Protein transport protein Sec24C

Overview
NameProtein transport protein Sec24C
Smed IDSMED30023022
Length (bp)3288
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein transport protein Sec24C (SMED30023022) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein transport protein Sec24C (SMED30023022) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein transport protein Sec24C (SMED30023022) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein transport protein Sec24C (SMED30023022) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023022

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30023022SMESG000060905.1 dd_Smed_v4_1764_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023022SMESG000060905.1 dd_Smed_v4_1764_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30023022SMESG000060905.1 dd_Smed_v4_1764_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023022SMESG000060905.1 dd_Smed_v4_1764_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein transport protein Sec24C vs. Ensembl Human
Match: SEC24C (SEC24 homolog C, COPII coat complex component [Source:HGNC Symbol;Acc:HGNC:10705])

HSP 1 Score: 700.279 bits (1806), Expect = 0.000e+0
Identity = 370/797 (46.42%), Postives = 515/797 (64.62%), Query Frame = 2
Query:  653 QSLNPEYMPSAVQVIELDKSNNNA-PYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINRYS-LPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 3037
            + L+P+ +PS +QVIE D++N    P+ TG R +VPPLVTT+F+  DQG  +P+YIR + Y +P   DM K   +P    I P A+L   E      +    GP+RC RCKAYM P M FI+GGRRFQC  C    +V  + F HLD +G+R+D ++RPEL LGSYE +AT +YCKN+  P+PPAFIFM+DVS+N++++GL+ L C  LK  +L +L  +    +S    VGFVTY++VLHFYN++S++++PQM+V+S    D     VPL++GFLV+ +E+   I+ L++ I + F DT E   V  PVI+AGMEALKAA       F+FH+SLP+ EAPGKLK RD+R ++ TDKEKTLF   +  Y  LA  C   G  +DLFL P+ ++DVATLS +P+ TGG++YKY  F   N   + L D++  V     FDAVMRVRTS G R VDF G FYM NT DV LA +  DK+V VE +H+D+L E     +Q A+LYTS +GQRRLRIHN++ N  T + D+++  + DTL+N+M++ A +      VK VRD +  + +QILA YR+N A  S   +L+LPE +KLLP+Y N +LK D +Q             G ++ TD+RAY   L+  MDV  T VF YPRLLPL  +  E + E    P A+R S   LS+   YL+ENG+++ LW+G +  +  +Q++F  SS S+I +  S LP+ +N +S +V  ++  +R+ RSR+M L +V Q D+ME  FK  LVED+   G +SYVDFLCH+HKEIR +
Sbjct:  319 KRLDPDAIPSPIQVIEDDRNNRGTEPFVTGVRGQVPPLVTTNFLVKDQGNASPRYIRCTSYNIPCTSDMAKQAQVPLAAVIKPLARLPPEEASPYVVDHGESGPLRCNRCKAYMCPFMQFIEGGRRFQCCFCSCINDVPPQYFQHLDHTGKRVDAYDRPELSLGSYEFLATVDYCKNNKFPSPPAFIFMIDVSYNAIRTGLVRLLCEELKS-LLDFLPREGGAEESAI-RVGFVTYNKVLHFYNVKSSLAQPQMMVVS----DVADMFVPLLDGFLVNVNESRAVITSLLDQIPEMFADTRETETVFVPVIQAGMEALKAAECAGKL-FLFHTSLPIAEAPGKLKNRDDRKLINTDKEKTLFQPQTGAYQTLAKECVAQGCCVDLFLFPNQYVDVATLSVVPQLTGGSVYKYASFQVENDQERFLSDLRRDVQKVVGFDAVMRVRTSTGIRAVDFFGAFYMSNTTDVELAGLDGDKTVTVEFKHDDRLNEESGALLQCALLYTSCAGQRRLRIHNLALNCCTQLADLYRNCETDTLINYMAKFAYRGVLNSPVKAVRDTLITQCAQILACYRKNCASPSSAGQLILPECMKLLPVYLNCVLKSDVLQ------------PGAEVTTDDRAYVRQLVTSMDVTETNVFFYPRLLPLTKSPVESTTE----PPAVRASEERLSNGDIYLLENGLNLFLWVGASVQQGVVQSLFSVSSFSQITSGLSVLPVLDNPLSKKVRGLIDSLRAQRSRYMKLTVVKQEDKMEMLFKHFLVEDKSLSGGASYVDFLCHMHKEIRQL 1092          
BLAST of Protein transport protein Sec24C vs. Ensembl Human
Match: SEC24C (SEC24 homolog C, COPII coat complex component [Source:HGNC Symbol;Acc:HGNC:10705])

HSP 1 Score: 700.279 bits (1806), Expect = 0.000e+0
Identity = 370/797 (46.42%), Postives = 515/797 (64.62%), Query Frame = 2
Query:  653 QSLNPEYMPSAVQVIELDKSNNNA-PYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINRYS-LPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 3037
            + L+P+ +PS +QVIE D++N    P+ TG R +VPPLVTT+F+  DQG  +P+YIR + Y +P   DM K   +P    I P A+L   E      +    GP+RC RCKAYM P M FI+GGRRFQC  C    +V  + F HLD +G+R+D ++RPEL LGSYE +AT +YCKN+  P+PPAFIFM+DVS+N++++GL+ L C  LK  +L +L  +    +S    VGFVTY++VLHFYN++S++++PQM+V+S    D     VPL++GFLV+ +E+   I+ L++ I + F DT E   V  PVI+AGMEALKAA       F+FH+SLP+ EAPGKLK RD+R ++ TDKEKTLF   +  Y  LA  C   G  +DLFL P+ ++DVATLS +P+ TGG++YKY  F   N   + L D++  V     FDAVMRVRTS G R VDF G FYM NT DV LA +  DK+V VE +H+D+L E     +Q A+LYTS +GQRRLRIHN++ N  T + D+++  + DTL+N+M++ A +      VK VRD +  + +QILA YR+N A  S   +L+LPE +KLLP+Y N +LK D +Q             G ++ TD+RAY   L+  MDV  T VF YPRLLPL  +  E + E    P A+R S   LS+   YL+ENG+++ LW+G +  +  +Q++F  SS S+I +  S LP+ +N +S +V  ++  +R+ RSR+M L +V Q D+ME  FK  LVED+   G +SYVDFLCH+HKEIR +
Sbjct:  319 KRLDPDAIPSPIQVIEDDRNNRGTEPFVTGVRGQVPPLVTTNFLVKDQGNASPRYIRCTSYNIPCTSDMAKQAQVPLAAVIKPLARLPPEEASPYVVDHGESGPLRCNRCKAYMCPFMQFIEGGRRFQCCFCSCINDVPPQYFQHLDHTGKRVDAYDRPELSLGSYEFLATVDYCKNNKFPSPPAFIFMIDVSYNAIRTGLVRLLCEELKS-LLDFLPREGGAEESAI-RVGFVTYNKVLHFYNVKSSLAQPQMMVVS----DVADMFVPLLDGFLVNVNESRAVITSLLDQIPEMFADTRETETVFVPVIQAGMEALKAAECAGKL-FLFHTSLPIAEAPGKLKNRDDRKLINTDKEKTLFQPQTGAYQTLAKECVAQGCCVDLFLFPNQYVDVATLSVVPQLTGGSVYKYASFQVENDQERFLSDLRRDVQKVVGFDAVMRVRTSTGIRAVDFFGAFYMSNTTDVELAGLDGDKTVTVEFKHDDRLNEESGALLQCALLYTSCAGQRRLRIHNLALNCCTQLADLYRNCETDTLINYMAKFAYRGVLNSPVKAVRDTLITQCAQILACYRKNCASPSSAGQLILPECMKLLPVYLNCVLKSDVLQ------------PGAEVTTDDRAYVRQLVTSMDVTETNVFFYPRLLPLTKSPVESTTE----PPAVRASEERLSNGDIYLLENGLNLFLWVGASVQQGVVQSLFSVSSFSQITSGLSVLPVLDNPLSKKVRGLIDSLRAQRSRYMKLTVVKQEDKMEMLFKHFLVEDKSLSGGASYVDFLCHMHKEIRQL 1092          
BLAST of Protein transport protein Sec24C vs. Ensembl Human
Match: SEC24D (SEC24 homolog D, COPII coat complex component [Source:HGNC Symbol;Acc:HGNC:10706])

HSP 1 Score: 635.565 bits (1638), Expect = 0.000e+0
Identity = 349/799 (43.68%), Postives = 495/799 (61.95%), Query Frame = 2
Query:  644 PQTQS-LNPEYMPSAVQVIELDKSNNNAP-YPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLK-CDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEI-INRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEI 3028
            PQ Q  L+P+ +PS +QVIE D+++     Y T TR ++PPLVTTD +  DQG  +P++IR + Y  P   DM K   IP    I PFA +   E  +        GP+RC RCKAYM P M FI+GGRR+QC  C    +V    F HLD  GRR+D + +PEL LGSYE +AT +YC+    PNPPAFIFM+DVS++++K+GL+ L C  LK  +      +Q    + +  VGF+TY++VLHF+N++SN+++PQM+V++    D G   VPL++GFLV+  E+   I  L++ I D F D+ E   V  PVI+AGMEALKAA       FIFHSSLP  EAPGKLK RD++ ++ TDKEK LF   ++ Y  LA  C   G S+ LFL PS ++DVA+L  +P+ TGG LYKY+ F       + L D+++ +     FDA+MRVRTS G R  DF G   M NT DV +A +  DK+V VE +H+DKL E+    IQ AVLYT+ISGQRRLRIHN+  N S+ + D++K  + D L+N+ +++A K    + +K +R+ +  +++ +LA YR+N A  S  ++L+LP+++K+LP+Y N LLK C  +             S  +++TDERAYQ  L+  M V  +Q+F YP+LLP+         +S  LP+A+R S   LS EG +L+ NG+ + LW+G ++  E +Q +F+  S + I  +   LP   N  S ++  I+ II+  R   M L IV Q ++ E  F++ LVED+G  G SSYVDFLC +HKEI
Sbjct:  253 PQPQKKLDPDSIPSPIQVIENDRASRGGQVYATNTRGQIPPLVTTDCMIQDQGNASPRFIRCTTYCFPCTSDMAKQAQIPLAAVIKPFATIPSNESPLYLVNHGESGPVRCNRCKAYMCPFMQFIEGGRRYQCGFCNCVNDVPPFYFQHLDHIGRRLDHYEKPELSLGSYEYVATLDYCRKSKPPNPPAFIFMIDVSYSNIKNGLVKLICEELKTMLEKIPKEEQEETSAIR--VGFITYNKVLHFFNVKSNLAQPQMMVVT----DVGEVFVPLLDGFLVNYQESQSVIHNLLDQIPDMFADSNENETVFAPVIQAGMEALKAADCPGKL-FIFHSSLPTAEAPGKLKNRDDKKLVNTDKEKILFQPQTNVYDSLAKDCVAHGCSVTLFLFPSQYVDVASLGLVPQLTGGTLYKYNNFQMHLDRQQFLNDLRNDIEKKIGFDAIMRVRTSTGFRATDFFGGILMNNTTDVEMAAIDCDKAVTVEFKHDDKLSEDSGALIQCAVLYTTISGQRRLRIHNLGLNCSSQLADLYKSCETDALINFFAKSAFKAVLHQPLKVIREILVNQTAHMLACYRKNCASPSAASQLILPDSMKVLPVYMNCLLKNCVLL-------------SRPEISTDERAYQRQLVMTMGVADSQLFFYPQLLPI----HTLDVKSTMLPAAVRCSESRLSEEGIFLLANGLHMFLWLGVSSPPELIQGIFNVPSFAHINTDMTLLPEVGNPYSQQLRMIMGIIQQKRPYSMKLTIVKQREQPEMVFRQFLVEDKGLYGGSSYVDFLCCVHKEI 1027          
BLAST of Protein transport protein Sec24C vs. Ensembl Human
Match: SEC24C (SEC24 homolog C, COPII coat complex component [Source:HGNC Symbol;Acc:HGNC:10705])

HSP 1 Score: 625.165 bits (1611), Expect = 0.000e+0
Identity = 333/719 (46.31%), Postives = 462/719 (64.26%), Query Frame = 2
Query:  659 LNPEYMPSAVQVIELDKSNNNA-PYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIIN 2812
            L+P+ +PS +QVIE D++N    P+ TG R +VPPLVTT+F+  DQG  +P+YIR + Y +P   DM K   +P    I P A+L   E      +    GP+RC RCKAYM P M FI+GGRRFQC  C    +V  + F HLD +G+R+D ++RPEL LGSYE +AT +YCKN+  P+PPAFIFM+DVS+N++++GL+ L C  LK  +L +L  +    +S    VGFVTY++VLHFYN++S++++PQM+V+S    D     VPL++GFLV+ +E+   I+ L++ I + F DT E   V  PVI+AGMEALKAA       F+FH+SLP+ EAPGKLK RD+R ++ TDKEKTLF   +  Y  LA  C   G  +DLFL P+ ++DVATLS +P+ TGG++YKY  F   N   + L D++  V     FDAVMRVRTS G R VDF G FYM NT DV LA +  DK+V VE +H+D+L E     +Q A+LYTS +GQRRLRIHN++ N  T + D+++  + DTL+N+M++ A +      VK VRD +  + +QILA YR+N A  S   +L+LPE +KLLP+Y N +LK D +Q             G ++ TD+RAY   L+  MDV  T VF YPRLLPL  +  E + E    P A+R S   LS+   YL+ENG+++ LW+G +  +  +Q++F  SS S+I +
Sbjct:  321 LDPDAIPSPIQVIEDDRNNRGTEPFVTGVRGQVPPLVTTNFLVKDQGNASPRYIRCTSYNIPCTSDMAKQAQVPLAAVIKPLARLPPEEASPYVVDHGESGPLRCNRCKAYMCPFMQFIEGGRRFQCCFCSCINDVPPQYFQHLDHTGKRVDAYDRPELSLGSYEFLATVDYCKNNKFPSPPAFIFMIDVSYNAIRTGLVRLLCEELKS-LLDFLPREGGAEESAI-RVGFVTYNKVLHFYNVKSSLAQPQMMVVS----DVADMFVPLLDGFLVNVNESRAVITSLLDQIPEMFADTRETETVFVPVIQAGMEALKAAECAGKL-FLFHTSLPIAEAPGKLKNRDDRKLINTDKEKTLFQPQTGAYQTLAKECVAQGCCVDLFLFPNQYVDVATLSVVPQLTGGSVYKYASFQVENDQERFLSDLRRDVQKVVGFDAVMRVRTSTGIRAVDFFGAFYMSNTTDVELAGLDGDKTVTVEFKHDDRLNEESGALLQCALLYTSCAGQRRLRIHNLALNCCTQLADLYRNCETDTLINYMAKFAYRGVLNSPVKAVRDTLITQCAQILACYRKNCASPSSAGQLILPECMKLLPVYLNCVLKSDVLQ------------PGAEVTTDDRAYVRQLVTSMDVTETNVFFYPRLLPLTKSPVESTTE----PPAVRASEERLSNGDIYLLENGLNLFLWVGASVQQGVVQSLFSVSSFSQITS 1016          
BLAST of Protein transport protein Sec24C vs. Ensembl Human
Match: SEC24D (SEC24 homolog D, COPII coat complex component [Source:HGNC Symbol;Acc:HGNC:10706])

