G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30023040
Length (bp)1021
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30023040) t-SNE clustered cells

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30023040) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30023040) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30023040) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023040

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30023040SMESG000016250.1 SmedASXL_003667SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30023040SMESG000016250.1 dd_Smed_v4_60821_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023040SMESG000016250.1 dd_Smed_v4_60821_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30023040SMESG000016250.1 dd_Smed_v4_60821_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: EDNRB (endothelin receptor type B [Source:HGNC Symbol;Acc:HGNC:3180])

HSP 1 Score: 50.0618 bits (118), Expect = 3.623e-6
Identity = 32/112 (28.57%), Postives = 59/112 (52.68%), Query Frame = 2
Query:  125 SKSFAFVCGIVMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVARHS 460
             ++F ++  +V  L  ++GI G+  ++  + K K + +N  NI I SL++ DL +++    + +   L   WPFG  +C L+P +    V I+++    + I RY  VA  S
Sbjct:   97 KETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCM-RNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWS 207          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: EDNRB (endothelin receptor type B [Source:HGNC Symbol;Acc:HGNC:3180])

HSP 1 Score: 50.0618 bits (118), Expect = 3.778e-6
Identity = 32/111 (28.83%), Postives = 59/111 (53.15%), Query Frame = 2
Query:  128 KSFAFVCGIVMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVARHS 460
            ++F ++  +V  L  ++GI G+  ++  + K K + +N  NI I SL++ DL +++    + +   L   WPFG  +C L+P +    V I+++    + I RY  VA  S
Sbjct:   98 ETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCM-RNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWS 207          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: EDNRB (endothelin receptor type B [Source:HGNC Symbol;Acc:HGNC:3180])

HSP 1 Score: 50.0618 bits (118), Expect = 3.778e-6
Identity = 32/111 (28.83%), Postives = 59/111 (53.15%), Query Frame = 2
Query:  128 KSFAFVCGIVMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVARHS 460
            ++F ++  +V  L  ++GI G+  ++  + K K + +N  NI I SL++ DL +++    + +   L   WPFG  +C L+P +    V I+++    + I RY  VA  S
Sbjct:   98 ETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCM-RNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWS 207          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: EDNRB (endothelin receptor type B [Source:HGNC Symbol;Acc:HGNC:3180])

HSP 1 Score: 50.0618 bits (118), Expect = 3.778e-6
Identity = 32/111 (28.83%), Postives = 59/111 (53.15%), Query Frame = 2
Query:  128 KSFAFVCGIVMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVARHS 460
            ++F ++  +V  L  ++GI G+  ++  + K K + +N  NI I SL++ DL +++    + +   L   WPFG  +C L+P +    V I+++    + I RY  VA  S
Sbjct:   98 ETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCM-RNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWS 207          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: EDNRB (endothelin receptor type B [Source:HGNC Symbol;Acc:HGNC:3180])

HSP 1 Score: 50.0618 bits (118), Expect = 3.778e-6
Identity = 32/111 (28.83%), Postives = 59/111 (53.15%), Query Frame = 2
Query:  128 KSFAFVCGIVMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVARHS 460
            ++F ++  +V  L  ++GI G+  ++  + K K + +N  NI I SL++ DL +++    + +   L   WPFG  +C L+P +    V I+++    + I RY  VA  S
Sbjct:   98 ETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCM-RNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWS 207          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: npr-10 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:Q6EUU1])

HSP 1 Score: 47.3654 bits (111), Expect = 8.871e-6
Identity = 30/92 (32.61%), Postives = 55/92 (59.78%), Query Frame = 2
Query:  173 IMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVV 448
            ++G+ G+L +V++V++ K+L Q++ N+FI SLSV+D+   +   S+   +     W FG  LC L+P +    +S S +    I I RY+++
Sbjct:   40 VVGVTGNLLVVMSVMRFKVL-QSVRNMFIVSLSVSDIFVAIVSGSVTPITAFSKVWLFGGPLCHLLPLLQGTALSFSTLTLTAIAIDRYILI 130          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: npr-10 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:Q6EUU1])

HSP 1 Score: 47.3654 bits (111), Expect = 9.134e-6
Identity = 30/92 (32.61%), Postives = 55/92 (59.78%), Query Frame = 2
Query:  173 IMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVV 448
            ++G+ G+L +V++V++ K+L Q++ N+FI SLSV+D+   +   S+   +     W FG  LC L+P +    +S S +    I I RY+++
Sbjct:   40 VVGVTGNLLVVMSVMRFKVL-QSVRNMFIVSLSVSDIFVAIVSGSVTPITAFSKVWLFGGPLCHLLPLLQGTALSFSTLTLTAIAIDRYILI 130          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: Tre1 (gene:FBgn0046687 transcript:FBtr0308339)

HSP 1 Score: 56.9954 bits (136), Expect = 7.975e-9
Identity = 35/108 (32.41%), Postives = 62/108 (57.41%), Query Frame = 2
Query:  176 MGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVARHSFYVKIHKTGYAIL 499
            +G+ G+L  +LA++K+  + ++    F+ SLS++DL    F   L    +   SW FG  LC + P +    V++SL+  V I ++RY+++A HS Y +I+K  +  L
Sbjct:   48 IGVLGNLITLLALLKSPTIREHATTAFVISLSISDLLFCSFSLPLTAVRFFQESWTFGTTLCKIFPVIFYGNVAVSLLSMVGITLNRYILIACHSRYSQIYKPKFITL 155          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: Tre1 (gene:FBgn0046687 transcript:FBtr0070848)

HSP 1 Score: 56.9954 bits (136), Expect = 7.975e-9
Identity = 35/108 (32.41%), Postives = 62/108 (57.41%), Query Frame = 2
Query:  176 MGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVARHSFYVKIHKTGYAIL 499
            +G+ G+L  +LA++K+  + ++    F+ SLS++DL    F   L    +   SW FG  LC + P +    V++SL+  V I ++RY+++A HS Y +I+K  +  L
Sbjct:   48 IGVLGNLITLLALLKSPTIREHATTAFVISLSISDLLFCSFSLPLTAVRFFQESWTFGTTLCKIFPVIFYGNVAVSLLSMVGITLNRYILIACHSRYSQIYKPKFITL 155          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: Tre1 (gene:FBgn0046687 transcript:FBtr0340222)

HSP 1 Score: 56.9954 bits (136), Expect = 8.792e-9
Identity = 35/108 (32.41%), Postives = 62/108 (57.41%), Query Frame = 2
Query:  176 MGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVARHSFYVKIHKTGYAIL 499
            +G+ G+L  +LA++K+  + ++    F+ SLS++DL    F   L    +   SW FG  LC + P +    V++SL+  V I ++RY+++A HS Y +I+K  +  L
Sbjct:   48 IGVLGNLITLLALLKSPTIREHATTAFVISLSISDLLFCSFSLPLTAVRFFQESWTFGTTLCKIFPVIFYGNVAVSLLSMVGITLNRYILIACHSRYSQIYKPKFITL 155          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: moody (gene:FBgn0025631 transcript:FBtr0310289)

