord: 642..664
IPR026082ABC transporter APANTHERPTHR19229ATP-BINDING CASSETTE TRANSPORTER SUBFAMILY A ABCAcoord: 2..811