HSP 1 Score: 541.191 bits (1393), Expect = 2.263e-179
Identity = 299/682 (43.84%), Postives = 428/682 (62.76%), Query Frame = 2
Query:  989 MSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLK-CDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEI-INRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEI 3028
            M P M FI+GGRR+QC  C    +V    F HLD  GRR+D + +PEL LGSYE +AT +YC+    PNPPAFIFM+DVS++++K+GL+ L C  LK  +      +Q   ++    VGF+TY++VLHF+N++SN+++PQM+V++    D G   VPL++GFLV+  E+   I  L++ I D F D+ E   V  PVI+AGMEALKAA       FIFHSSLP  EAPGKLK RD++ ++ TDKEK LF   ++ Y  LA  C   G S+ LFL PS ++DVA+L  +P+ TGG LYKY+ F       + L D+++ +     FDA+MRVRTS G R  DF G   M NT DV +A +  DK+V VE +H+DKL E+    IQ AVLYT+ISGQRRLRIHN+  N S+ + D++K  + D L+N+ +++A K    + +K +R+ +  +++ +LA YR+N A  S  ++L+LP+++K+LP+Y N LLK C  +             S  +++TDERAYQ  L+  M V  +Q+F YP+LLP+         +S  LP+A+R S   LS EG +L+ NG+ + LW+G ++  E +Q +F+  S + I  +   LP   N  S ++  I+ II+  R   M L IV Q ++ E  F++ LVED+G  G SSYVDFLC +HKEI
Sbjct:    1 MCPFMQFIEGGRRYQCGFCNCVNDVPPFYFQHLDHIGRRLDHYEKPELSLGSYEYVATLDYCRKSKPPNPPAFIFMIDVSYSNIKNGLVKLICEELKTMLEKIPKEEQ--EETSAIRVGFITYNKVLHFFNVKSNLAQPQMMVVT----DVGEVFVPLLDGFLVNYQESQSVIHNLLDQIPDMFADSNENETVFAPVIQAGMEALKAADCPGKL-FIFHSSLPTAEAPGKLKNRDDKKLVNTDKEKILFQPQTNVYDSLAKDCVAHGCSVTLFLFPSQYVDVASLGLVPQLTGGTLYKYNNFQMHLDRQQFLNDLRNDIEKKIGFDAIMRVRTSTGFRATDFFGGILMNNTTDVEMAAIDCDKAVTVEFKHDDKLSEDSGALIQCAVLYTTISGQRRLRIHNLGLNCSSQLADLYKSCETDALINFFAKSAFKAVLHQPLKVIREILVNQTAHMLACYRKNCASPSAASQLILPDSMKVLPVYMNCLLKNCVLL-------------SRPEISTDERAYQRQLVMTMGVADSQLFFYPQLLPI----HTLDVKSTMLPAAVRCSESRLSEEGIFLLANGLHMFLWLGVSSPPELIQGIFNVPSFAHINTDMTLLPEVGNPYSQQLRMIMGIIQQKRPYSMKLTIVKQREQPEMVFRQFLVEDKGLYGGSSYVDFLCCVHKEI 658          
BLAST of Protein transport protein Sec24C vs. Ensembl Celegans
Match: sec-24.1 (Yeast SEC homolog [Source:UniProtKB/TrEMBL;Acc:Q19371])

HSP 1 Score: 587.415 bits (1513), Expect = 0.000e+0
Identity = 318/798 (39.85%), Postives = 492/798 (61.65%), Query Frame = 2
Query:  653 QSLNPEYMPSAVQVIELDKSNNNAPYPTGTRD-KVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEI-INRYSLPIHNNNVSLEVNRIVQII-RSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 3037
            Q L+P  MPSAVQVI+ D S  +  +PTG  + ++PPLV+T+  A DQG CNPK++RS++Y  P   D+LK+  IP  + I PFA L E E+     +L P+GPIRC RCKAY+ P M F DGGR F+C  C   T V +  FAHLD +GRR D   RPELCLG+Y+L+AT +YCKN   P  PAFIFM+DVS+N++ +G+L + C NL + +L  L  +    +S    +G  T+D+ +HF+++ S  + P+MLV+S    D     VP+V+G L+  +EA+  +   +  I   F  ++    +L PV++AG++       RAGK+ +F + LP  +APGKLK++++R++LGTDKEK         Y+KL + C +SGV++DLFL P+AFIDVAT+  L   TGG+++K+ +FS    G ++L +++  VS   AFD + RVRTS G R + F G+FYM+N+ D+ LA +   K+ I EI+H+D L++  S  IQ AVLYTS++GQRRLRI N+   V+ +   +++L D + L  +M + AV+  + K   E+R+ +S R +Q LA+YR   +E +   +L+LPE+LKL+PLY NS+LK D +              G+++  D++ +Q  L+  +  ++    +YPR++P+ + +   + E K LP  +R S   L +  AY+I+NG+ + +W+G    + W+Q+VF   + ++I     ++P  +N  S  + R +Q++ R  R R     +V++   +E   KK LVED+    N SYVD+L  IH++IR +
Sbjct:  351 QRLDPNMMPSAVQVIDDDSSTRSGIFPTGYPNAELPPLVSTNSFAQDQGNCNPKFMRSTLYTAPQTNDILKASQIPLAVVISPFASLTEYEKEPPVVDLGPQGPIRCQRCKAYICPFMEFQDGGRSFRCPFCHARTSVEDAYFAHLDHTGRRTDIEMRPELCLGAYDLVATKQYCKNGIAPKEPAFIFMIDVSYNAISNGMLPILCQNL-EKVLRNLPRESGQLESSM-RIGLATFDQAVHFFDISS--ASPKMLVMS----DVQEPFVPMVDGLLLPYNEALPGLRAALAEIPKLFSQSKTTETILQPVVQAGLD-ALKCADRAGKVILFSTVLPTYDAPGKLKSKNDRSLLGTDKEKNALVPQEDSYTKLGEQCVKSGVTVDLFLFPNAFIDVATIGQLSAVTGGSIFKFQYFSADKDGVRMLNELERHVSKKIAFDCMARVRTSTGIRPITFTGSFYMENSTDLELATLDESKAFITEIKHDDSLKDPASF-IQTAVLYTSMTGQRRLRILNLCLPVTADYNQVYRLADPEALTAFMLKQAVQLNRDKGSSEMRESLSSRCAQFLATYREKCSEGAPLGQLILPESLKLMPLYVNSILKNDAI------------SGGSEMTVDDKVWQMELIRGLRTENVMPLIYPRVMPISDLQINDTEEMKDLPKPVRASSEFLENSKAYIIDNGVILFVWVGSACPQTWVQDVFGVGATNQIDTESGTIPEKDNGHSRALRRAIQLLPRGIRERKTF--VVVEKSGLEPWMKKFLVEDKAGPANMSYVDYLVDIHRKIRDL 1124          
BLAST of Protein transport protein Sec24C vs. Ensembl Celegans
Match: sec-24.2 (Yeast SEC homolog [Source:UniProtKB/TrEMBL;Acc:Q23368])

HSP 1 Score: 223.787 bits (569), Expect = 6.428e-60
Identity = 194/759 (25.56%), Postives = 364/759 (47.96%), Query Frame = 2
Query:  779 IAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKD---TEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSN--HGTKLL-KDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAV-KTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDR--MESAFKKLLVEDRGERGNSSYVDFLCHIHKEI 3028
            +A      +P   RS++  VP   ++LK   +PF + + PF  +           +     +RC  C+ Y++P + ++   R ++CN+C  N ++ ++ F     +    D  NRPE+   + E +A +EY      P P  ++F++D+S  +++SG L+ F   L  +I      DQ+ P   +  V F+  D+ LHF++  SN   P  +++  +D+      +P V   LV   +  + I   ++ + + +     T   N  LG  ++     ++  GGR     IF  SLP +   G LK+R+E T  G +         + +Y  L+  C+ S + +DLF+  + + D+ATLS++ K + G +Y +  ++  N  H  K   + +   ++    F+AV+R+RTS G     F GNF++++ + + LA V+ D ++  ++   +KL   + V  Q A+LYTS  G RR+R+H +    + ++L ++   DL   ++++++  V ++    S+ + R+ +       + +Y++  +  S    +    +L+L P Y  ++LK                 S   +  DERA    +M    +      +YPRL  L    S    +S   P A+  S+ ++S  G YL+  G    +++  +A+  +L NVF  S+ ++ I+ YSL   +N +S  V+   + +  T+ RF +  I+   +   +   F + LV+DR E    SYV+FL H+ +EI
Sbjct:  276 VANPNAHVDPNIFRSTLAQVPQTEELLKKSRLPFAITLHPFRDVKN------LNIIQTSNIVRCRYCRTYINPYV-YLPDHRHWKCNLCNRNNDLPDD-FCWDPVTKAFGDPRNRPEIQNATVEFIAPSEYMLRP--PQPAVYVFVIDISAAAIQSGYLHTFAEQLLINI------DQM-PGDDRSQVCFIAVDQCLHFFSFSSNKRYPNEMIVDDIDDA----FLPSVTSLLVPMKKFKDTIRTFIKQLPEFYSQIGPTSNGNC-LGSALKLAQSMIQEVGGRIS---IFQVSLPNLGL-GALKSREESTEGGQN-----LGPATDFYKALSLECTGSQICLDLFMFNTQYADLATLSEIAKFSTGCVYHFPNYNYRNDIHQVKRFERTLTRYLTRKLGFEAVLRIRTSRGLALTGFYGNFFVRSPDLLALANVNPDSALAAQVTLEEKLP--QYVCFQSALLYTSSKGDRRIRVHTMCLPTTGDLLQLYNNFDLKATVSYLAKIGVERSMTGSSLADSREALVNAVVDSVGAYQKAVSRGSG-MLVPRVGHLRLFPSYVLAMLK------------HPAFSSSRGIRLDERAGAMLMMRFSPLDQILSDIYPRLYRLNELASMPEDQS---PPALPLSFEHISRGGVYLMITGTIAFVYVASSADPGFLVNVFGTSTYND-IDEYSLLERDNELSRRVHAFFKQV--TQFRFYLGPIITIKEHSPLRDVFVRRLVDDRSE-STHSYVEFLQHLKREI 981          
BLAST of Protein transport protein Sec24C vs. Ensembl Fly
Match: Sec24CD (gene:FBgn0262126 transcript:FBtr0329965)

HSP 1 Score: 667.922 bits (1722), Expect = 0.000e+0
Identity = 346/800 (43.25%), Postives = 518/800 (64.75%), Query Frame = 2
Query:  641 GPQTQSLNPEYMPSAVQVIELDKSNNNAPYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEI-INRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 3037
             PQ + L+P+ MP+ +QV+  ++  +  P+ T     +PPLVTT F+  DQG  +P+++RSS+Y +P   D+LK+  +P  LNI P AK+ E E           GPIRC RCKAYMSP M F+D GRRFQC +C   +EV +  + HLD +G+R+D   RPEL LG+YE +AT +YC+N+T P  PAFIF++DVS+N+VKSGL++L C+ +K+ IL +L  DQ   D  K  VGF+TY+  +HFYN++S++++PQM+V+     D     +PL++GFL  P+E+   I  LME I   F DT+E   +L P I+AG+EALKA+        +F+S+LP+ EAPGKLK RD+R +LGTDKEKT+ +  ++ Y+ L   C + G S+DLF+  +A+ID+AT+  + + TGG ++KY +F     G +L++DI   VS P AFDAVMRVRTS G R  +F G+F+M NT DV LA + + KS+ +EI+H+DKL   E+V +QVA+LYTS SGQRRLRI N++  V+T I D+FK  DLD +M + ++ A       S K+V+D +  RS+QILA YR++    +   +L+LPE LKLLPLYA+ LLK D +              G+D+  D+R+Y    +  MD+  +  +LYPR +P+ N       E   LP+ +R ++     +GAY++ENG+ + +W+GQ  + +++Q+VF      +I + R+++ +    ++  ++ I++ I   RSR+M +  + Q D++ES F+  LVEDRG  G++SYVDFLCH+HKEI+ +
Sbjct:  416 APQARRLDPDQMPNPIQVMIENQRLSGGPFVTNQPGLLPPLVTTKFVVHDQGNSSPRFLRSSLYCIPNTGDLLKTTALPLTLNISPLAKVGEGEMEPPIVNFGEMGPIRCNRCKAYMSPNMQFVDAGRRFQCLMCKVTSEVHQNYYQHLDHTGQRVDKHERPELLLGTYEFLATKDYCRNNTPPEVPAFIFIIDVSYNTVKSGLVHLLCSQIKN-ILKHLPVDQGQ-DKSKVRVGFITYNSTVHFYNIKSSLAQPQMMVV----GDVQEMFMPLLDGFLCHPEESAAVIDALMEEIPRMFADTKETETILYPAIQAGLEALKASNAAGKL-LVFNSTLPIAEAPGKLKNRDDRKLLGTDKEKTVLTPQTTAYNTLGQECVQQGCSVDLFVFNNAYIDLATIGQVSRLTGGEVFKYTYFQADVDGKRLIQDIIKNVSRPIAFDAVMRVRTSAGIRPTEFYGHFFMSNTTDVELASIDATKSISIEIKHDDKLAPEENVYLQVALLYTSCSGQRRLRILNLALRVTTTIADVFKCCDLDAMMLFFAKQACFKLMEHSPKQVKDNLIHRSAQILACYRKHCTSPTSAGQLILPECLKLLPLYASCLLKNDAI------------SGGSDMTLDDRSYVIQFILSMDLNQSVSYLYPRFIPIHNV----VPEETDLPTPVRCTHEKTQEDGAYILENGVHLFVWLGQALSPDFVQSVFGVQGLQQIALERFNI-VPETPLAKRIHGILEQIMKERSRYMRITWLRQNDKLESVFRHFLVEDRGTDGSASYVDFLCHMHKEIKDL 1191          
BLAST of Protein transport protein Sec24C vs. Ensembl Fly
Match: Sec24CD (gene:FBgn0262126 transcript:FBtr0077810)