HSP 1 Score: 53.1434 bits (126), Expect = 1.955e-7
Identity = 38/130 (29.23%), Postives = 68/130 (52.31%), Query Frame = 2
Query:  125 SKSFAFVCGIVMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVARHSFYVKIHKTGY-AILIIIC 511
            S+S      ++  L  I+GI G+L  V+A++K   + +N+   FI SL + DL     +       ++  +W  G +LC LIP +    + +SL+    I I+RY+++  H  Y +I+K  + A++I  C
Sbjct:   32 SQSLLTFAAVMTFLIMIVGICGNLLTVVALLKCPKV-RNVAAAFIISLCIADLLFCALVLPFQGLRFVQGTWRHGQVLCRLIPFIQYGNIGVSLLCIAMITINRYVMITHHGLYARIYKRHWIAVMIAAC 160          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: moody (gene:FBgn0025631 transcript:FBtr0310288)

HSP 1 Score: 53.1434 bits (126), Expect = 1.955e-7
Identity = 38/130 (29.23%), Postives = 68/130 (52.31%), Query Frame = 2
Query:  125 SKSFAFVCGIVMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVARHSFYVKIHKTGY-AILIIIC 511
            S+S      ++  L  I+GI G+L  V+A++K   + +N+   FI SL + DL     +       ++  +W  G +LC LIP +    + +SL+    I I+RY+++  H  Y +I+K  + A++I  C
Sbjct:   32 SQSLLTFAAVMTFLIMIVGICGNLLTVVALLKCPKV-RNVAAAFIISLCIADLLFCALVLPFQGLRFVQGTWRHGQVLCRLIPFIQYGNIGVSLLCIAMITINRYVMITHHGLYARIYKRHWIAVMIAAC 160          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: mtnr1c (melatonin receptor 1C [Source:NCBI gene;Acc:30661])

HSP 1 Score: 49.6766 bits (117), Expect = 2.785e-6
Identity = 69/285 (24.21%), Postives = 130/285 (45.61%), Query Frame = 2
Query:  155 VMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVF----IGIHRYLVVARHSFYVKIHKTGYAILIIICSRLYPXXXXXXXXXXXXKNIMDLNSIIVYDPRILRCVYRPKESLRXXXXXXXXXXXXXXXXXXXXXXXXXXXRRISYQSSVRDKHRIQREIQITKMFAM--VFLMFIMGYFPYS---LVRALDSKKTFP--PDVYVIVTVLYA-LASCLNSLIFGLMNVTLR 973
            V++ T++  I G+L ++L+V + K L +N  NIF+ SLSV DL   L+   L L +     W  G+L C    ++S  ++ +S++  VF    I I+RY  +     Y +++      L ++ + +   + +             L   + YDPR+  C +    S     + +  I     + ++ F  + I+   I  +  VR   ++ R   +     M  VF++F + + P +   L  A++  K  P  P+   + +   A   SCLN++++GL+N   R
Sbjct:   37 VLIFTTVADIVGNLLVILSVYRNKKL-RNAGNIFVVSLSVADLVVALYPYPLALIAIFHNDWTMGSLHC----QLSGFIMGLSVIGSVFNITAIAINRYCYICHSLRYDRLYSRRNTCLYLLLTWMLTALATVPNF---------LVGSLKYDPRVFSCTFTQTAS-SSYTVCVVLIHFLVPLGVVSFCYLRIWTLVIRVKGRVRPNPKV-RAADLRNFLTMFVVFVLFAVCWAPLNFIGLAVAINPAKVAPNIPEWLFVTSYFMAYFNSCLNAVVYGLLNQNFR 305          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: mtnr1c (melatonin receptor 1C [Source:NCBI gene;Acc:30661])

HSP 1 Score: 49.6766 bits (117), Expect = 2.785e-6
Identity = 69/285 (24.21%), Postives = 130/285 (45.61%), Query Frame = 2
Query:  155 VMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVF----IGIHRYLVVARHSFYVKIHKTGYAILIIICSRLYPXXXXXXXXXXXXKNIMDLNSIIVYDPRILRCVYRPKESLRXXXXXXXXXXXXXXXXXXXXXXXXXXXRRISYQSSVRDKHRIQREIQITKMFAM--VFLMFIMGYFPYS---LVRALDSKKTFP--PDVYVIVTVLYA-LASCLNSLIFGLMNVTLR 973
            V++ T++  I G+L ++L+V + K L +N  NIF+ SLSV DL   L+   L L +     W  G+L C    ++S  ++ +S++  VF    I I+RY  +     Y +++      L ++ + +   + +             L   + YDPR+  C +    S     + +  I     + ++ F  + I+   I  +  VR   ++ R   +     M  VF++F + + P +   L  A++  K  P  P+   + +   A   SCLN++++GL+N   R
Sbjct:   37 VLIFTTVADIVGNLLVILSVYRNKKL-RNAGNIFVVSLSVADLVVALYPYPLALIAIFHNDWTMGSLHC----QLSGFIMGLSVIGSVFNITAIAINRYCYICHSLRYDRLYSRRNTCLYLLLTWMLTALATVPNF---------LVGSLKYDPRVFSCTFTQTAS-SSYTVCVVLIHFLVPLGVVSFCYLRIWTLVIRVKGRVRPNPKV-RAADLRNFLTMFVVFVLFAVCWAPLNFIGLAVAINPAKVAPNIPEWLFVTSYFMAYFNSCLNAVVYGLLNQNFR 305          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: yod1 (YOD1 deubiquitinase [Source:Xenbase;Acc:XB-GENE-998960])

HSP 1 Score: 50.8322 bits (120), Expect = 1.643e-6
Identity = 69/299 (23.08%), Postives = 134/299 (44.82%), Query Frame = 2
Query:  125 SKSFAFVCGIVMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVF----IGIHRYLVVARHSFYVKIHKTGYAILIIICSRLYPXXXXXXXXXXXXKNIMDLNSIIVYDPRILRCVYRPKESLRXXXXXXXXXXXXXXXXXXXXXXXXXXXRRISYQSSVRDKHRIQREIQITK------MFAMVFLMFIMGYFPYSL------VRALDSKKTFPPDVYVIVTVLYALASCLNSLIFGLMNVTLR 973
            S+       +V++ T ++ + G++ ++L+V++ K L QN  N+F+ SLSV DL   ++   ++L +     W  GN+ C    ++S  L+ +S++  VF    I I+RY  +     Y K+            +  Y  +     +I +  N       + YDPRI  C +    S   +I ++   F   + ++    L +     +  Q   R +H  ++++  T       MF +VF++F + + P +       +  L      P  ++V+   +    SCLN++I+GL+N   R
Sbjct:   20 SQGLTSALAVVLIFTIVVDVLGNMLVILSVLRNKKL-QNAGNLFVVSLSVADLVVAVYPYPVILIAIFQNGWTLGNIHC----QISGFLMGLSVIGSVFNITAIAINRYCYICHSLRYDKLFNQK-------STWCYLGLTWILTIIAIVPNFFV--GSLQYDPRIFSCTFAQTVSSSYTITVVVVHFIVPLSVVTFCYLRIWV---LVIQVKHRVRHDFKQKLTPTDLRNFLTMF-VVFVLFAVCWAPLNFIGLAVAINPLHVAPKIPEWLFVVSYFMAYFNSCLNAVIYGLLNQNFR 300          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: yod1 (YOD1 deubiquitinase [Source:Xenbase;Acc:XB-GENE-998960])

HSP 1 Score: 50.447 bits (119), Expect = 1.927e-6
Identity = 69/299 (23.08%), Postives = 134/299 (44.82%), Query Frame = 2
Query:  125 SKSFAFVCGIVMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVF----IGIHRYLVVARHSFYVKIHKTGYAILIIICSRLYPXXXXXXXXXXXXKNIMDLNSIIVYDPRILRCVYRPKESLRXXXXXXXXXXXXXXXXXXXXXXXXXXXRRISYQSSVRDKHRIQREIQITK------MFAMVFLMFIMGYFPYSL------VRALDSKKTFPPDVYVIVTVLYALASCLNSLIFGLMNVTLR 973
            S+       +V++ T ++ + G++ ++L+V++ K L QN  N+F+ SLSV DL   ++   ++L +     W  GN+ C    ++S  L+ +S++  VF    I I+RY  +     Y K+            +  Y  +     +I +  N       + YDPRI  C +    S   +I ++   F   + ++    L +     +  Q   R +H  ++++  T       MF +VF++F + + P +       +  L      P  ++V+   +    SCLN++I+GL+N   R
Sbjct:   28 SQGLTSALAVVLIFTIVVDVLGNMLVILSVLRNKKL-QNAGNLFVVSLSVADLVVAVYPYPVILIAIFQNGWTLGNIHC----QISGFLMGLSVIGSVFNITAIAINRYCYICHSLRYDKLFNQK-------STWCYLGLTWILTIIAIVPNF--FVGSLQYDPRIFSCTFAQTVSSSYTITVVVVHFIVPLSVVTFCYLRIWV---LVIQVKHRVRHDFKQKLTPTDLRNFLTMF-VVFVLFAVCWAPLNFIGLAVAINPLHVAPKIPEWLFVVSYFMAYFNSCLNAVIYGLLNQNFR 308          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Ednrb (endothelin receptor type B [Source:MGI Symbol;Acc:MGI:102720])

HSP 1 Score: 53.5286 bits (127), Expect = 2.010e-7
Identity = 35/112 (31.25%), Postives = 59/112 (52.68%), Query Frame = 2
Query:  125 SKSFAFVCGIVMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVARHS 460
            SK+F ++  IV  L  ++GI G+  ++  + K K + +N  NI I SL++ DL +++    +     L   WPFG  +C L+P +    V I+++    + I RY  VA  S
Sbjct:   97 SKTFKYINTIVSCLVFVLGIIGNSTLLRIIYKNKCM-RNGPNILIASLALGDLLHIIIDIPINTYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWS 207          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Ednrb (endothelin receptor type B [Source:MGI Symbol;Acc:MGI:102720])

HSP 1 Score: 53.5286 bits (127), Expect = 2.010e-7
Identity = 35/112 (31.25%), Postives = 59/112 (52.68%), Query Frame = 2
Query:  125 SKSFAFVCGIVMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVARHS 460
            SK+F ++  IV  L  ++GI G+  ++  + K K + +N  NI I SL++ DL +++    +     L   WPFG  +C L+P +    V I+++    + I RY  VA  S
Sbjct:   97 SKTFKYINTIVSCLVFVLGIIGNSTLLRIIYKNKCM-RNGPNILIASLALGDLLHIIIDIPINTYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWS 207          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Ednrb (endothelin receptor type B [Source:MGI Symbol;Acc:MGI:102720])

HSP 1 Score: 53.5286 bits (127), Expect = 2.010e-7
Identity = 35/112 (31.25%), Postives = 59/112 (52.68%), Query Frame = 2
Query:  125 SKSFAFVCGIVMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVARHS 460
            SK+F ++  IV  L  ++GI G+  ++  + K K + +N  NI I SL++ DL +++    +     L   WPFG  +C L+P +    V I+++    + I RY  VA  S
Sbjct:   97 SKTFKYINTIVSCLVFVLGIIGNSTLLRIIYKNKCM-RNGPNILIASLALGDLLHIIIDIPINTYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWS 207          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9NDM2|GUTR1_DROME (Protein trapped in endoderm-1 OS=Drosophila melanogaster OX=7227 GN=Tre1 PE=1 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 7.994e-8
Identity = 35/108 (32.41%), Postives = 62/108 (57.41%), Query Frame = 2
Query:  176 MGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVARHSFYVKIHKTGYAIL 499
            +G+ G+L  +LA++K+  + ++    F+ SLS++DL    F   L    +   SW FG  LC + P +    V++SL+  V I ++RY+++A HS Y +I+K  +  L
Sbjct:   48 IGVLGNLITLLALLKSPTIREHATTAFVISLSISDLLFCSFSLPLTAVRFFQESWTFGTTLCKIFPVIFYGNVAVSLLSMVGITLNRYILIACHSRYSQIYKPKFITL 155          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|P48302|EDNRB_MOUSE (Endothelin receptor type B OS=Mus musculus OX=10090 GN=Ednrb PE=2 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 1.406e-6
Identity = 35/112 (31.25%), Postives = 59/112 (52.68%), Query Frame = 2
Query:  125 SKSFAFVCGIVMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVARHS 460
            SK+F ++  IV  L  ++GI G+  ++  + K K + +N  NI I SL++ DL +++    +     L   WPFG  +C L+P +    V I+++    + I RY  VA  S
Sbjct:   97 SKTFKYINTIVSCLVFVLGIIGNSTLLRIIYKNKCM-RNGPNILIASLALGDLLHIIIDIPINTYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWS 207          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9W534|MOODY_DROME (G-protein coupled receptor moody OS=Drosophila melanogaster OX=7227 GN=moody PE=2 SV=2)

HSP 1 Score: 53.1434 bits (126), Expect = 1.960e-6
Identity = 38/130 (29.23%), Postives = 68/130 (52.31%), Query Frame = 2
Query:  125 SKSFAFVCGIVMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVARHSFYVKIHKTGY-AILIIIC 511
            S+S      ++  L  I+GI G+L  V+A++K   + +N+   FI SL + DL     +       ++  +W  G +LC LIP +    + +SL+    I I+RY+++  H  Y +I+K  + A++I  C
Sbjct:   32 SQSLLTFAAVMTFLIMIVGICGNLLTVVALLKCPKV-RNVAAAFIISLCIADLLFCALVLPFQGLRFVQGTWRHGQVLCRLIPFIQYGNIGVSLLCIAMITINRYVMITHHGLYARIYKRHWIAVMIAAC 160          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|P21451|EDNRB_RAT (Endothelin receptor type B OS=Rattus norvegicus OX=10116 GN=Ednrb PE=2 SV=2)

HSP 1 Score: 52.373 bits (124), Expect = 3.083e-6
Identity = 34/112 (30.36%), Postives = 59/112 (52.68%), Query Frame = 2
Query:  125 SKSFAFVCGIVMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVARHS 460
            +K+F ++  IV  L  ++GI G+  ++  + K K + +N  NI I SL++ DL +++    +     L   WPFG  +C L+P +    V I+++    + I RY  VA  S
Sbjct:   97 NKTFKYINTIVSCLVFVLGIIGNSTLLRIIYKNKCM-RNGPNILIASLALGDLLHIIIDIPINAYKLLAGDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWS 207          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|P43141|ADB4C_MELGA (Beta-4C adrenergic receptor OS=Meleagris gallopavo OX=9103 GN=ADRB4C PE=2 SV=1)