HSP 1 Score: 667.152 bits (1720), Expect = 0.000e+0
Identity = 346/800 (43.25%), Postives = 518/800 (64.75%), Query Frame = 2
Query:  641 GPQTQSLNPEYMPSAVQVIELDKSNNNAPYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEI-INRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 3037
             PQ + L+P+ MP+ +QV+  ++  +  P+ T     +PPLVTT F+  DQG  +P+++RSS+Y +P   D+LK+  +P  LNI P AK+ E E           GPIRC RCKAYMSP M F+D GRRFQC +C   +EV +  + HLD +G+R+D   RPEL LG+YE +AT +YC+N+T P  PAFIF++DVS+N+VKSGL++L C+ +K+ IL +L  DQ   D  K  VGF+TY+  +HFYN++S++++PQM+V+     D     +PL++GFL  P+E+   I  LME I   F DT+E   +L P I+AG+EALKA+        +F+S+LP+ EAPGKLK RD+R +LGTDKEKT+ +  ++ Y+ L   C + G S+DLF+  +A+ID+AT+  + + TGG ++KY +F     G +L++DI   VS P AFDAVMRVRTS G R  +F G+F+M NT DV LA + + KS+ +EI+H+DKL   E+V +QVA+LYTS SGQRRLRI N++  V+T I D+FK  DLD +M + ++ A       S K+V+D +  RS+QILA YR++    +   +L+LPE LKLLPLYA+ LLK D +              G+D+  D+R+Y    +  MD+  +  +LYPR +P+ N       E   LP+ +R ++     +GAY++ENG+ + +W+GQ  + +++Q+VF      +I + R+++ +    ++  ++ I++ I   RSR+M +  + Q D++ES F+  LVEDRG  G++SYVDFLCH+HKEI+ +
Sbjct:  416 APQARRLDPDQMPNPIQVMIENQRLSGGPFVTNQPGLLPPLVTTKFVVHDQGNSSPRFLRSSLYCIPNTGDLLKTTALPLTLNISPLAKVGEGEMEPPIVNFGEMGPIRCNRCKAYMSPNMQFVDAGRRFQCLMCKVTSEVHQNYYQHLDHTGQRVDKHERPELLLGTYEFLATKDYCRNNTPPEVPAFIFIIDVSYNTVKSGLVHLLCSQIKN-ILKHLPVDQGQ-DKSKVRVGFITYNSTVHFYNIKSSLAQPQMMVV----GDVQEMFMPLLDGFLCHPEESAAVIDALMEEIPRMFADTKETETILYPAIQAGLEALKASNAAGKL-LVFNSTLPIAEAPGKLKNRDDRKLLGTDKEKTVLTPQTTAYNTLGQECVQQGCSVDLFVFNNAYIDLATIGQVSRLTGGEVFKYTYFQADVDGKRLIQDIIKNVSRPIAFDAVMRVRTSAGIRPTEFYGHFFMSNTTDVELASIDATKSISIEIKHDDKLAPEENVYLQVALLYTSCSGQRRLRILNLALRVTTTIADVFKCCDLDAMMLFFAKQACFKLMEHSPKQVKDNLIHRSAQILACYRKHCTSPTSAGQLILPECLKLLPLYASCLLKNDAI------------SGGSDMTLDDRSYVIQFILSMDLNQSVSYLYPRFIPIHNV----VPEETDLPTPVRCTHEKTQEDGAYILENGVHLFVWLGQALSPDFVQSVFGVQGLQQIALERFNI-VPETPLAKRIHGILEQIMKERSRYMRITWLRQNDKLESVFRHFLVEDRGTDGSASYVDFLCHMHKEIKDL 1191          
BLAST of Protein transport protein Sec24C vs. Ensembl Fly
Match: Sec24CD (gene:FBgn0262126 transcript:FBtr0329964)

HSP 1 Score: 667.152 bits (1720), Expect = 0.000e+0
Identity = 346/800 (43.25%), Postives = 518/800 (64.75%), Query Frame = 2
Query:  641 GPQTQSLNPEYMPSAVQVIELDKSNNNAPYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEI-INRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 3037
             PQ + L+P+ MP+ +QV+  ++  +  P+ T     +PPLVTT F+  DQG  +P+++RSS+Y +P   D+LK+  +P  LNI P AK+ E E           GPIRC RCKAYMSP M F+D GRRFQC +C   +EV +  + HLD +G+R+D   RPEL LG+YE +AT +YC+N+T P  PAFIF++DVS+N+VKSGL++L C+ +K+ IL +L  DQ   D  K  VGF+TY+  +HFYN++S++++PQM+V+     D     +PL++GFL  P+E+   I  LME I   F DT+E   +L P I+AG+EALKA+        +F+S+LP+ EAPGKLK RD+R +LGTDKEKT+ +  ++ Y+ L   C + G S+DLF+  +A+ID+AT+  + + TGG ++KY +F     G +L++DI   VS P AFDAVMRVRTS G R  +F G+F+M NT DV LA + + KS+ +EI+H+DKL   E+V +QVA+LYTS SGQRRLRI N++  V+T I D+FK  DLD +M + ++ A       S K+V+D +  RS+QILA YR++    +   +L+LPE LKLLPLYA+ LLK D +              G+D+  D+R+Y    +  MD+  +  +LYPR +P+ N       E   LP+ +R ++     +GAY++ENG+ + +W+GQ  + +++Q+VF      +I + R+++ +    ++  ++ I++ I   RSR+M +  + Q D++ES F+  LVEDRG  G++SYVDFLCH+HKEI+ +
Sbjct:  416 APQARRLDPDQMPNPIQVMIENQRLSGGPFVTNQPGLLPPLVTTKFVVHDQGNSSPRFLRSSLYCIPNTGDLLKTTALPLTLNISPLAKVGEGEMEPPIVNFGEMGPIRCNRCKAYMSPNMQFVDAGRRFQCLMCKVTSEVHQNYYQHLDHTGQRVDKHERPELLLGTYEFLATKDYCRNNTPPEVPAFIFIIDVSYNTVKSGLVHLLCSQIKN-ILKHLPVDQGQ-DKSKVRVGFITYNSTVHFYNIKSSLAQPQMMVV----GDVQEMFMPLLDGFLCHPEESAAVIDALMEEIPRMFADTKETETILYPAIQAGLEALKASNAAGKL-LVFNSTLPIAEAPGKLKNRDDRKLLGTDKEKTVLTPQTTAYNTLGQECVQQGCSVDLFVFNNAYIDLATIGQVSRLTGGEVFKYTYFQADVDGKRLIQDIIKNVSRPIAFDAVMRVRTSAGIRPTEFYGHFFMSNTTDVELASIDATKSISIEIKHDDKLAPEENVYLQVALLYTSCSGQRRLRILNLALRVTTTIADVFKCCDLDAMMLFFAKQACFKLMEHSPKQVKDNLIHRSAQILACYRKHCTSPTSAGQLILPECLKLLPLYASCLLKNDAI------------SGGSDMTLDDRSYVIQFILSMDLNQSVSYLYPRFIPIHNV----VPEETDLPTPVRCTHEKTQEDGAYILENGVHLFVWLGQALSPDFVQSVFGVQGLQQIALERFNI-VPETPLAKRIHGILEQIMKERSRYMRITWLRQNDKLESVFRHFLVEDRGTDGSASYVDFLCHMHKEIKDL 1191          
BLAST of Protein transport protein Sec24C vs. Ensembl Fly
Match: Sec24AB (gene:FBgn0033460 transcript:FBtr0339407)

HSP 1 Score: 213.001 bits (541), Expect = 4.546e-56
Identity = 174/763 (22.80%), Postives = 358/763 (46.92%), Query Frame = 2
Query:  800 CNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSN-HGTKLLKD-IQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPS----------------AIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINR-YSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIR 3031
            C+P  +R ++  +P +  +L+   +P  + I PF  ++     I C  +     +RC  C+ Y++P + F+D  + ++CN+C    E+ ++ F     +    D   RPE+   + E +A +EY      P P  ++F+ DVS  + +SG L   C  L  H+      D++ P   +  VGF+ +D  +HFY++   +++P  + +  LD ++    +P  +  LV+  E  E +  L++ +   F  T +    LG  ++   + ++A+GGR     +F S LP  + PG L+ R++     + K+    +  + +Y + A  CS   ++ DLFL    + D+AT+S + K +GG ++ +  +  +  H  +  +   +  ++    F+AVMR+R + G +   F GNF++++T+ ++L  V+ D    ++I + + L + +++  Q A+LYT+  G+RR+R+H +   V+ ++ ++    D + ++  +S+ AV    A ++ + RD     +  +  +++     Q+ P+                            + +       GT    D+R Y    M  + +     ++YP L   I+A   + A + ++ S                 ++ S  +L S   +L++ G  I++++G N   + L+ V   SS +E+ +  Y LP   +N +  + R +  +   +    ++ I+      +  F + L +DR E  + SY +FL HI  +++
Sbjct:  440 CSPSIMRCTLTKIPESNSLLQKSRLPLGIVIHPFRDVNSLPV-IQCINI-----VRCRLCRTYINPFVYFVDS-KMWKCNLCYRVNELPDD-FQFDPATKTYGDVTRRPEVRSSTIEFIAPSEYMLRP--PQPAMYLFLFDVSIIAQQSGYLEAACAVLNRHL------DEM-PGDARTQVGFICFDSFVHFYSMAEGLNQPHEMTL--LDIED--PFLPRPDSLLVNLKECKELVRDLLKQLPKRFAHTHDPGSALGAALQVAFKLMQASGGRIT---VFQSCLPN-KGPGALEPREDPNNR-SAKDVAHLNPATDFYKRFALECSGYQIACDLFLMNQQYSDMATISGISKHSGGCVHHFPLYQKTKPHMVESFRSCFKRYLTRKIGFEAVMRIRCTRGLQVHTFHGNFFVRSTDLLSLPNVNPDAGYGMQISYEESLTDAKTICFQAALLYTNSEGERRIRVHTVCLPVTASLPEVMHSADTEAIIGLLSKMAVDRSVASNLSDARDAFINATIDVYNAFK---IAQNLPSGQSGQLIAPRSLALLPL--------YILALLKHPAFRVGTSTRLDDRVYAMDCMKTLPLDQLMKYVYPELY-KIDALI-YHARNSNISSNQDDDEDEDEPLPELPRLQLSAEHLDSRSIFLMDCGTLIMIYVGLNVPPDVLEAVLGISSTAELGDYVYGLPNVVSNENDVLKRFILRLNYDKPYSALVQIIRDTSTAKGQFTERLTDDRSE-SSLSYYEFLQHIRAQVK 1162          
BLAST of Protein transport protein Sec24C vs. Ensembl Fly
Match: Sec24AB (gene:FBgn0033460 transcript:FBtr0088451)

HSP 1 Score: 213.001 bits (541), Expect = 5.502e-56
Identity = 174/763 (22.80%), Postives = 358/763 (46.92%), Query Frame = 2
Query:  800 CNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSN-HGTKLLKD-IQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPS----------------AIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINR-YSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIR 3031
            C+P  +R ++  +P +  +L+   +P  + I PF  ++     I C  +     +RC  C+ Y++P + F+D  + ++CN+C    E+ ++ F     +    D   RPE+   + E +A +EY      P P  ++F+ DVS  + +SG L   C  L  H+      D++ P   +  VGF+ +D  +HFY++   +++P  + +  LD ++    +P  +  LV+  E  E +  L++ +   F  T +    LG  ++   + ++A+GGR     +F S LP  + PG L+ R++     + K+    +  + +Y + A  CS   ++ DLFL    + D+AT+S + K +GG ++ +  +  +  H  +  +   +  ++    F+AVMR+R + G +   F GNF++++T+ ++L  V+ D    ++I + + L + +++  Q A+LYT+  G+RR+R+H +   V+ ++ ++    D + ++  +S+ AV    A ++ + RD     +  +  +++     Q+ P+                            + +       GT    D+R Y    M  + +     ++YP L   I+A   + A + ++ S                 ++ S  +L S   +L++ G  I++++G N   + L+ V   SS +E+ +  Y LP   +N +  + R +  +   +    ++ I+      +  F + L +DR E  + SY +FL HI  +++
Sbjct:  462 CSPSIMRCTLTKIPESNSLLQKSRLPLGIVIHPFRDVNSLP-VIQCINI-----VRCRLCRTYINPFVYFVDS-KMWKCNLCYRVNELPDD-FQFDPATKTYGDVTRRPEVRSSTIEFIAPSEYMLRP--PQPAMYLFLFDVSIIAQQSGYLEAACAVLNRHL------DEM-PGDARTQVGFICFDSFVHFYSMAEGLNQPHEMTL--LDIED--PFLPRPDSLLVNLKECKELVRDLLKQLPKRFAHTHDPGSALGAALQVAFKLMQASGGRIT---VFQSCLPN-KGPGALEPREDPNNR-SAKDVAHLNPATDFYKRFALECSGYQIACDLFLMNQQYSDMATISGISKHSGGCVHHFPLYQKTKPHMVESFRSCFKRYLTRKIGFEAVMRIRCTRGLQVHTFHGNFFVRSTDLLSLPNVNPDAGYGMQISYEESLTDAKTICFQAALLYTNSEGERRIRVHTVCLPVTASLPEVMHSADTEAIIGLLSKMAVDRSVASNLSDARDAFINATIDVYNAFK---IAQNLPSGQSGQLIAPRSLALLPL--------YILALLKHPAFRVGTSTRLDDRVYAMDCMKTLPLDQLMKYVYPELY-KIDALI-YHARNSNISSNQDDDEDEDEPLPELPRLQLSAEHLDSRSIFLMDCGTLIMIYVGLNVPPDVLEAVLGISSTAELGDYVYGLPNVVSNENDVLKRFILRLNYDKPYSALVQIIRDTSTAKGQFTERLTDDRSE-SSLSYYEFLQHIRAQVK 1184          
BLAST of Protein transport protein Sec24C vs. Ensembl Zebrafish
Match: sec24c (SEC24 homolog C, COPII coat complex component [Source:ZFIN;Acc:ZDB-GENE-030131-4487])