HSP 1 Score: 50.8322 bits (120), Expect = 8.797e-6
Identity = 35/136 (25.74%), Postives = 67/136 (49.26%), Query Frame = 2
Query:  116 SYPSKSFA------FVCGIVMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVARHSFYVKIHKTGYAILII 505
            S P+ S+A      +  G  + +T ++ + G+L +++A+ KT  L Q + N+F+ SL+  DL   L +     +  L   WP+G ++C L   + ++ V+ S+     I + RYL +     Y  +   G A  ++
Sbjct:   10 SVPNCSWAAVLSRQWAVGAALSITILVIVAGNLLVIVAIAKTPRL-QTMTNVFVTSLACADLVMGLLVVPPGATILLSGHWPYGTVVCELWTSLDVLCVTASIETLCAIAVDRYLAITAPLQYEALVTKGRAWAVV 144          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: R7TMD3 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_188859 PE=4 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 9.167e-37
Identity = 104/284 (36.62%), Postives = 161/284 (56.69%), Query Frame = 2
Query:  122 PSKSFAFVCGIVMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVARHSFYVKIHKTGYAILIIICSRLYPXXXXXXXXXXXXKNIMDLNSIIVYDPRILRCVYRPKESLRXXXXXXXXXXXXXXXXXXXXXXXXXXXRRISYQSSVRDKHRIQREIQITKMFAMVFLMFIMGYFPYSLVRALDSKKTFPPDVYVIVTVLYALASCLNSLIFGLMNVTLR 973
            PS+    +   VML+  + G+ G + I+LAV+ T+    N+INIFI SL  NDL  L  I  L++ SY+   W  G ++C L PE ++     SL H   I IHRYLVV  ++ Y ++ +  Y   ++I +R  P   +       + +         Y P++LRC+  P+E +RI  I +  I  PCV++++C+  + + V RI  +    +   ++REIQITKMF ++FLM + G+ PYS VR  D    F  D+YVIVTV YA+ +CL+ L++G+M+  LR
Sbjct:   23 PSRWATAIGAGVMLVFFVEGLLGSIWIMLAVL-TRRKVWNVINIFIVSLCANDLLVLSLILVLIIDSYIWGRWTAGAVMCKLNPEFTVAFTGCSLWHSALIAIHRYLVVVHNNLYKRMSRKAYVAFVLIAARAIPFACTLPGFTLDTSD---------YVPKLLRCILLPREKVRIITITMVQIILPCVVVVMCYLCVFVSVVRIGRRVQAANNRAMRREIQITKMFGVIFLMIMFGFIPYSAVRNADRGNRFSADIYVIVTVCYAIGTCLSPLVYGVMSRELR 296          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: V4AYR3 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_156745 PE=4 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 2.963e-36
Identity = 99/280 (35.36%), Postives = 166/280 (59.29%), Query Frame = 2
Query:  143 VCGIVMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVARHSFYVKIHKTGYAILIIICSRLYPXXXXXXXXXXXXKNIMDLNSIIVYDPRILRCVYRPKESLRXXXXXXXXXXXXXXXXXXXXXXXXXXXRRISYQ-SSVRDKHRIQREIQITKMFAMVFLMFIMGYFPYSLVRALDSKKTFPPDVYVIVTVLYALASCLNSLIFGLMNVTLRSA 979
            +  +VML++ + G+F +   + A++  + L +NI N+FI SL +ND+ NL     LVL SY + +W  G ++C ++   +++L+  SL H   I IHR +VV  +SFY KI K  Y I ++  +R+ P++               L +++ Y+P++LRC+ R    L   ++ I  +  P +++I+C+  I I V + S    + R +  ++REIQITKMF  VFL+ I+GY PY +VR++D K  F  D YV+++VLYA+A+  N +I+G M+  +R A
Sbjct:   41 IGAVVMLISLLWGLFANALTMYAILTNREL-KNITNMFIVSLCINDIMNLGISNLLVLVSYFMMTWSTGLIVCEMVTHFTVLLMGSSLWHTGLIAIHRLIVVCFNSFYKKISKRSYTIFVLTTARIVPLLFLIQP---------HLGNMVHYEPKLLRCIIRQGFGLYTMLVSIVLMIMPSLMLIICYIAIFIKVHQSSSAFRATRKREWLRREIQITKMFGFVFLVIILGYLPYGIVRSIDKKLLFSADCYVVISVLYAVANSCNPIIYGSMDRNIRRA 310          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A2T7NWP8 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_13253 PE=4 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 1.427e-35
Identity = 104/285 (36.49%), Postives = 163/285 (57.19%), Query Frame = 2
Query:  122 PSKSFAFVCGIVMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVARHSFYVKIHKTGYAILIIICSRLYPXXXXXXXXXXXXKNIMDLNSIIVYDPRILRCVYRPKESLRXXXXXXXXXXXXXXXXXXXXXXXXXXXRRISYQ-SSVRDKHRIQREIQITKMFAMVFLMFIMGYFPYSLVRALDSKKTFPPDVYVIVTVLYALASCLNSLIFGLMNVTLR 973
            PS     V  ++MLL  + GIF + A+   V+  +   +NI NIFI SL +ND+ NL     LVL SY + SW  G  +C +I   +++L+  SL H   I IHR +VV  ++FY KI K  Y I +++ +R+ P++               L  +  Y P++LRC+ R +  L   ++ +  +  P VI+I+C+  I + V + S    + R +  ++REIQITKMF MVFL+ I GY PY +VR +D +  F  D YV+++VLYA+A+  N +I+G+M+  +R
Sbjct:   40 PSPIALNVGAVIMLLALLWGIFAN-ALTSTVILMQRDLKNITNIFIVSLCINDIINLSINNLLVLVSYFMMSWTMGAAVCEMIMHFAVLLMGSSLWHTGLISIHRLIVVVFNNFYKKISKRAYTIFVLVAARVVPMLFLITP---------HLGEMSEYQPKLLRCLVRREHGLYTMLVSVVLMMLPSVILIVCYVAIFVKVHQSSSAFRATRKREWLRREIQITKMFGMVFLLIIFGYLPYGIVRFIDRRLEFSADFYVVISVLYAVANSCNPIIYGVMDRRIR 314          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A3S1A3X5 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_010092 PE=4 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.909e-33
Identity = 94/285 (32.98%), Postives = 158/285 (55.44%), Query Frame = 2
Query:  122 PSKSFAFVCGIVMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVARHSFYVKIHKTGYAILIIICSRLYPXXXXXXXXXXXXKNIMDLNSIIVYDPRILRCVYRPKESLRXXXXXXXXXXX-XXXXXXXXXXXXXXXXRRISYQSSVRDKHRIQREIQITKMFAMVFLMFIMGYFPYSLVRALDSKKTFPPDVYVIVTVLYALASCLNSLIFGLMNVTLR 973
            PS S   +  +VM L  + G+FG++     +++ K L +++ N+FI SL +ND+ NL     +VL SY    W  G  +C L+   +++L+  SL H   I IHR +VV  ++FY KI K  Y + ++  +R+ P++               L  +  ++P+++RC+ R + +L   ++ I        ++I+   A+ +   R  S   + R +   +REIQ+TKMF MVFL+ I+GY PY +VR +D +  F  D YV VTVLYA+A+  N +I+G+M+  +R
Sbjct:   41 PSASALRIGAVVMSLALLWGLFGNILTSCVILRNKDL-KSMTNVFIVSLCINDILNLGINNMIVLISYFTMEWTMGLAVCELVMHFTVLLMGSSLWHTGLISIHRLIVVCFNNFYKKISKRSYLVFVLSFARIVPLMFMVTA---------PLGRMSKFEPKLVRCIARKEFALYTMLVSITLQMLPSIILIVCYIAIFIKVFRSSSAIRATRKREWFRREIQVTKMFGMVFLLIILGYLPYGIVRFIDRRLEFSADFYVGVTVLYAVANSCNPIIYGVMDRKIR 315          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A2C9LLL1 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106072027 PE=4 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 9.722e-32
Identity = 92/286 (32.17%), Postives = 159/286 (55.59%), Query Frame = 2
Query:  122 PSKSFAFVCGIVMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVARHSFYVKIHKTGYAILIIICSRLYPXXXXXXXXXXXXKNIMDLNSIIVYDPRILRCVYRPKESL--RXXXXXXXXXXXXXXXXXXXXXXXXXXXRRISYQSSVRDKHRIQREIQITKMFAMVFLMFIMGYFPYSLVRALDSKKTFPPDVYVIVTVLYALASCLNSLIFGLMNVTLR 973
            PS +   +  IVML+  + G+FG++     ++  + L +N  N+FI SL +ND+ NL     +VL SY +  W  G  +C ++   +++L+  SL H   I IHR +VV  ++FY KI K  Y I ++  +R+ P++               L ++  + P+++RC+ R KE L   + + +   +    ++I+   A+ +   R  S   + R +  ++REIQ+TKMF MVFL+ I+GY PY +VR +D K     D YV ++V+YA+A+  N +I+G+M+  +R
Sbjct:   43 PSATALHIGAIVMLIALLWGLFGNILTSFVILTNRDL-KNTTNVFIVSLCINDILNLGINNMIVLISYFMMEWRMGLEICEMVMHFTVLLMGSSLWHTGLISIHRLIVVCFNNFYKKISKKAYVIFVLSFARIVPLLFMITP---------HLGNMSQFQPKLIRCIAR-KEFLLYTMLVSVTLQMLPSIILIVCYIAIFVKVFRSSSAIRATRKREWLRREIQVTKMFGMVFLLIILGYLPYGIVRFIDRKLELSADFYVGISVVYAVANSCNPIIYGVMDRKIR 317          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: mtnr1c (melatonin receptor type 1C-like [Source:NCBI gene;Acc:103024280])

HSP 1 Score: 51.9878 bits (123), Expect = 3.938e-7
Identity = 71/284 (25.00%), Postives = 129/284 (45.42%), Query Frame = 2
Query:  155 VMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVF----IGIHRYLVVARHSFYVKIHKTGYAILIIICSRLYPXXXXXXXXXXXXKNIMDLNSIIVYDPRILRCVY-RPKESLRXXXXXXXXXXXXXXXXXXXXXXXXXXXRRISYQSSVRDKHRIQREIQITKMFAMVFLMFIMGYFPYS---LVRALDSKKTFP--PDVYVIVTVLYA-LASCLNSLIFGLMNVTLR 973
            +++ T ++ I G+L ++L+V + K L +N  NIF+ SLSV DL   L+   L L +     W  GNL C    ++S  ++ +S++  VF    I I+RY  +     Y +++      + +  + L          +    N   L   + YDPR+  C + +   S     +++     P  ++  C+  I   V R+  +   R   R         MF +VF++F + + P +   L  A+D  +  P  P+   + +   A   SCLN++++GL+N   R
Sbjct:   38 ILIFTIVVDIVGNLLVILSVCRNKKL-RNAGNIFVVSLSVADLVVALYPYPLALLAIFHNGWTMGNLHC----QLSGFVMGLSVIGSVFNITAIAINRYCYICHSLRYDRLYTRRNTCIYLTLTWL-------LTAVATLPNF--LVGSLTYDPRVFSCTFAQTVSSSYTVCVVVVHFMFPLGVVSYCYLRIWTLVIRVKGRVRARPGARAADLRNFLTMF-VVFVLFAVCWAPLNFIGLAVAMDPARVAPNVPEWLFVTSYFMAYFNSCLNAVVYGLLNQNFR 306          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: adrb1 (adrenoceptor beta 1 [Source:ZFIN;Acc:ZDB-GENE-081022-145])

HSP 1 Score: 51.6026 bits (122), Expect = 5.344e-7
Identity = 32/114 (28.07%), Postives = 59/114 (51.75%), Query Frame = 2
Query:  113 PSYPSKSFAFVCGIVMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVAR 454
            P  PS+ +A     VM L  ++ + G+  ++LA+ +T  L Q + N+FI SL+  DL   + +     +  +  +W +G+ LC L   + ++ V+ S+     I + RY+ V R
Sbjct:   32 PPGPSEQWAVGMAAVMALIVLVTVAGNALVILAIARTHRL-QTLTNVFITSLACADLIMGMLVVPFGAALQVRGAWLYGSFLCELWIALDVLCVTASIDTLCVIAVDRYVAVTR 144          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: ednrba (endothelin receptor Ba [Source:ZFIN;Acc:ZDB-GENE-980526-16])

HSP 1 Score: 49.2914 bits (116), Expect = 3.336e-6
Identity = 34/113 (30.09%), Postives = 59/113 (52.21%), Query Frame = 2
Query:  113 PSYPSKSFAFVCGIVMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVA 451
            P+    +F ++  +V  L  ++GI G+  ++  + K K + +N  NI I SL++ DL +++    + +   L   WPFG  LC L+P V    V I+++    + I RY  VA
Sbjct:   54 PTEIRDTFKYINTVVSCLVFVVGIIGNSTLLRIIYKNKCM-RNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGVGLCKLVPFVQKASVGITVLSLCALSIDRYRAVA 165          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000055934.1 (endothelin receptor type B-like [Source:NCBI gene;Acc:103043510])

HSP 1 Score: 48.1358 bits (113), Expect = 7.568e-6
Identity = 34/116 (29.31%), Postives = 60/116 (51.72%), Query Frame = 2
Query:  113 PSYPSKSFAFVCGIVMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVARHS 460
            P+   ++F +V  ++  L  ++GI G+  ++  + K K + +N  N+ I SL++ DL  +LF   + +   L   WPFG  +C L+P V    V I+++    + I RY  V   S
Sbjct:   70 PTEIKETFKYVNTVISCLIFVVGIIGNSTLLRIIYKNKCM-RNGPNVLIGSLALGDLFYILFALPINVFKLLAEDWPFGVHICKLMPFVQKASVGITVLSLCALSIDRYHAVTSWS 184          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Match: si:dkey-202l22.3 (prolactin releasing hormone receptor [Source:HGNC Symbol;Acc:HGNC:4464])

HSP 1 Score: 46.2098 bits (108), Expect = 6.152e-6
Identity = 29/97 (29.90%), Postives = 55/97 (56.70%), Query Frame = 2
Query:  164 LTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDL-TNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVA 451
            L +++G+ G+L ++L + +TK LH N  N  + +L+++DL   L  +      ++    W +G LLC+L+  +    V +S++    I + RY+VVA
Sbjct:   76 LLTLVGVSGNLLLILVIARTKRLH-NATNFLLGNLALSDLLVCLTCVPISAAFAFEPRGWVYGALLCYLVALLQPATVHVSVLSLTAIALDRYVVVA 171          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO38513 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCL3])

HSP 1 Score: 49.6766 bits (117), Expect = 6.405e-7
Identity = 36/122 (29.51%), Postives = 62/122 (50.82%), Query Frame = 2
Query:  155 VMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVARHSFYVKIHKTGYAILIIICSRL 520
            V ++ S++G+ G++ +VL +VK K     +I +FI +L+V D++ L           ++  WPF +  C         LVS SL+   F  I+RY +V R ++Y ++  T      +IC  L
Sbjct:    1 VFIILSLVGLIGNI-LVLWIVKKKRNEGKVIYLFIGALAVTDVSLLAVYPLFAFPVLVLGKWPFSDFFCQFYGFYISCLVSASLLLMAFTAINRYFLVVRTNYYRRLF-TSMRTRFLICGAL 120          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO32200 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVR3])