HSP 1 Score: 714.916 bits (1844), Expect = 0.000e+0
Identity = 378/796 (47.49%), Postives = 514/796 (64.57%), Query Frame = 2
Query:  659 LNPEYMPSAVQVIELDKSNNNA-PYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPL-VGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEI-INRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 3037
            L+P+ +PS +QVIE DK+N  + P+ TG R + PPLVTT F   DQG  +P+YIR + Y +P   DM K   +P    I P A L   E      +    GPIRC RCKAYM P M FI+GGRRFQC  C   TEV    F HLD +G+R+DC+ RPEL +GSYE MAT +YCKN+  P PPAFIF++DVS+N+VK+G++ + C  LK  ++ YL  +   PD    + VGFVTY++VLHFYN+++++++PQMLV+S    D     VPL++GFLV+  E+   I  L++ I + F DT E   V GPVI+AG+EALKAA       FIFHSSLP+ EAPGKLK R+++ ++GTDKEK+LF    S+Y+ LA  C   G  +DLFL P+ ++DVATL  +P  TGG++YKY +F  S+   + L D++  V     FDAVMRVRTS G R  DF G+FYM NT DV LA +  DK+V VE RH+DKL E     +Q AVLYTS SGQRRLR+HN++ N  + + D+++  + DT++N+  + A ++  +   K VRD +  + +QILA YR+N A  S   +L+LPE +KLLP+Y N +LK D +Q             G D++ D+RAY   L++ MDV  + VF YPRLLPL     +  AES  LP A+RDS   LS  G YL+ENG++I +W+G NA +E LQN+F   + S+I  +  SLP  +N  S  +  I++ IR+ RSR+M L +V Q D++E  FK  LVED+   G +SYVDFLCH+HKEIR +
Sbjct:  475 LDPDSIPSPIQVIEDDKANKGSQPFTTGVRGQAPPLVTTRFQVKDQGNASPRYIRCTAYNMPCNSDMAKQSQVPLAAVIKPLATLPPDESPPYLVDHGESGPIRCNRCKAYMCPFMQFIEGGRRFQCGFCSCVTEVPPHYFQHLDHTGKRVDCYERPELSMGSYEFMATVDYCKNNKFPQPPAFIFLIDVSYNAVKNGMVGMVCQELKT-LMDYLPREN--PDVESNVRVGFVTYNKVLHFYNVKASLAQPQMLVVS----DVADMFVPLLDGFLVNVSESRVVIESLLDQIPEMFADTRETETVFGPVIQAGLEALKAADCAGKL-FIFHSSLPIAEAPGKLKNREDKKLVGTDKEKSLFQPQVSFYNTLAKDCVAQGCCVDLFLFPNQYVDVATLGVVPTSTGGSIYKYTYFQASSDQERFLNDLRRDVQKQMGFDAVMRVRTSTGIRATDFFGSFYMSNTTDVELAGLDCDKTVTVEFRHDDKLSEETGALMQCAVLYTSCSGQRRLRVHNMAVNCCSQLADLYRNCETDTIINFFVKYAYRSVLSSPTKNVRDSLVNQCAQILACYRKNCASPSSAGQLILPECMKLLPVYLNCVLKSDVLQ------------PGADVSLDDRAYLRQLVSAMDVAESHVFFYPRLLPL----QKLDAESTSLPLAVRDSEERLSRGGVYLLENGLNIFIWVGVNAQQELLQNIFGTPAFSQIDPSMTSLPALDNPFSKRLKEIIESIRAQRSRYMKLMVVKQEDKLELIFKHFLVEDKSNNGGASYVDFLCHMHKEIRQL 1246          
BLAST of Protein transport protein Sec24C vs. Ensembl Zebrafish
Match: sec24c (SEC24 homolog C, COPII coat complex component [Source:ZFIN;Acc:ZDB-GENE-030131-4487])

HSP 1 Score: 714.146 bits (1842), Expect = 0.000e+0
Identity = 377/796 (47.36%), Postives = 514/796 (64.57%), Query Frame = 2
Query:  659 LNPEYMPSAVQVIELDKSNNNA-PYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPL-VGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEI-INRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 3037
            ++P+ +PS +QVIE DK+N  + P+ TG R + PPLVTT F   DQG  +P+YIR + Y +P   DM K   +P    I P A L   E      +    GPIRC RCKAYM P M FI+GGRRFQC  C   TEV    F HLD +G+R+DC+ RPEL +GSYE MAT +YCKN+  P PPAFIF++DVS+N+VK+G++ + C  LK  ++ YL  +   PD    + VGFVTY++VLHFYN+++++++PQMLV+S    D     VPL++GFLV+  E+   I  L++ I + F DT E   V GPVI+AG+EALKAA       FIFHSSLP+ EAPGKLK R+++ ++GTDKEK+LF    S+Y+ LA  C   G  +DLFL P+ ++DVATL  +P  TGG++YKY +F  S+   + L D++  V     FDAVMRVRTS G R  DF G+FYM NT DV LA +  DK+V VE RH+DKL E     +Q AVLYTS SGQRRLR+HN++ N  + + D+++  + DT++N+  + A ++  +   K VRD +  + +QILA YR+N A  S   +L+LPE +KLLP+Y N +LK D +Q             G D++ D+RAY   L++ MDV  + VF YPRLLPL     +  AES  LP A+RDS   LS  G YL+ENG++I +W+G NA +E LQN+F   + S+I  +  SLP  +N  S  +  I++ IR+ RSR+M L +V Q D++E  FK  LVED+   G +SYVDFLCH+HKEIR +
Sbjct:  527 IDPDAIPSPIQVIEDDKANKGSQPFTTGVRGQAPPLVTTRFQVKDQGNASPRYIRCTAYNMPCNSDMAKQSQVPLAAVIKPLATLPPDESPPYLVDHGESGPIRCNRCKAYMCPFMQFIEGGRRFQCGFCSCVTEVPPHYFQHLDHTGKRVDCYERPELSMGSYEFMATVDYCKNNKFPQPPAFIFLIDVSYNAVKNGMVGMVCQELKT-LMDYLPREN--PDVESNVRVGFVTYNKVLHFYNVKASLAQPQMLVVS----DVADMFVPLLDGFLVNVSESRVVIESLLDQIPEMFADTRETETVFGPVIQAGLEALKAADCAGKL-FIFHSSLPIAEAPGKLKNREDKKLVGTDKEKSLFQPQVSFYNTLAKDCVAQGCCVDLFLFPNQYVDVATLGVVPTSTGGSIYKYTYFQASSDQERFLNDLRRDVQKQMGFDAVMRVRTSTGIRATDFFGSFYMSNTTDVELAGLDCDKTVTVEFRHDDKLSEETGALMQCAVLYTSCSGQRRLRVHNMAVNCCSQLADLYRNCETDTIINFFVKYAYRSVLSSPTKNVRDSLVNQCAQILACYRKNCASPSSAGQLILPECMKLLPVYLNCVLKSDVLQ------------PGADVSLDDRAYLRQLVSAMDVAESHVFFYPRLLPL----QKLDAESTSLPLAVRDSEERLSRGGVYLLENGLNIFIWVGVNAQQELLQNIFGTPAFSQIDPSMTSLPALDNPFSKRLKEIIESIRAQRSRYMKLMVVKQEDKLELIFKHFLVEDKSNNGGASYVDFLCHMHKEIRQL 1298          
BLAST of Protein transport protein Sec24C vs. Ensembl Zebrafish
Match: sec24d (SEC24 homolog D, COPII coat complex component [Source:ZFIN;Acc:ZDB-GENE-070117-2501])

HSP 1 Score: 665.226 bits (1715), Expect = 0.000e+0
Identity = 351/801 (43.82%), Postives = 502/801 (62.67%), Query Frame = 2
Query:  641 GPQTQSLNPEYMPSAVQVIELDKSNNNAP-YPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEI-INRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 3037
            GP  + L+P+ +PS  Q+I  D++      Y T  R +VPPLVTT+F   DQG  +P+++R + Y+ P   D+ K   +P    I PFA + + E  +        GPIRC RCKAYM P M FIDGGRRFQC+ C    EV    F HLD  GRR+D + RPEL LGSYE  AT +YCKN+  PNPPA+IFM+DVS+N++KSGL+ L C  LK  +L  L  ++   +S    VGFVTY+++LHFYN++S +++PQM+V+S    D     VPL++GFLV+  E+   I+ L++ I D F DT E   V  PV++AG+EALKAA       FIFHSS+P  EAPGKLK RD++ ++GT+KEKTLF      Y +L   C   G  +DLFL P+ ++D+AT+ D+P  TGG++YKY  F    +G + L D+   V     FDA+MRVRT  G R  DF G  YM NT DV +A V  DK+V VE +H+D L E     +Q A+LYT+I GQRRLRIHN+S N S+ + +++K  + D L+N+ +++A +    + +K VR+ +  +++ +LA YR+N A  S  ++L+LP+ +K+ P+Y NSLLK   + S             T+L+TD+RA+  F++N M V+ TQV LYPRL+PL          S+ LP+A+R S   L+  G +L+ENG+S+ LW+GQ  + + +QN+F+  S   +     SLP+ +N  S +++ I+  I   R+  M L IV Q DR E +F++LLVED+G  G +SY+DFLC +H+EIR +
Sbjct:  251 GPPQKKLDPDSIPSTTQMIADDQAKRGGQVYVTNIRGQVPPLVTTNFTVQDQGNASPRFMRCTTYSFPCTADLAKQCKVPLAAIIKPFATVPKNETPLYVVNHGETGPIRCNRCKAYMCPYMQFIDGGRRFQCSFCSCVNEVPVHYFQHLDHMGRRMDLYERPELSLGSYEFAATLDYCKNNKPPNPPAYIFMIDVSYNNIKSGLVRLICEELKT-LLDRLPKEEGA-ESSSIKVGFVTYNKILHFYNVKSALAQPQMMVVS----DTAEMFVPLLDGFLVNFQESRAVINNLLDQIPDMFADTNESETVFAPVVQAGLEALKAAECSGKL-FIFHSSIPTAEAPGKLKNRDDKKLVGTEKEKTLFQPQRGVYEQLTKDCVAQGCCVDLFLFPNQYVDIATMGDVPSHTGGSIYKYSNFQVEVNGQQFLSDLSRDVEKSIGFDAIMRVRTGTGFRATDFFGAVYMNNTTDVEMAAVDCDKAVTVEFKHDDTLSEESGAVMQCALLYTTIGGQRRLRIHNLSLNCSSQLSELYKSCETDALINFFAKSAYRAMLNQPMKTVREILVNQTAHMLACYRKNCASPSAVSQLILPDAMKVFPVYMNSLLKTPALVSS------------TELSTDDRAFHRFMVNAMGVEETQVLLYPRLIPL----HTMDVSSESLPAAVRCSEERLNESGMFLLENGLSMFLWLGQACSPDLIQNLFNVPSFGHLPAEGTSLPVLDNPHSRKLHSIISRISQQRAASMKLLIVKQKDRAEMSFRQLLVEDKGLHGGASYMDFLCFVHREIRQL 1028          
BLAST of Protein transport protein Sec24C vs. Ensembl Zebrafish
Match: sec24a (SEC24 homolog A, COPII coat complex component [Source:ZFIN;Acc:ZDB-GENE-120926-1])