HSP 1 Score: 49.6766 bits (117), Expect = 8.043e-7
Identity = 24/79 (30.38%), Postives = 43/79 (54.43%), Query Frame = 2
Query:  755 RDKHRIQREIQITKMFAMVFLMFIMGYFP---YSLVRALDSKKTFPPDVYVIVTVLYALASCLNSLIFGLMNVTLRSAI 982
            R   ++  E ++ K+FA+  +MFI+ +FP   Y++  A+D     PP ++VI     AL S +N +++  M    R A+
Sbjct:  202 RQMRKLSSEAKVAKVFAIAAIMFILSWFPVLFYTIAAAVDRIGVVPPWIFVISPFTLALGSLVNPVLYSFMKPDFRRAL 280          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: mtnr1c (melatonin receptor type 1C-like [Source:NCBI gene;Acc:105357260])

HSP 1 Score: 50.0618 bits (118), Expect = 1.548e-6
Identity = 78/294 (26.53%), Postives = 137/294 (46.60%), Query Frame = 2
Query:  155 VMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVF----IGIHRYLVVARHSFYVKIHKTGYAILIIICSRLYPXXXXXXXXXXXXKNIMDLNSIIVYDPRILRCVYRPKESLRXXXXXXXXXXXXXXXXXXXXXXXXXXXRRISYQSSVRDKHRIQREIQITK-----------MFAMVFLMFIMGYFPYSLVR---ALDSKKTFP--PDVYVIVTVLYA-LASCLNSLIFGLMNVTLR 973
            V++ T ++ I G++ ++++V + K L +N  NIF+ SLSV DL   L+   LVL++     W  G+L C    + S  ++ IS++  +F    I I+RY  +     Y ++    Y++    C   Y  +      I    N       + YDPRI  C +    S        +TI    +  ++   ++     RI +   ++ KHR++ E Q T+           MF MVF++F + + P +L+    A++  K  P  P+   + +   A   SCLN++I+GL+N   R
Sbjct:   33 VLIFTIVVDILGNVLVIMSVYRNKKL-RNAGNIFVVSLSVADLVVALYPYPLVLTAIFHNDWTMGDLHC----QASGFIMGISVIGSIFNITAIAINRYCYICHSLHYDRL----YSVRNTCC---YLGLTWLLTAIATVPNFFV--GSLQYDPRIYSCTFAQTVS------SYYTISVVVIHFLIPLLVVSYCYMRI-WVLVIKVKHRVKPE-QRTRLKPSDVRNFLTMF-MVFVLFAVCWAPLNLIGLAVAINPVKVAPNIPEWLFVTSYFMAYFNSCLNAIIYGLLNQNFR 303          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: npy4r (neuropeptide Y receptor type 1-like [Source:NCBI gene;Acc:101168234])

HSP 1 Score: 49.2914 bits (116), Expect = 3.319e-6
Identity = 31/114 (27.19%), Postives = 64/114 (56.14%), Query Frame = 2
Query:  167 TSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVARHSFYVKIHKTGYAILIII 508
            T ++G+ G++ ++  ++  +    N+ +IFIC+LS +D+   +F     +   L+  W FG+LLC L+P +  + V++S++  VFI + R+ ++   S +       Y  +I+I
Sbjct:   67 TMVLGLVGNIGLI-CIIAHRREKVNVTSIFICNLSFSDILVCVFCLPFTIIYTLMDHWVFGSLLCRLVPFIQCVSVTVSVLSLVFIALERHQLIINPSGWKPSLFQAYMAVIVI 179          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: ednrba (endothelin receptor type B [Source:NCBI gene;Acc:101158386])

HSP 1 Score: 48.521 bits (114), Expect = 5.846e-6
Identity = 35/113 (30.97%), Postives = 59/113 (52.21%), Query Frame = 2
Query:  113 PSYPSKSFAFVCGIVMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVA 451
            P+    +F ++  +V  L  I+GI G+  ++  + K K + +N  NI I SL++ DL +++    + +   L   WPFG  LC L+P V    V I+++    + I RY  VA
Sbjct:   70 PTEIRDTFKYINTVVSCLVFIIGIIGNSTLLRIIYKNKCM-RNGPNILIGSLALGDLLHIIIGIPINVYKLLAEDWPFGVNLCKLVPFVQKASVGITVLSLCALSIDRYRAVA 181          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: mtnr1bb (melatonin receptor type 1B-B [Source:NCBI gene;Acc:101174522])

HSP 1 Score: 47.7506 bits (112), Expect = 9.274e-6
Identity = 71/299 (23.75%), Postives = 146/299 (48.83%), Query Frame = 2
Query:  137 AFVCGI---VMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVF----IGIHRYLVVARHSF-YVKIHKTGYAILIIICSRLYPXXXXXXXXXXXXKNIMDLNSIIVYDPRILRCVYRPKESLRXXXXXXXXXXXXXXXXXX-----XXXXXXXXXRRISYQSSVRDKHRIQREIQITKMFAMVFLMFIMGYFPYSLVR---ALDSKKTFP--PDVYVIVTVLYA-LASCLNSLIFGLMNVTLRS 976
            A+V GI   V++ T+++ + G+L ++++V + + L +N  N+F+ SL+  DL    +   LVL +     W  GN  C     VS  L+ +S++  +F    I ++RY  +  HSF Y +++   Y   ++  + ++ + +   +  F   ++        YDPR+  C +    S   ++ ++   F   + ++       + L++   R++  + + R +    R      MF +VF++F + + P +L+    A+D  +  P  P+   +V+   A   SCLN++I+GL+N   R+
Sbjct:   32 AWVIGILASVLIFTTVVDVLGNLLVIISVFRNRKL-RNSGNVFVVSLAFADLVVAFYPYPLVLYALFHDGWALGNTQCM----VSGFLMGLSVIGSIFNITGIAVNRYCYIC-HSFSYSRLYS--YRNTLLFVALIWVLTVVAIVPNFFVGSLR-------YDPRVYSCTFAQNVSSSYTVAVVVVHFLVPIAVVTFCYLRIWVLVIQVRRKVKTEENPRLRPSDLR--NFITMF-VVFVLFAICWAPLNLIGLAVAIDPTRVAPRIPEWLFVVSYFMAYFNSCLNAVIYGLLNRNFRN 312          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000016250.1 (SMESG000016250.1)