HSP 1 Score: 303.138 bits (775), Expect = 3.491e-86
Identity = 226/801 (28.21%), Postives = 401/801 (50.06%), Query Frame = 2
Query:  671 YMPSAVQVIELDKSNNNAPYPTGTRDKVPPL--VTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNH-------GTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLAT--DERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHL----PSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEI-INRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKE 3025
            + P A++V+ L +  N  P+   T    PPL  +  D   + +  C+P+  R ++ ++P    +L    +P  L + PF  L +         +     +RC  C+ Y++P +TF+ G  R++CN+C    EV EE F +   S        RPE+   + E +A +EY      P P  ++F+LDVSHN+V++G L+  C +L D++         +P   +  +GF+T+D  +HFY+LQ  +S+PQML++S +D+      +P  +G LV+ +E  E +  L+ ++   ++ T E +  LGP ++A  + L A GGR     +F + LP +   G LK R++ +     K+    S  + +Y KLA  CS   V++DLFL  + + D+++L  + + + G+++ Y    PS H         +  KD++  ++    F+AVMR+R + G     F GNF++++T+ ++LA V+ D    V++   + L + ++V+ Q A+LYTS  G+RR+R+H +   V  ++ DIF   D+  +   ++  AV      SV + RD +   +  +L+SYR +     +P  L+ P  L+L PLY  +LLK               +  GT  AT  DER +    +    + +  + ++P L  + +   E +          P   + S   LS + A+L++ G  + LWIG+N N  +L  V      + I +N   LP  +   S  +   V  +R  R    +L+++     +++ F +L++EDR E    SY +FL H+ ++
Sbjct:  345 HTPEALRVLNLLQERNLLPHTAVT----PPLPCLPQD---LQRMNCSPEVFRCTLTSIPQTQALLNKAKLPLGLLLHPFKDLSQLP------VVTSSNIVRCRSCRTYINPFVTFV-GPTRWKCNLCHRINEVPEE-FMYNPVSKSYGAPHKRPEVQNATIEFIAPSEYMLRP--PQPAVYLFVLDVSHNAVETGYLDAVCRSLLDNL-------SSLPGDARTKIGFITFDSTIHFYSLQEGLSRPQMLIVSDIDDV----FLPTQDGLLVNLNECKELVQDLLSSLPQMWRQTMETHSALGPALQAAFKLLSATGGRIS---LFQTQLPTLGI-GALKPREQPSTKTQAKDIQHLSPATDFYKKLALDCSGQHVAVDLFLLSAQYCDLSSLGCISRYSAGSVFYY----PSYHTLHNPAQAERFQKDLKRYLTRKIGFEAVMRIRCTKGLSIHTFHGNFFVRSTDLLSLANVNPDAGFAVQMNIEENLLDLQTVSFQAALLYTSSKGERRIRVHTLCLPVVNSLSDIFAGADVQAITALLASMAVDRSVTASVSDARDALVNAAVDMLSSYRSSVLTVPQPG-LLAPACLRLFPLYILALLK--------------HKAFGTSSATRLDERMFCMCQLKQQPLAYAMLSIHPSLYRVDDLTDEGALNVNDCTIPQPRVQQLSVEKLSRDAAFLMDCGSVLYLWIGRNCNPAFLTQVLGVDGYANIPLNMTQLPELDTAESCRMRAFVDWLRERRPFHPLLHVIRDESPLKAEFLQLMIEDRSESA-LSYYEFLLHLQQQ 1093          
BLAST of Protein transport protein Sec24C vs. Ensembl Zebrafish
Match: sec24b (SEC24 homolog B, COPII coat complex component [Source:ZFIN;Acc:ZDB-GENE-030131-6565])

HSP 1 Score: 295.049 bits (754), Expect = 4.385e-83
Identity = 213/758 (28.10%), Postives = 380/758 (50.13%), Query Frame = 2
Query:  800 CNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGT----KLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHL-------PSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFD----CSSPSEIINRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEI 3028
            C+P   R ++  +P    +L    +P  L + PF  L +    I    +     +RC  C+ Y++P ++F+D  RR++CN+C    +V +E F +   +    +   RPE+   + E +A+++Y      P P  ++F+LDVSHN+V+SG LN+FC +L D++      D+L P   +  +GFVT+D  +HFYNLQ  +S+PQMLV+S +++      +P  +  LV+  E+ E +  L+  +   F  T E    LGP ++A  + +   GGR     +F + LP + A G L++R++  +  + K     +  + +Y KLA  CS   + +DLFL  S + D+A+L+ + K + G+++ Y  F    H T    KL +D+Q  +S    F+AVMR+R + G     F GNF++++T+ ++LA V+ D    V++   + L +      Q A+LYTS  G+RR+R+H +   V + + ++F   D+  +   ++  A+    + S+ + RD +       L++YR N     +P+ L+ P  L+L PLY  +LLK            ++   +GT    DER +         +      ++P L  + N   +    + HL       P  ++ +   L+ EGA+L++ G  + LW+G+  N  ++++V       S PS +     +P      S      +  +  +R+     ++V      +S+F + LVEDR E    SY +FL H+ +++
Sbjct:  434 CSPDTFRCTLTNIPQTQALLNKARLPLGLLLHPFRDLTQLP-VITSNTI-----VRCRSCRTYINPFVSFLDQ-RRWKCNLCYRVNDVPDE-FMYNPVTRSYGEPHKRPEVQNSTVEFIASSDYMLRP--PQPAVYLFVLDVSHNAVESGYLNVFCQSLLDNL------DKL-PGDTRTRIGFVTFDSTIHFYNLQEGLSQPQMLVVSDIEDV----FIPTHDSLLVNLKESKELVKDLLNALPGMFSQTRETQSALGPALQAAYKLMCPTGGRVS---VFQTQLPTLGA-GLLQSREDPNLRSSTKTVQHLAPATDFYKKLALDCSGQQIGVDLFLLSSQYSDLASLACVSKYSAGSVFYYPSFH-HIHNTAQRQKLQRDLQRYLSRKIGFEAVMRIRCTKGLSIHTFHGNFFVRSTDLLSLANVNPDSGFAVQMSIEESLADTSLACFQAALLYTSSKGKRRIRVHTLCLPVVSQLSEVFAGADIQAITCLLANMAIDRSVSSSLSDARDALVNAVVDCLSAYRAN-GSNIQPSGLIAPAALRLFPLYVLALLK------------QKALRTGTSTRLDERVFSMCEFKSQPLHQIMRMVHPDLYRIDNMTEQ---GALHLNDSVVPQPPLLQLTAEKLTREGAFLMDCGSVMYLWVGKCCNEMFIRDVLGFPNYASLPSSMTE---IPELQTTYSERTRAFISWLLESRTFHPAFHVVKDDAPAKSSFFQHLVEDRTESA-FSYYEFLLHVQQQM 1145          
BLAST of Protein transport protein Sec24C vs. Ensembl Xenopus
Match: slc34a2 (solute carrier family 34 member 2 [Source:Xenbase;Acc:XB-GENE-483740])

HSP 1 Score: 693.73 bits (1789), Expect = 0.000e+0
Identity = 370/795 (46.54%), Postives = 512/795 (64.40%), Query Frame = 2
Query:  659 LNPEYMPSAVQVIELDKSNNNA-PYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINRYS-LPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 3037
            L+P+ +PS +QVIE DK+N  + P+ TG R +VPPL+TT+ +  DQG  +P+YIR + Y  PA+ DM K   +P    I P A L   E      +    GPIRC RCKAYM P M FI+GGRRFQC  C   TEV    F HLD +GRR+DC+ RPEL +GSYE  AT +YCKN+  PNPPAFIFM+DVS+N+VKSGL+ L C  LK  ++ YL  +  + +S    VGFVTY++VLHFYN++S++++PQM+V+S    D     VPL++GFLV+ +E+   I+ L++ I + F DT E   V  PVI+AG+EALKAA       FIFH++LP+ EAPGKLK RD++ ++ TDKEK LF   +++Y+ L+  C   G  +DLFL P+ F+DVATL  +P  TGG++YKY FF P     + L D++  V     FDAVMRVRTS G R  DF G FYM NT DV LA +  DK++ VE +H+DKL E+    +Q A+LYTS  GQRRLR+HN++ N  T + D+++  + DTL+N+ ++ A +   +   K VRD +  + +QILA YR+N A  S   +L+LPE +KLLP+Y N +LK D +Q             G ++  D+R Y   L++ MDV  + VF YPRLLPL    S+    +  LP AIR S   LS    YL+ENG+++ +W+G N  +  +QN+F+ SS S+I +  S LP+ +N +S ++  I+ + R+ R R+M L IV Q D++E  FK LLVED+   G +SYVDFLCH+HKEIR +
Sbjct:  388 LDPDSIPSPIQVIEDDKNNRGSEPFITGQRGQVPPLITTNVLVKDQGNTSPRYIRCTSYNFPASSDMAKQSQVPLAAVIKPLATLPPDELPPFLVDHGETGPIRCNRCKAYMCPFMQFIEGGRRFQCCFCSCVTEVPTHYFQHLDHTGRRVDCYERPELSMGSYEFTATVDYCKNNKTPNPPAFIFMIDVSYNAVKSGLVALVCEELK-QLVDYLPREGSMEES-VIRVGFVTYNKVLHFYNVKSSLAQPQMMVVS----DVSDMFVPLLDGFLVNVNESRTVINSLLDQIPELFADTRETETVFAPVIQAGLEALKAADCAGKL-FIFHTTLPIAEAPGKLKNRDDKKLVNTDKEKILFQPQTNFYNNLSKDCVAQGCCVDLFLFPNQFLDVATLGVVPFQTGGSVYKYTFFQPETDKERFLNDLRRDVQKEIGFDAVMRVRTSTGIRATDFFGAFYMSNTTDVELAGLDCDKTITVEFKHDDKLNEDTGALLQCAILYTSCGGQRRLRVHNMALNCCTQLADLYRNCETDTLINYFAKFAFRGVLSNPTKTVRDTLINQCAQILACYRKNCASPSSAGQLILPECMKLLPVYLNCVLKSDVLQ------------PGAEMTIDDRTYIRQLVSSMDVADSNVFFYPRLLPL----SKMDPSNDSLPVAIRSSEERLSKGEMYLLENGLNLFVWVGANIQQSLIQNLFNVSSFSQIDSSMSALPVLDNPISNKIRGIITMFRAQRPRYMKLIIVKQDDKIEMLFKHLLVEDKNLNGGASYVDFLCHMHKEIRQL 1159          
BLAST of Protein transport protein Sec24C vs. Ensembl Xenopus
Match: slc34a2 (solute carrier family 34 member 2 [Source:Xenbase;Acc:XB-GENE-483740])

HSP 1 Score: 692.96 bits (1787), Expect = 0.000e+0
Identity = 369/795 (46.42%), Postives = 512/795 (64.40%), Query Frame = 2
Query:  659 LNPEYMPSAVQVIELDKSNNNA-PYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINRYS-LPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 3037
            ++P+ +PS +QVIE DK+N  + P+ TG R +VPPL+TT+ +  DQG  +P+YIR + Y  PA+ DM K   +P    I P A L   E      +    GPIRC RCKAYM P M FI+GGRRFQC  C   TEV    F HLD +GRR+DC+ RPEL +GSYE  AT +YCKN+  PNPPAFIFM+DVS+N+VKSGL+ L C  LK  ++ YL  +  + +S    VGFVTY++VLHFYN++S++++PQM+V+S    D     VPL++GFLV+ +E+   I+ L++ I + F DT E   V  PVI+AG+EALKAA       FIFH++LP+ EAPGKLK RD++ ++ TDKEK LF   +++Y+ L+  C   G  +DLFL P+ F+DVATL  +P  TGG++YKY FF P     + L D++  V     FDAVMRVRTS G R  DF G FYM NT DV LA +  DK++ VE +H+DKL E+    +Q A+LYTS  GQRRLR+HN++ N  T + D+++  + DTL+N+ ++ A +   +   K VRD +  + +QILA YR+N A  S   +L+LPE +KLLP+Y N +LK D +Q             G ++  D+R Y   L++ MDV  + VF YPRLLPL    S+    +  LP AIR S   LS    YL+ENG+++ +W+G N  +  +QN+F+ SS S+I +  S LP+ +N +S ++  I+ + R+ R R+M L IV Q D++E  FK LLVED+   G +SYVDFLCH+HKEIR +
Sbjct:  381 IDPDAIPSPIQVIEDDKNNRGSEPFITGQRGQVPPLITTNVLVKDQGNTSPRYIRCTSYNFPASSDMAKQSQVPLAAVIKPLATLPPDELPPFLVDHGETGPIRCNRCKAYMCPFMQFIEGGRRFQCCFCSCVTEVPTHYFQHLDHTGRRVDCYERPELSMGSYEFTATVDYCKNNKTPNPPAFIFMIDVSYNAVKSGLVALVCEELK-QLVDYLPREGSMEESVI-RVGFVTYNKVLHFYNVKSSLAQPQMMVVS----DVSDMFVPLLDGFLVNVNESRTVINSLLDQIPELFADTRETETVFAPVIQAGLEALKAADCAGKL-FIFHTTLPIAEAPGKLKNRDDKKLVNTDKEKILFQPQTNFYNNLSKDCVAQGCCVDLFLFPNQFLDVATLGVVPFQTGGSVYKYTFFQPETDKERFLNDLRRDVQKEIGFDAVMRVRTSTGIRATDFFGAFYMSNTTDVELAGLDCDKTITVEFKHDDKLNEDTGALLQCAILYTSCGGQRRLRVHNMALNCCTQLADLYRNCETDTLINYFAKFAFRGVLSNPTKTVRDTLINQCAQILACYRKNCASPSSAGQLILPECMKLLPVYLNCVLKSDVLQ------------PGAEMTIDDRTYIRQLVSSMDVADSNVFFYPRLLPL----SKMDPSNDSLPVAIRSSEERLSKGEMYLLENGLNLFVWVGANIQQSLIQNLFNVSSFSQIDSSMSALPVLDNPISNKIRGIITMFRAQRPRYMKLIIVKQDDKIEMLFKHLLVEDKNLNGGASYVDFLCHMHKEIRQL 1152          
BLAST of Protein transport protein Sec24C vs. Ensembl Xenopus
Match: slc34a2 (solute carrier family 34 member 2 [Source:Xenbase;Acc:XB-GENE-483740])

HSP 1 Score: 692.96 bits (1787), Expect = 0.000e+0
Identity = 369/795 (46.42%), Postives = 512/795 (64.40%), Query Frame = 2
Query:  659 LNPEYMPSAVQVIELDKSNNNA-PYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINRYS-LPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 3037
            ++P+ +PS +QVIE DK+N  + P+ TG R +VPPL+TT+ +  DQG  +P+YIR + Y  PA+ DM K   +P    I P A L   E      +    GPIRC RCKAYM P M FI+GGRRFQC  C   TEV    F HLD +GRR+DC+ RPEL +GSYE  AT +YCKN+  PNPPAFIFM+DVS+N+VKSGL+ L C  LK  ++ YL  +  + +S    VGFVTY++VLHFYN++S++++PQM+V+S    D     VPL++GFLV+ +E+   I+ L++ I + F DT E   V  PVI+AG+EALKAA       FIFH++LP+ EAPGKLK RD++ ++ TDKEK LF   +++Y+ L+  C   G  +DLFL P+ F+DVATL  +P  TGG++YKY FF P     + L D++  V     FDAVMRVRTS G R  DF G FYM NT DV LA +  DK++ VE +H+DKL E+    +Q A+LYTS  GQRRLR+HN++ N  T + D+++  + DTL+N+ ++ A +   +   K VRD +  + +QILA YR+N A  S   +L+LPE +KLLP+Y N +LK D +Q             G ++  D+R Y   L++ MDV  + VF YPRLLPL    S+    +  LP AIR S   LS    YL+ENG+++ +W+G N  +  +QN+F+ SS S+I +  S LP+ +N +S ++  I+ + R+ R R+M L IV Q D++E  FK LLVED+   G +SYVDFLCH+HKEIR +
Sbjct:  411 IDPDAIPSPIQVIEDDKNNRGSEPFITGQRGQVPPLITTNVLVKDQGNTSPRYIRCTSYNFPASSDMAKQSQVPLAAVIKPLATLPPDELPPFLVDHGETGPIRCNRCKAYMCPFMQFIEGGRRFQCCFCSCVTEVPTHYFQHLDHTGRRVDCYERPELSMGSYEFTATVDYCKNNKTPNPPAFIFMIDVSYNAVKSGLVALVCEELK-QLVDYLPREGSMEES-VIRVGFVTYNKVLHFYNVKSSLAQPQMMVVS----DVSDMFVPLLDGFLVNVNESRTVINSLLDQIPELFADTRETETVFAPVIQAGLEALKAADCAGKL-FIFHTTLPIAEAPGKLKNRDDKKLVNTDKEKILFQPQTNFYNNLSKDCVAQGCCVDLFLFPNQFLDVATLGVVPFQTGGSVYKYTFFQPETDKERFLNDLRRDVQKEIGFDAVMRVRTSTGIRATDFFGAFYMSNTTDVELAGLDCDKTITVEFKHDDKLNEDTGALLQCAILYTSCGGQRRLRVHNMALNCCTQLADLYRNCETDTLINYFAKFAFRGVLSNPTKTVRDTLINQCAQILACYRKNCASPSSAGQLILPECMKLLPVYLNCVLKSDVLQ------------PGAEMTIDDRTYIRQLVSSMDVADSNVFFYPRLLPL----SKMDPSNDSLPVAIRSSEERLSKGEMYLLENGLNLFVWVGANIQQSLIQNLFNVSSFSQIDSSMSALPVLDNPISNKIRGIITMFRAQRPRYMKLIIVKQDDKIEMLFKHLLVEDKNLNGGASYVDFLCHMHKEIRQL 1182          
BLAST of Protein transport protein Sec24C vs. Ensembl Xenopus
Match: slc34a2 (solute carrier family 34 member 2 [Source:Xenbase;Acc:XB-GENE-483740])

HSP 1 Score: 692.96 bits (1787), Expect = 0.000e+0
Identity = 370/797 (46.42%), Postives = 513/797 (64.37%), Query Frame = 2
Query:  653 QSLNPEYMPSAVQVIELDKSNNNA-PYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINRYS-LPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 3037
            + L+P+ +PS +QVIE DK+N  + P+ TG R +VPPL+TT+ +  DQG  +P+YIR + Y  PA+ DM K   +P    I P A L   E      +    GPIRC RCKAYM P M FI+GGRRFQC  C   TEV    F HLD +GRR+DC+ RPEL +GSYE  AT +YCKN+  PNPPAFIFM+DVS+N+VKSGL+ L C  LK  ++ YL  +  + +S    VGFVTY++VLHFYN++S++++PQM+V+S    D     VPL++GFLV+ +E+   I+ L++ I + F DT E   V  PVI+AG+EALKAA       FIFH++LP+ EAPGKLK RD++ ++ TDKEK LF   +++Y+ L+  C   G  +DLFL P+ F+DVATL  +P  TGG++YKY FF P     + L D++  V     FDAVMRVRTS G R  DF G FYM NT DV LA +  DK++ VE +H+DKL E+    +Q A+LYTS  GQRRLR+HN++ N  T + D+++  + DTL+N+ ++ A +   +   K VRD +  + +QILA YR+N A  S   +L+LPE +KLLP+Y N +LK D +Q             G ++  D+R Y   L++ MDV  + VF YPRLLPL    S+    +  LP AIR S   LS    YL+ENG+++ +W+G N  +  +QN+F+ SS S+I +  S LP+ +N +S ++  I+ + R+ R R+M L IV Q D++E  FK LLVED+   G +SYVDFLCH+HKEIR +
Sbjct:  314 KRLDPDSIPSPIQVIEDDKNNRGSEPFITGQRGQVPPLITTNVLVKDQGNTSPRYIRCTSYNFPASSDMAKQSQVPLAAVIKPLATLPPDELPPFLVDHGETGPIRCNRCKAYMCPFMQFIEGGRRFQCCFCSCVTEVPTHYFQHLDHTGRRVDCYERPELSMGSYEFTATVDYCKNNKTPNPPAFIFMIDVSYNAVKSGLVALVCEELK-QLVDYLPREGSMEESVI-RVGFVTYNKVLHFYNVKSSLAQPQMMVVS----DVSDMFVPLLDGFLVNVNESRTVINSLLDQIPELFADTRETETVFAPVIQAGLEALKAADCAGKL-FIFHTTLPIAEAPGKLKNRDDKKLVNTDKEKILFQPQTNFYNNLSKDCVAQGCCVDLFLFPNQFLDVATLGVVPFQTGGSVYKYTFFQPETDKERFLNDLRRDVQKEIGFDAVMRVRTSTGIRATDFFGAFYMSNTTDVELAGLDCDKTITVEFKHDDKLNEDTGALLQCAILYTSCGGQRRLRVHNMALNCCTQLADLYRNCETDTLINYFAKFAFRGVLSNPTKTVRDTLINQCAQILACYRKNCASPSSAGQLILPECMKLLPVYLNCVLKSDVLQ------------PGAEMTIDDRTYIRQLVSSMDVADSNVFFYPRLLPL----SKMDPSNDSLPVAIRSSEERLSKGEMYLLENGLNLFVWVGANIQQSLIQNLFNVSSFSQIDSSMSALPVLDNPISNKIRGIITMFRAQRPRYMKLIIVKQDDKIEMLFKHLLVEDKNLNGGASYVDFLCHMHKEIRQL 1087          
BLAST of Protein transport protein Sec24C vs. Ensembl Xenopus
Match: slc34a2 (solute carrier family 34 member 2 [Source:Xenbase;Acc:XB-GENE-483740])

HSP 1 Score: 692.575 bits (1786), Expect = 0.000e+0
Identity = 370/797 (46.42%), Postives = 513/797 (64.37%), Query Frame = 2
Query:  653 QSLNPEYMPSAVQVIELDKSNNNA-PYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINRYS-LPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 3037
            + L+P+ +PS +QVIE DK+N  + P+ TG R +VPPL+TT+ +  DQG  +P+YIR + Y  PA+ DM K   +P    I P A L   E      +    GPIRC RCKAYM P M FI+GGRRFQC  C   TEV    F HLD +GRR+DC+ RPEL +GSYE  AT +YCKN+  PNPPAFIFM+DVS+N+VKSGL+ L C  LK  ++ YL  +  + +S    VGFVTY++VLHFYN++S++++PQM+V+S    D     VPL++GFLV+ +E+   I+ L++ I + F DT E   V  PVI+AG+EALKAA       FIFH++LP+ EAPGKLK RD++ ++ TDKEK LF   +++Y+ L+  C   G  +DLFL P+ F+DVATL  +P  TGG++YKY FF P     + L D++  V     FDAVMRVRTS G R  DF G FYM NT DV LA +  DK++ VE +H+DKL E+    +Q A+LYTS  GQRRLR+HN++ N  T + D+++  + DTL+N+ ++ A +   +   K VRD +  + +QILA YR+N A  S   +L+LPE +KLLP+Y N +LK D +Q             G ++  D+R Y   L++ MDV  + VF YPRLLPL    S+    +  LP AIR S   LS    YL+ENG+++ +W+G N  +  +QN+F+ SS S+I +  S LP+ +N +S ++  I+ + R+ R R+M L IV Q D++E  FK LLVED+   G +SYVDFLCH+HKEIR +
Sbjct:  227 KRLDPDSIPSPIQVIEDDKNNRGSEPFITGQRGQVPPLITTNVLVKDQGNTSPRYIRCTSYNFPASSDMAKQSQVPLAAVIKPLATLPPDELPPFLVDHGETGPIRCNRCKAYMCPFMQFIEGGRRFQCCFCSCVTEVPTHYFQHLDHTGRRVDCYERPELSMGSYEFTATVDYCKNNKTPNPPAFIFMIDVSYNAVKSGLVALVCEELK-QLVDYLPREGSMEESVI-RVGFVTYNKVLHFYNVKSSLAQPQMMVVS----DVSDMFVPLLDGFLVNVNESRTVINSLLDQIPELFADTRETETVFAPVIQAGLEALKAADCAGKL-FIFHTTLPIAEAPGKLKNRDDKKLVNTDKEKILFQPQTNFYNNLSKDCVAQGCCVDLFLFPNQFLDVATLGVVPFQTGGSVYKYTFFQPETDKERFLNDLRRDVQKEIGFDAVMRVRTSTGIRATDFFGAFYMSNTTDVELAGLDCDKTITVEFKHDDKLNEDTGALLQCAILYTSCGGQRRLRVHNMALNCCTQLADLYRNCETDTLINYFAKFAFRGVLSNPTKTVRDTLINQCAQILACYRKNCASPSSAGQLILPECMKLLPVYLNCVLKSDVLQ------------PGAEMTIDDRTYIRQLVSSMDVADSNVFFYPRLLPL----SKMDPSNDSLPVAIRSSEERLSKGEMYLLENGLNLFVWVGANIQQSLIQNLFNVSSFSQIDSSMSALPVLDNPISNKIRGIITMFRAQRPRYMKLIIVKQDDKIEMLFKHLLVEDKNLNGGASYVDFLCHMHKEIRQL 1000          
BLAST of Protein transport protein Sec24C vs. Ensembl Mouse
Match: Sec24c (Sec24 related gene family, member C (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1919746])

HSP 1 Score: 704.901 bits (1818), Expect = 0.000e+0
Identity = 371/797 (46.55%), Postives = 520/797 (65.24%), Query Frame = 2
Query:  653 QSLNPEYMPSAVQVIELDKSNNNA-PYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINRYS-LPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 3037
            + L+P+ +PS +QVIE D++N  + P+ TG R +VPPLVTT+F+  DQG  +P+YIR + Y +P   DM K   +P    I P A+L   E      +    GP+RC RCKAYM PLMTFI+GGRRFQC+ C    +V  + F HLD +G+R+D ++RPEL LGSYE +AT +YCKN+  P+PPAFIFM+DVS+N++++GL+ L C  LK  +L YL  +    +S    VGFVTY++VLHFYN++S++++PQM+V+S    D     VPL++GFLV+  E+   I+ L++ I + F DT E   V  PVI+AGMEALKAA       F+FH+SLP+ EAPGKLK RD+R ++ TDKEKTLF   +  Y  LA  C   G  +DLFL P+ ++DVATLS +P+ TGG++YKY  F   N   + L D++  V     FDAVMRVRTS G R VDF G FYM NT DV LA +  DK+V VE +H+D+L E     +Q A+LYTS +GQRRLRIHN++ N  T + D+++  + DTL+N+M++ A +      VK VRD +  + +QILA YR+N A  S   +L+LPE +KLLP+Y N +LK D +Q             G ++ TD+RAY   L++ MDV  T VF YPRLLPL  +  + +AE    P A+R S   LSS   YL+ENG+++ +W+G +  +  +Q++F+ SS S+I +  S LP+ +N +S +V  ++  +R+ R R+M L +V Q D++E  FK  LVED+   G +SYVDFLCH+HKEIR +
Sbjct:  321 KRLDPDAIPSPIQVIEDDRNNRGSEPFVTGVRGQVPPLVTTNFLVKDQGNASPRYIRCTSYNIPCTSDMAKQAQVPLAAVIKPLARLPPEEASPYVVDHGESGPLRCNRCKAYMCPLMTFIEGGRRFQCSFCSCVNDVPPQYFQHLDHTGKRVDAYDRPELSLGSYEFLATVDYCKNNKFPSPPAFIFMIDVSYNAIRTGLVRLLCEELKS-LLDYLPREGGAEESAI-RVGFVTYNKVLHFYNVKSSLAQPQMMVVS----DVADMFVPLLDGFLVNVSESRAVITSLLDQIPEMFADTRETETVFAPVIQAGMEALKAAECAGKL-FLFHTSLPIAEAPGKLKNRDDRKLINTDKEKTLFQPQTGTYQTLAKECVAQGCCVDLFLFPNQYVDVATLSVVPQLTGGSVYKYACFQVENDQERFLSDLRRDVQKVVGFDAVMRVRTSTGIRAVDFFGAFYMSNTTDVELAGLDGDKTVTVEFKHDDRLNEENGALLQCALLYTSCAGQRRLRIHNLALNCCTQLADLYRNCETDTLINYMAKFAYRAVLNSPVKTVRDTLITQCAQILACYRKNCASPSSAGQLILPECMKLLPVYLNCVLKSDVLQ------------PGAEVTTDDRAYVRQLVSSMDVAETNVFFYPRLLPLTKSPLDSTAE----PPAVRASEERLSSGDIYLLENGLNLFVWVGASVQQGVVQSLFNVSSFSQITSGLSVLPVLDNPLSKKVRGLIDSLRAQRMRYMKLIVVKQEDKLEMLFKHFLVEDKSLSGGASYVDFLCHMHKEIRQL 1094          
BLAST of Protein transport protein Sec24C vs. Ensembl Mouse
Match: Sec24c (Sec24 related gene family, member C (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1919746])