HSP 1 Score: 468.389 bits (1204), Expect = 4.005e-167
Identity = 302/304 (99.34%), Postives = 303/304 (99.67%), Query Frame = 2
Query:   71 MLNDXXXXXXXXXXPSYPSKSFAFVCGIVMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVARHSFYVKIHKTGYAILIIICSRLYPXXXXXXXXXXXXKNIMDLNSIIVYDPRILRCVYRPKESLRXXXXXXXXXXXXXXXXXXXXXXXXXXXRRISYQSSVRDKHRIQREIQITKMFAMVFLMFIMGYFPYSLVRALDSKKTFPPDVYVIVTVLYALASCLNSLIFGLMNVTLRSAI 982
            MLNDSS NFGNFSSPSYPSKSFAFVCGIVMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQSLVLSSYLVYSWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVA+HSFYVKIHKTGYAILIIICSRLYPIIISFFLMIFLSKNIMDLNSIIVYDPRILRCVYRPKESLRISIIIIFTIFSPCVIIILCFALILIFVRRISYQSSVRDKHRIQREIQITKMFAMVFLMFIMGYFPYSLVRALDSKKTFPPDVYVIVTVLYALASCLNSLIFGLMNVTLRSAI
Sbjct:    1 MLNDSSVNFGNFSSPSYPSKSFAFVCGIVMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQSLVLSSYLVYSWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVAKHSFYVKIHKTGYAILIIICSRLYPIIISFFLMIFLSKNIMDLNSIIVYDPRILRCVYRPKESLRISIIIIFTIFSPCVIIILCFALILIFVRRISYQSSVRDKHRIQREIQITKMFAMVFLMFIMGYFPYSLVRALDSKKTFPPDVYVIVTVLYALASCLNSLIFGLMNVTLRSAI 304          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000072564.1 (SMESG000072564.1)

HSP 1 Score: 60.4622 bits (145), Expect = 4.245e-10
Identity = 59/297 (19.87%), Postives = 133/297 (44.78%), Query Frame = 2
Query:  119 YPSKSFAFVCGIVMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPF--GNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVARHSFYVKIHKTGYAILIIICSRLYPXXXXXXXXXXXXKNIMDLNSIIVYDPRILRCVYRPKESLRXXXXXXXXXXXXXXXXXXX--------XXXXXXXXRRISYQSSVRDKHRIQREIQITKMFAMVFLMFIMGYFPYSLVRALDSKKTFPPDVYVIVTVLYALASCLNSLIFGLMNVTLRSA 979
            YP  +  F+  +++ L++ +G  G++  ++A+   K L+    N+F+ +L++ DLT  LF+    ++  ++    F     LC L+  + + +   SL+    +G +RY+ +  +S Y K++     +L  I   +   I      I    N         +D + L C+Y    +   +      +    +I            +      V+ +  ++S +        +++ +M  +++  F+M +FPY+++  +D   +FP +V+  + +   L S LN++++G  N+  R A
Sbjct:   24 YPITAITFL--VMLTLSTTIGGIGNILTIIAITTIKELNTTG-NMFVVNLAITDLTVSLFVNLFNIAGVIIGEMFFRVNRWLCELVGALCLTVCICSLLSITSVGFNRYIFIVHNSLYHKVYTRRNTVLFCIGLWIIAFIAQMGNEIGWGDN--------AFDRKTLSCIYSRTAARSFTNFFAGFLVMAPIIFTAVCYILIFYHWKKSANRVKEMKGENSKKQNSEANNSMRLARMLFVIYFTFVMCWFPYAVIVLIDVHDSFPAEVHGTLIITAHLNSSLNAILYGFTNIQFRRA 309          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000041717.1 (SMESG000041717.1)

HSP 1 Score: 53.9138 bits (128), Expect = 6.150e-8
Identity = 70/295 (23.73%), Postives = 137/295 (46.44%), Query Frame = 2
Query:  119 YPSKSFAFVCGIVMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPF--GNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVARHSFYVKI--HKTGYAILIIICSRLYPXXXXXXXXXXXXKNIMDLNSIIVYDPRILRCVY-RPKESLRXXXXXXXXXXXXXXXXXXXXXXXXXXXRRISYQSSVRDKHRIQREIQITKMFAMVFLMF---IMGYFPYSLVRALDSKKTFPPDVYVIVTVLYALASCLNSLIFGLMNVTLRSA 979
            +P  SF F    ++ LTS+ G+FG++  ++AV  TK L+    NIF+ +L++ D+    FI ++ +   L     F     LC  I    +     SL+    +GI+RY+ + +++ Y K+   ++ Y + +I+              +    N +       +D + L C+Y R  +         F +  P ++   C+  I +F R++S + +   K     ++   K+  M+FL+F   ++ + PY++V   D   T+   V++       L S +N +++G+ N+  RSA
Sbjct:   24 FPYISFTFTS--LLSLTSVTGVFGNVLTIIAVFNTKELNFE-GNIFVVNLAIADIIVCGFIDTMSIVGLLEGEVFFIDKTGLCKFIGSTCLTACICSLLTISSVGINRYIFIVKNNIYRKLFTRRSCYLLCVIL---------WVISFLLNMPNFVGWGG-HTFDRKTLSCIYDRMADPSFTLFFAGFIVSLPVIVTSFCYIRIYLFWRKVSVKIAKMSKSSQSTQLNSMKLARMLFLLFFIYVICWTPYAIVANADRHNTYSEIVHIFSVTSAHLNSSINPILYGVTNLQFRSA 305          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000023113.1 (SMESG000023113.1)

HSP 1 Score: 53.9138 bits (128), Expect = 7.275e-8
Identity = 32/124 (25.81%), Postives = 69/124 (55.65%), Query Frame = 2
Query:  137 AFVCGIVMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVARHSFYVKIHKTGYAILIII 508
            +F+  +++L+T    +FG+  +V++V+K + L   +   F+CSL+++D+   +F+  + +  +LV  WPFG + C+      ++  + S++H   + I RY+ +A    Y  +     A+ II+
Sbjct:   21 SFLMNLIILVT----LFGNTLVVVSVIKFRRLRSQMCFRFLCSLAISDICVAVFVMFVSMIYFLVQLWPFGWVFCYFWMSCDVMCCTASILHLCAVAIDRYISIAHGLRYATLMTGRRALTIIV 140          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000046633.1 (SMESG000046633.1)