HSP 1 Score: 702.205 bits (1811), Expect = 0.000e+0
Identity = 370/795 (46.54%), Postives = 519/795 (65.28%), Query Frame = 2
Query:  659 LNPEYMPSAVQVIELDKSNNNA-PYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINRYS-LPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 3037
            ++P+ +PS +QVIE D++N  + P+ TG R +VPPLVTT+F+  DQG  +P+YIR + Y +P   DM K   +P    I P A+L   E      +    GP+RC RCKAYM PLMTFI+GGRRFQC+ C    +V  + F HLD +G+R+D ++RPEL LGSYE +AT +YCKN+  P+PPAFIFM+DVS+N++++GL+ L C  LK  +L YL  +    +S    VGFVTY++VLHFYN++S++++PQM+V+S    D     VPL++GFLV+  E+   I+ L++ I + F DT E   V  PVI+AGMEALKAA       F+FH+SLP+ EAPGKLK RD+R ++ TDKEKTLF   +  Y  LA  C   G  +DLFL P+ ++DVATLS +P+ TGG++YKY  F   N   + L D++  V     FDAVMRVRTS G R VDF G FYM NT DV LA +  DK+V VE +H+D+L E     +Q A+LYTS +GQRRLRIHN++ N  T + D+++  + DTL+N+M++ A +      VK VRD +  + +QILA YR+N A  S   +L+LPE +KLLP+Y N +LK D +Q             G ++ TD+RAY   L++ MDV  T VF YPRLLPL  +  + +AE    P A+R S   LSS   YL+ENG+++ +W+G +  +  +Q++F+ SS S+I +  S LP+ +N +S +V  ++  +R+ R R+M L +V Q D++E  FK  LVED+   G +SYVDFLCH+HKEIR +
Sbjct:  247 IDPDAIPSPIQVIEDDRNNRGSEPFVTGVRGQVPPLVTTNFLVKDQGNASPRYIRCTSYNIPCTSDMAKQAQVPLAAVIKPLARLPPEEASPYVVDHGESGPLRCNRCKAYMCPLMTFIEGGRRFQCSFCSCVNDVPPQYFQHLDHTGKRVDAYDRPELSLGSYEFLATVDYCKNNKFPSPPAFIFMIDVSYNAIRTGLVRLLCEELKS-LLDYLPREGGAEES-AIRVGFVTYNKVLHFYNVKSSLAQPQMMVVS----DVADMFVPLLDGFLVNVSESRAVITSLLDQIPEMFADTRETETVFAPVIQAGMEALKAAECAGKL-FLFHTSLPIAEAPGKLKNRDDRKLINTDKEKTLFQPQTGTYQTLAKECVAQGCCVDLFLFPNQYVDVATLSVVPQLTGGSVYKYACFQVENDQERFLSDLRRDVQKVVGFDAVMRVRTSTGIRAVDFFGAFYMSNTTDVELAGLDGDKTVTVEFKHDDRLNEENGALLQCALLYTSCAGQRRLRIHNLALNCCTQLADLYRNCETDTLINYMAKFAYRAVLNSPVKTVRDTLITQCAQILACYRKNCASPSSAGQLILPECMKLLPVYLNCVLKSDVLQ------------PGAEVTTDDRAYVRQLVSSMDVAETNVFFYPRLLPLTKSPLDSTAE----PPAVRASEERLSSGDIYLLENGLNLFVWVGASVQQGVVQSLFNVSSFSQITSGLSVLPVLDNPLSKKVRGLIDSLRAQRMRYMKLIVVKQEDKLEMLFKHFLVEDKSLSGGASYVDFLCHMHKEIRQL 1018          
BLAST of Protein transport protein Sec24C vs. Ensembl Mouse
Match: Sec24d (Sec24 related gene family, member D (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1916858])

HSP 1 Score: 630.558 bits (1625), Expect = 0.000e+0
Identity = 348/802 (43.39%), Postives = 498/802 (62.09%), Query Frame = 2
Query:  641 GPQTQ-SLNPEYMPSAVQVIELDKSNNNAP-YPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHI--LPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLK-CDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEI-INRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEI 3028
             PQ Q  L+P+ +PS +QVIE D++      Y T TR +VPPLVTT+ +  DQG  +P+YIR + Y  P   DM K   IP    I PFA +   E  +        GP+RC RCKAYM P M FI+GGRR+QC  C    EV    F HLD  GRR+D + +PEL LGSYE +AT +YC+ +  P+PPAFIFM+DVS++++K+GL+ L C  LK  +  LP    +    ++    VGF+TY++VLHF+N++SN+++PQM+V++    D G   VPL++GFLV+ +E+   I  L++ I + F D+ E   V  PVI+AGMEALKAA       FIFHSSLP  EAPGKLK RD++ ++ TDKEK LF   ++ Y  LA  C  +  S+ LFL PS F+DVA+L  +P  TGG LYKY+ F   +   + L D+++ +     FDA+MRVRTS G R  DF G  +M NT DV +A +  DK+V VE +H+DKL E+    IQ AVLYT+ISGQRRLRIHN++ N ST + D++K  + D L+N+ +++A K    + +K +R+ +  +++ +LA YR++ A  S  ++L+LP+++K+LP+Y NSLLK C  +             S ++++ DERAYQ  L+  M V  +Q+F YP LLP+         +S  LP A+R S   LS EG +L+ NG+++ LW G  +  E +Q +F+  S + I  +  SLP   +  S ++  I+  I+  +   M L +V Q ++ E AF++ LVED+G  G SSYVDFLC +HKEI
Sbjct:  252 APQLQRKLDPDSIPSPIQVIENDRATRGGQVYTTNTRGQVPPLVTTECVIQDQGHSSPRYIRCTTYCFPCTSDMAKQAQIPLAAVIKPFADIPPNETPLYLVNHGESGPVRCNRCKAYMCPFMQFIEGGRRYQCGFCSCVNEVPPFYFQHLDHIGRRLDHYEKPELSLGSYEYVATLDYCRKNKPPSPPAFIFMIDVSYSNIKNGLVKLICEELKTALKRLPKEEHE----ETSAIRVGFITYNKVLHFFNVKSNLAQPQMMVVT----DVGEVFVPLLDGFLVNYEESQSVIHNLLDQIPEMFADSNENETVFAPVIQAGMEALKAAECPGKL-FIFHSSLPTAEAPGKLKNRDDKKLVNTDKEKILFQPQTAVYESLAKDCVANSCSVTLFLFPSQFVDVASLGLVPLLTGGTLYKYNVFQIHSDSQRFLTDLRNDIEKKIGFDAIMRVRTSTGFRATDFFGGIFMNNTTDVEMAAIDCDKAVTVEFKHDDKLSEDVGALIQCAVLYTTISGQRRLRIHNLALNCSTQLADLYKSCETDALINFFAKSAFKAVLNQPLKAIREILVNQTAHMLACYRKHCASPSAASQLILPDSMKVLPVYMNSLLKNCVLL-------------SRSEISPDERAYQRQLVMTMGVADSQLFFYPLLLPI----HTLDVKSAALPPAVRCSESRLSEEGIFLLANGLNMFLWFGVGSPPELIQGIFNVPSFAHINTDMTSLPEVGSPHSQQLRMIMNNIQQKKPYSMKLIVVKQREQREMAFRQFLVEDKGLYGGSSYVDFLCCVHKEI 1027          
BLAST of Protein transport protein Sec24C vs. Ensembl Mouse
Match: Sec24a (Sec24 related gene family, member A (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1924621])

HSP 1 Score: 313.153 bits (801), Expect = 1.258e-89
Identity = 227/796 (28.52%), Postives = 403/796 (50.63%), Query Frame = 2
Query:  677 PSAVQVIELDKSNNNAPYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGT-------KLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSE----FSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINRYS-LPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEI 3028
            P  ++V+ L +  N  P  T  +  VP L+      I +  CNP+  R ++ +VP    +L    +P  L + PF  L       V   +     +RC  C+ Y++P + F+D  RR++CN+C    +V EE F +   +    +   RPE+   + E MA +EY      P PP ++F+ DVSHN++++G LN  C +L D++        L+P + +  +GF+T+D  +HFY+LQ  +S+PQML++S +D+      +P+    LV+ +E+ E +  L++ +   F  T E    LGP ++A  + +   GGR     +F + LP +   G LK R+E     + KE  L  S + +Y KLA  CS    ++DLFL    + D+A+L  + + + G++Y Y    PS H         KL K++   ++    F+AVMR+R + G     F GNF++++T+ ++L  V+ D    V++   + L + + V+ Q A+LYTS  G+RR+R+H +   V + + ++F   D+  +   ++  AV      S+ + RD +       L++YR +     +P  L++P +L+L PL+  +LLK            +++  +GT +  DER +    +    + H  +  +P L  + N   E     +  +   P  ++ S   LS +GA+L++ G  ++LW+G+N ++ +L  V    + + I    + LP  +   S  +   +  +R  R  F +L ++ +   M++AF + LVEDR E    SY +FL HI +++
Sbjct:  342 PEGLRVVNLLQERNMLPS-TPLQPPVPNLLED----IQKLNCNPELFRCTLTSVPQTQALLNKAKLPLGLLLHPFKDL-------VLPVVTSSTIVRCRSCRTYINPFVNFLDQ-RRWKCNLCYRVNDVPEE-FMYNPLTRVYGEPHKRPEVQNATIEFMAPSEYMLRP--PQPPVYLFVFDVSHNAIETGYLNSVCQSLLDNL-------DLLPGNTRTKIGFITFDSTIHFYSLQEGLSQPQMLIVSDIDDV----FIPMPENLLVNLNESKELVQDLLKTLPQMFTKTLETQSALGPALQAAFKLISPTGGRMS---VFQTQLPTLGV-GALKPREEPNQRSSAKEIHLTPS-TDFYKKLALDCSGQQAAVDLFLLSGQYSDLASLGCISRYSAGSVYYY----PSYHHQHNPVQVQKLQKELHRYLTRKIGFEAVMRIRCTKGLSIHTFHGNFFVRSTDLLSLPNVNPDAGYAVQMSVEESLTDTQLVSFQSALLYTSSKGERRIRVHTLCLPVVSTLNEVFLGADVQAISGLLANMAVDRSVTASLSDARDALVNAVIDSLSAYRSSVLSGQQPG-LMVPFSLRLFPLFVLALLK------------QKSFQTGTSIRLDERIFAMCQVKSQPLVHLMLTTHPSLYRVDNLSDEGALNINDRTIPQPPILQLSVEKLSRDGAFLMDAGSLLMLWVGRNCSQNFLSQVLGVQNYASIPQTMTDLPELDTPESARIAAFISWLREQRPFFPVLYVIREESLMKAAFLQSLVEDRTESA-LSYYEFLLHIQQQV 1087          
BLAST of Protein transport protein Sec24C vs. Ensembl Mouse
Match: Sec24a (Sec24 related gene family, member A (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1924621])

HSP 1 Score: 312.383 bits (799), Expect = 2.313e-89
Identity = 227/796 (28.52%), Postives = 404/796 (50.75%), Query Frame = 2
Query:  677 PSAVQVIELDKSNNNAPYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGT-------KLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSE----FSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINRYS-LPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEI 3028
            P  ++V+ L +  N  P  T  +  VP L+      I +  CNP+  R ++ +VP    +L    +P  L + PF   D  +  +V         +RC  C+ Y++P + F+D  RR++CN+C    +V EE F +   +    +   RPE+   + E MA +EY      P PP ++F+ DVSHN++++G LN  C +L D++        L+P + +  +GF+T+D  +HFY+LQ  +S+PQML++S +D+      +P+    LV+ +E+ E +  L++ +   F  T E    LGP ++A  + +   GGR     +F + LP +   G LK R+E     + KE  L  S + +Y KLA  CS    ++DLFL    + D+A+L  + + + G++Y Y    PS H         KL K++   ++    F+AVMR+R + G     F GNF++++T+ ++L  V+ D    V++   + L + + V+ Q A+LYTS  G+RR+R+H +   V + + ++F   D+  +   ++  AV      S+ + RD +       L++YR +     +P  L++P +L+L PL+  +LLK            +++  +GT +  DER +    +    + H  +  +P L  + N   E     +  +   P  ++ S   LS +GA+L++ G  ++LW+G+N ++ +L  V    + + I    + LP  +   S  +   +  +R  R  F +L ++ +   M++AF + LVEDR E    SY +FL HI +++
Sbjct:  342 PEGLRVVNLLQERNMLPS-TPLQPPVPNLLED----IQKLNCNPELFRCTLTSVPQTQALLNKAKLPLGLLLHPFK--DLVQLPVVTSSTI----VRCRSCRTYINPFVNFLDQ-RRWKCNLCYRVNDVPEE-FMYNPLTRVYGEPHKRPEVQNATIEFMAPSEYMLRP--PQPPVYLFVFDVSHNAIETGYLNSVCQSLLDNL-------DLLPGNTRTKIGFITFDSTIHFYSLQEGLSQPQMLIVSDIDDV----FIPMPENLLVNLNESKELVQDLLKTLPQMFTKTLETQSALGPALQAAFKLISPTGGRMS---VFQTQLPTLGV-GALKPREEPNQRSSAKEIHLTPS-TDFYKKLALDCSGQQAAVDLFLLSGQYSDLASLGCISRYSAGSVYYY----PSYHHQHNPVQVQKLQKELHRYLTRKIGFEAVMRIRCTKGLSIHTFHGNFFVRSTDLLSLPNVNPDAGYAVQMSVEESLTDTQLVSFQSALLYTSSKGERRIRVHTLCLPVVSTLNEVFLGADVQAISGLLANMAVDRSVTASLSDARDALVNAVIDSLSAYRSSVLSGQQPG-LMVPFSLRLFPLFVLALLK------------QKSFQTGTSIRLDERIFAMCQVKSQPLVHLMLTTHPSLYRVDNLSDEGALNINDRTIPQPPILQLSVEKLSRDGAFLMDAGSLLMLWVGRNCSQNFLSQVLGVQNYASIPQTMTDLPELDTPESARIAAFISWLREQRPFFPVLYVIREESLMKAAFLQSLVEDRTESA-LSYYEFLLHIQQQV 1088          
BLAST of Protein transport protein Sec24C vs. UniProt/SwissProt
Match: sp|P53992|SC24C_HUMAN (Protein transport protein Sec24C OS=Homo sapiens OX=9606 GN=SEC24C PE=1 SV=3)