HSP 1 Score: 48.9062 bits (115), Expect = 2.711e-6
Identity = 39/120 (32.50%), Postives = 62/120 (51.67%), Query Frame = 2
Query:  149 GIVMLLTSIMGIFGHLAIVLAVVKTKLLHQNIINIFICSLSVNDLTNLLFIQXXXXXXXXXXXWPFGNLLCFLIPEVSMILVSISLVHHVFIGIHRYLVVARHSFYVKIHKTGYAILIII 508
            G++ +LT    I G++A++L V++  +  + +INIFIC+LS+ D+   LF+  + L   +   W FG LLC   P +    V  S+     I   RY+ +      V   KT Y I+I I
Sbjct:   33 GMIFVLT----IIGNIAVLLTVIR-HVSMRTVINIFICNLSIADILCALFVLPITLLQSIHNEWHFGTLLCRASPYLQGTTVCASISTLTIIAFDRYVAICHPMKRVINKKTTYIIVIGI 147          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EDNRB3.623e-628.57endothelin receptor type B [Source:HGNC Symbol;Acc... [more]
EDNRB3.778e-628.83endothelin receptor type B [Source:HGNC Symbol;Acc... [more]
EDNRB3.778e-628.83endothelin receptor type B [Source:HGNC Symbol;Acc... [more]
EDNRB3.778e-628.83endothelin receptor type B [Source:HGNC Symbol;Acc... [more]
EDNRB3.778e-628.83endothelin receptor type B [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
npr-108.871e-632.61NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-109.134e-632.61NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tre17.975e-932.41gene:FBgn0046687 transcript:FBtr0308339[more]
Tre17.975e-932.41gene:FBgn0046687 transcript:FBtr0070848[more]
Tre18.792e-932.41gene:FBgn0046687 transcript:FBtr0340222[more]
moody1.955e-729.23gene:FBgn0025631 transcript:FBtr0310289[more]
moody1.955e-729.23gene:FBgn0025631 transcript:FBtr0310288[more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mtnr1c2.785e-624.21melatonin receptor 1C [Source:NCBI gene;Acc:30661][more]
mtnr1c2.785e-624.21melatonin receptor 1C [Source:NCBI gene;Acc:30661][more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
yod11.643e-623.08YOD1 deubiquitinase [Source:Xenbase;Acc:XB-GENE-99... [more]
yod11.927e-623.08YOD1 deubiquitinase [Source:Xenbase;Acc:XB-GENE-99... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Ednrb2.010e-731.25endothelin receptor type B [Source:MGI Symbol;Acc:... [more]
Ednrb2.010e-731.25endothelin receptor type B [Source:MGI Symbol;Acc:... [more]
Ednrb2.010e-731.25endothelin receptor type B [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9NDM2|GUTR1_DROME7.994e-832.41Protein trapped in endoderm-1 OS=Drosophila melano... [more]
sp|P48302|EDNRB_MOUSE1.406e-631.25Endothelin receptor type B OS=Mus musculus OX=1009... [more]
sp|Q9W534|MOODY_DROME1.960e-629.23G-protein coupled receptor moody OS=Drosophila mel... [more]
sp|P21451|EDNRB_RAT3.083e-630.36Endothelin receptor type B OS=Rattus norvegicus OX... [more]
sp|P43141|ADB4C_MELGA8.797e-625.74Beta-4C adrenergic receptor OS=Meleagris gallopavo... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7TMD39.167e-3736.62G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
V4AYR32.963e-3635.36G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A2T7NWP81.427e-3536.49G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A3S1A3X51.909e-3332.98G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A2C9LLL19.722e-3232.17G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mtnr1c3.938e-725.00melatonin receptor type 1C-like [Source:NCBI gene;... [more]
adrb15.344e-728.07adrenoceptor beta 1 [Source:ZFIN;Acc:ZDB-GENE-0810... [more]
ednrba3.336e-630.09endothelin receptor Ba [Source:ZFIN;Acc:ZDB-GENE-9... [more]
ENSAMXT00000055934.17.568e-629.31endothelin receptor type B-like [Source:NCBI gene;... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:dkey-202l22.36.152e-629.90prolactin releasing hormone receptor [Source:HGNC ... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO385136.405e-729.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO322008.043e-730.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mtnr1c1.548e-626.53melatonin receptor type 1C-like [Source:NCBI gene;... [more]
npy4r3.319e-627.19neuropeptide Y receptor type 1-like [Source:NCBI g... [more]
ednrba5.846e-630.97endothelin receptor type B [Source:NCBI gene;Acc:1... [more]
mtnr1bb9.274e-623.75melatonin receptor type 1B-B [Source:NCBI gene;Acc... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016250.14.005e-16799.34SMESG000016250.1[more]
SMESG000072564.14.245e-1019.87SMESG000072564.1[more]
SMESG000041717.16.150e-823.73SMESG000041717.1[more]
SMESG000023113.17.275e-825.81SMESG000023113.1[more]
SMESG000046633.12.711e-632.50SMESG000046633.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023040 ID=SMED30023040|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1021bp
AATAATGTGAGTGACTATTTAAACAGGTAAAAAAACATAATTCAGATAAT
CAGTCATTTTATTGCGGAAAATGTTGAATGATTCCAGTGGAAATTTTGGA
AATTTCTCATCTCCTTCCTACCCCAGTAAATCTTTTGCATTCGTATGTGG
AATCGTCATGCTCCTCACTTCCATAATGGGCATTTTCGGACACTTGGCAA
TCGTACTGGCTGTCGTAAAAACGAAATTACTTCATCAAAACATCATAAAC
ATTTTCATTTGCAGTCTCAGCGTGAATGATCTGACAAATTTATTATTTAT
CCAGTCTCTTGTCTTAAGCAGTTATTTGGTGTATTCTTGGCCGTTTGGAA
ATCTTTTGTGCTTTCTCATTCCAGAGGTCAGCATGATCCTAGTATCAATC
AGTCTGGTGCACCATGTTTTCATCGGGATCCATCGGTATCTGGTCGTTGC
CAGACACTCATTCTATGTGAAAATCCACAAAACTGGCTATGCCATCCTGA
TAATTATCTGTTCCAGACTTTATCCCATTATAATCAGCTTCTTTCTGATG
ATTTTCCTTTCGAAAAACATCATGGATCTCAACAGCATAATCGTGTATGA
CCCAAGAATTCTTAGATGTGTTTATAGACCGAAGGAATCTTTGCGAATAT
CTATCATTATTATCTTTACCATATTCTCGCCATGCGTCATTATCATTTTA
TGTTTTGCGCTGATTTTAATCTTTGTCAGGCGGATCTCGTATCAGTCCAG
CGTGCGGGATAAACATCGGATTCAACGAGAAATCCAAATAACAAAGATGT
TTGCAATGGTATTCCTAATGTTTATTATGGGATACTTTCCGTATAGTCTC
GTCAGGGCTTTAGATTCAAAAAAGACCTTTCCACCTGATGTATACGTCAT
TGTTACTGTTCTATATGCTCTAGCATCTTGTTTAAATTCTTTGATCTTTG
GATTGATGAATGTCACTCTTAGATCAGCAATTTTCAAATTGTTTTTACCG
AAACTTTAGTAAAATTTTGAA
back to top

protein sequence of SMED30023040-orf-1

>SMED30023040-orf-1 ID=SMED30023040-orf-1|Name=SMED30023040-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=313bp
MLNDSSGNFGNFSSPSYPSKSFAFVCGIVMLLTSIMGIFGHLAIVLAVVK
TKLLHQNIINIFICSLSVNDLTNLLFIQSLVLSSYLVYSWPFGNLLCFLI
PEVSMILVSISLVHHVFIGIHRYLVVARHSFYVKIHKTGYAILIIICSRL
YPIIISFFLMIFLSKNIMDLNSIIVYDPRILRCVYRPKESLRISIIIIFT
IFSPCVIIILCFALILIFVRRISYQSSVRDKHRIQREIQITKMFAMVFLM
FIMGYFPYSLVRALDSKKTFPPDVYVIVTVLYALASCLNSLIFGLMNVTL
RSAIFKLFLPKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 104..126
score: 22.78
coord: 25..49
score: 16.71
coord: 275..301
score: 22.44
coord: 59..80
score: 27.11
coord: 193..216
score: 18.32
coord: 240..264
score: 20.9
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 44..292
e-value: 3.0E-21
score: 75.9
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 19..311
e-value: 9.8E-39
score: 135.1
NoneNo IPR availablePANTHERPTHR24228B2 BRADYKININ RECEPTOR/ANGIOTENSIN II RECEPTORcoord: 23..304
NoneNo IPR availableCDDcd006377tm_classA_rhodopsin-likecoord: 28..297
e-value: 6.74836E-26
score: 101.971
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 16..311
NoneNo IPR availableTMHMMTMhelixcoord: 61..83
NoneNo IPR availableTMHMMTMhelixcoord: 238..260
NoneNo IPR availableTMHMMTMhelixcoord: 275..297
NoneNo IPR availableTMHMMTMhelixcoord: 98..120
NoneNo IPR availableTMHMMTMhelixcoord: 195..217
NoneNo IPR availableTMHMMTMhelixcoord: 27..49
NoneNo IPR availableTMHMMTMhelixcoord: 140..162
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 40..293
score: 30.061