HSP 1 Score: 700.279 bits (1806), Expect = 0.000e+0
Identity = 370/797 (46.42%), Postives = 515/797 (64.62%), Query Frame = 2
Query:  653 QSLNPEYMPSAVQVIELDKSNNNA-PYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINRYS-LPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 3037
            + L+P+ +PS +QVIE D++N    P+ TG R +VPPLVTT+F+  DQG  +P+YIR + Y +P   DM K   +P    I P A+L   E      +    GP+RC RCKAYM P M FI+GGRRFQC  C    +V  + F HLD +G+R+D ++RPEL LGSYE +AT +YCKN+  P+PPAFIFM+DVS+N++++GL+ L C  LK  +L +L  +    +S    VGFVTY++VLHFYN++S++++PQM+V+S    D     VPL++GFLV+ +E+   I+ L++ I + F DT E   V  PVI+AGMEALKAA       F+FH+SLP+ EAPGKLK RD+R ++ TDKEKTLF   +  Y  LA  C   G  +DLFL P+ ++DVATLS +P+ TGG++YKY  F   N   + L D++  V     FDAVMRVRTS G R VDF G FYM NT DV LA +  DK+V VE +H+D+L E     +Q A+LYTS +GQRRLRIHN++ N  T + D+++  + DTL+N+M++ A +      VK VRD +  + +QILA YR+N A  S   +L+LPE +KLLP+Y N +LK D +Q             G ++ TD+RAY   L+  MDV  T VF YPRLLPL  +  E + E    P A+R S   LS+   YL+ENG+++ LW+G +  +  +Q++F  SS S+I +  S LP+ +N +S +V  ++  +R+ RSR+M L +V Q D+ME  FK  LVED+   G +SYVDFLCH+HKEIR +
Sbjct:  319 KRLDPDAIPSPIQVIEDDRNNRGTEPFVTGVRGQVPPLVTTNFLVKDQGNASPRYIRCTSYNIPCTSDMAKQAQVPLAAVIKPLARLPPEEASPYVVDHGESGPLRCNRCKAYMCPFMQFIEGGRRFQCCFCSCINDVPPQYFQHLDHTGKRVDAYDRPELSLGSYEFLATVDYCKNNKFPSPPAFIFMIDVSYNAIRTGLVRLLCEELKS-LLDFLPREGGAEESAI-RVGFVTYNKVLHFYNVKSSLAQPQMMVVS----DVADMFVPLLDGFLVNVNESRAVITSLLDQIPEMFADTRETETVFVPVIQAGMEALKAAECAGKL-FLFHTSLPIAEAPGKLKNRDDRKLINTDKEKTLFQPQTGAYQTLAKECVAQGCCVDLFLFPNQYVDVATLSVVPQLTGGSVYKYASFQVENDQERFLSDLRRDVQKVVGFDAVMRVRTSTGIRAVDFFGAFYMSNTTDVELAGLDGDKTVTVEFKHDDRLNEESGALLQCALLYTSCAGQRRLRIHNLALNCCTQLADLYRNCETDTLINYMAKFAYRGVLNSPVKAVRDTLITQCAQILACYRKNCASPSSAGQLILPECMKLLPVYLNCVLKSDVLQ------------PGAEVTTDDRAYVRQLVTSMDVTETNVFFYPRLLPLTKSPVESTTE----PPAVRASEERLSNGDIYLLENGLNLFLWVGASVQQGVVQSLFSVSSFSQITSGLSVLPVLDNPLSKKVRGLIDSLRAQRSRYMKLTVVKQEDKMEMLFKHFLVEDKSLSGGASYVDFLCHMHKEIRQL 1092          
BLAST of Protein transport protein Sec24C vs. UniProt/SwissProt
Match: sp|O94855|SC24D_HUMAN (Protein transport protein Sec24D OS=Homo sapiens OX=9606 GN=SEC24D PE=1 SV=2)

HSP 1 Score: 635.565 bits (1638), Expect = 0.000e+0
Identity = 349/799 (43.68%), Postives = 495/799 (61.95%), Query Frame = 2
Query:  644 PQTQS-LNPEYMPSAVQVIELDKSNNNAP-YPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLK-CDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEI-INRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEI 3028
            PQ Q  L+P+ +PS +QVIE D+++     Y T TR ++PPLVTTD +  DQG  +P++IR + Y  P   DM K   IP    I PFA +   E  +        GP+RC RCKAYM P M FI+GGRR+QC  C    +V    F HLD  GRR+D + +PEL LGSYE +AT +YC+    PNPPAFIFM+DVS++++K+GL+ L C  LK  +      +Q    + +  VGF+TY++VLHF+N++SN+++PQM+V++    D G   VPL++GFLV+  E+   I  L++ I D F D+ E   V  PVI+AGMEALKAA       FIFHSSLP  EAPGKLK RD++ ++ TDKEK LF   ++ Y  LA  C   G S+ LFL PS ++DVA+L  +P+ TGG LYKY+ F       + L D+++ +     FDA+MRVRTS G R  DF G   M NT DV +A +  DK+V VE +H+DKL E+    IQ AVLYT+ISGQRRLRIHN+  N S+ + D++K  + D L+N+ +++A K    + +K +R+ +  +++ +LA YR+N A  S  ++L+LP+++K+LP+Y N LLK C  +             S  +++TDERAYQ  L+  M V  +Q+F YP+LLP+         +S  LP+A+R S   LS EG +L+ NG+ + LW+G ++  E +Q +F+  S + I  +   LP   N  S ++  I+ II+  R   M L IV Q ++ E  F++ LVED+G  G SSYVDFLC +HKEI
Sbjct:  253 PQPQKKLDPDSIPSPIQVIENDRASRGGQVYATNTRGQIPPLVTTDCMIQDQGNASPRFIRCTTYCFPCTSDMAKQAQIPLAAVIKPFATIPSNESPLYLVNHGESGPVRCNRCKAYMCPFMQFIEGGRRYQCGFCNCVNDVPPFYFQHLDHIGRRLDHYEKPELSLGSYEYVATLDYCRKSKPPNPPAFIFMIDVSYSNIKNGLVKLICEELKTMLEKIPKEEQEETSAIR--VGFITYNKVLHFFNVKSNLAQPQMMVVT----DVGEVFVPLLDGFLVNYQESQSVIHNLLDQIPDMFADSNENETVFAPVIQAGMEALKAADCPGKL-FIFHSSLPTAEAPGKLKNRDDKKLVNTDKEKILFQPQTNVYDSLAKDCVAHGCSVTLFLFPSQYVDVASLGLVPQLTGGTLYKYNNFQMHLDRQQFLNDLRNDIEKKIGFDAIMRVRTSTGFRATDFFGGILMNNTTDVEMAAIDCDKAVTVEFKHDDKLSEDSGALIQCAVLYTTISGQRRLRIHNLGLNCSSQLADLYKSCETDALINFFAKSAFKAVLHQPLKVIREILVNQTAHMLACYRKNCASPSAASQLILPDSMKVLPVYMNCLLKNCVLL-------------SRPEISTDERAYQRQLVMTMGVADSQLFFYPQLLPI----HTLDVKSTMLPAAVRCSESRLSEEGIFLLANGLHMFLWLGVSSPPELIQGIFNVPSFAHINTDMTLLPEVGNPYSQQLRMIMGIIQQKRPYSMKLTIVKQREQPEMVFRQFLVEDKGLYGGSSYVDFLCCVHKEI 1027          
BLAST of Protein transport protein Sec24C vs. UniProt/SwissProt
Match: sp|Q9M291|SC24C_ARATH (Protein transport protein Sec24-like CEF OS=Arabidopsis thaliana OX=3702 GN=CEF PE=2 SV=3)

HSP 1 Score: 395.201 bits (1014), Expect = 2.072e-118
Identity = 255/814 (31.33%), Postives = 430/814 (52.83%), Query Frame = 2
Query:  629 GSRYGP---QTQSLNPEYMPSAVQVIELDKSNNNAP---YPTGTRDKV--PPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDE----RTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESA-FKKLLVEDRGERGNSSYVDFLCHIHKEIR 3031
            GS YG    Q QS+     PS + + ++ +  +++    Y T   +K   PP  T D+I  D G  +P+Y+R +I  +P   D+L +  +   L + P A    +E+ I   +    GP+RC RCK Y++P M FID GR+F CN+CG   E   +   +L   GRR D   RPELC G+ + +AT EY   D  P P  + F++DVS N++++G     C+ ++      + +D  +P+ P+  VG  T+D  +HFYNL+  + +P ML++     D      PL    +V   E  + + IL+E+I   F++++      G  ++A      A     GKL +F S LP V   G L +R+         G  +   L          +A   +E  V +DLF+T  A++D+A++S++P+ TGG +Y Y  FS  +   KL  D++  ++ P  F+AVMRVR S G +  ++ GNF  +   D++L  +  DK+++V ++H+DKLQ+      Q A+LYT+ISG+RR+R+ N+S   +  + ++F+  DLD+    M + A     +K++  V+++ +     IL SYR+  A  +   +L+LPE LKLLPLY  +L K   ++ D                 D+R++    ++ +        +YPR++ + +  +    E   +P  I     +LS EG Y +ENG   +++IG++ N + LQ +F+  S +E+ ++Y L  ++N +S + N +V  IR  RS ++ + +  +GD   +  F+  +VEDRG  G +SYVDFL  +H++I+
Sbjct:  312 GSIYGMGPMQNQSMTSVSSPSKIDLNQIPRPGSSSSPIVYETRVENKANPPPPTTVDYITRDTGNSSPRYMRCTINQIPCTVDLLSTSGMQLALIVQPMALSHPSEEPIQVVDFGESGPVRCSRCKGYVNPFMKFIDQGRKFICNLCGYTDETPRDYQCNLGPDGRRRDADERPELCRGTVDFVATKEYMVRD--PMPAVYFFLIDVSMNAIQTGATAAACSAIQQ-----VLSD--LPEGPRTFVGIATFDSTIHFYNLKRALQQPLMLIVP----DVQDVYTPLETDVIVQLSECRQHLEILLESIPTMFQESKSPESAFGAAVKAAF---LAMKSTGGKLMVFQSVLPSVGI-GALSSREADGRANASAGEKEAHKLLQPADKTLRTMAIEFAEYQVCVDLFITTQAYVDMASISEIPRTTGGQVYCYYPFSALSDPPKLYNDLRWNITRPQGFEAVMRVRCSQGIQVQEYSGNFCKRIPTDIDLPAIDCDKAIMVTLKHDDKLQDGAECGFQCALLYTTISGERRIRVLNLSIPCTNMLSNLFRSADLDSQFACMLKQAANEIPSKALPLVKEQATNDCITILHSYRKFCATVTSTGQLILPEALKLLPLYTLALTKGVGLRMDGR--------------IDDRSFWINHVSSLSTPLAIPLVYPRMIAVHDLDAN-DNEENVVPCPIPLQSEHLSDEGVYFLENGEDGLIYIGESVNSDILQKLFNVRSAAELPSQYVLQKYDNQLSKKFNDVVNEIRRQRSSYLRIKLCKKGDPAGNMLFQSYMVEDRGS-GGASYVDFLVSVHRQIQ 1092          
BLAST of Protein transport protein Sec24C vs. UniProt/SwissProt
Match: sp|Q9M081|SC24B_ARATH (Protein transport protein Sec24-like At4g32640 OS=Arabidopsis thaliana OX=3702 GN=At4g32640 PE=3 SV=3)

HSP 1 Score: 362.459 bits (929), Expect = 1.524e-106
Identity = 233/807 (28.87%), Postives = 400/807 (49.57%), Query Frame = 2
Query:  644 PQTQSLNPEYMP-----SAVQVIELDKSNNNAPYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDER----TILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSG--TDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIR 3031
            P    ++P  +P     S+  V E  +SN   P         PP  T+D++  D G C+P+Y+R +I  +P   D+L +  +   L + P A    +E+ I   +    GP+RC RCK Y++P M FID GR+F CN CG   E   +   +L   GRR D   RPELC G+ E +AT EY   D  P P  + F++DVS N++++G     CN ++  +     +D  +P+ P+  VG  T+D  +HFYNL+  + +P ML++     D      PL    +V   E  + + +L+++I   F++++      G  ++A      A   + GKL +F S L  V   G L +R+         G  +   L          +A   +E  V +D+F+T  A++D+A++S +P+ TGG +Y Y  FS  +   KL  D++  ++ P  F+AVMRVR S G +  ++ GNF  +   D++L              H+DKLQ+      Q A+LYT+I G+RR+R+  +S + +  + ++F+  DLD+    M + A     +K++  V+++ +      L +YR+  A  +                 +  L+  + ++    Y    T+  G  TD   D+R++    ++ +        +YPR++ + +   +   E   LP  I  S  ++S+EG Y +ENG   +L++G++ + + LQ +F  SS +EI N++ L  ++N +S + N  V  IR  R  ++ + +  +G+     F   +VEDR   G  SYV+FL  +H++I+
Sbjct:  326 PGPSRIDPNQIPRPGSSSSPTVFETRQSNQANP---------PPPATSDYVVRDTGNCSPRYMRCTINQIPCTVDLLSTSGMQLALMVQPLALSHPSEEPIQVVDFGEGGPVRCSRCKGYINPFMKFIDQGRKFICNFCGYTDETPRDYHCNLGPDGRRRDVDERPELCRGTVEFVATKEYMVRD--PMPAVYFFLIDVSMNAIQTGATAAACNAIQQVL-----SD--LPEGPRTFVGIATFDSTIHFYNLKRALQQPLMLIVP----DVQDVYTPLETDVVVQLSECRQHLELLLDSIPTMFQESKIPESAFGAAVKAAF---LAMKSKGGKLMVFQSILCSVGV-GALSSREAEGRANMSAGEKEAHKLLQPADKTLKTMAIEFAEYQVCVDIFITTQAYVDMASISVIPRTTGGQVYCYYPFSALSDPPKLYNDLKWNITRPQGFEAVMRVRCSQGIQVQEYSGNFCKRIPTDIDLPA------------HDDKLQDGAECAFQCALLYTTIYGERRIRVTTLSLSCTNMLSNLFRAADLDSQFACMLKQAANEIPSKALPLVKEQATNSCINALYAYRKFCATVTS----------------SGQLILPEALKLFPLYTLALTKSVGLRTDGRIDDRSFWINYVSSLSTPLAIPLVYPRMISVHDLDVK-DTEGSVLPPPIPLSSEHISNEGVYFLENGEDGLLFVGESVDSDILQKLFAVSSAAEIPNQFVLQQYDNQLSKKFNDAVNEIRRQRCSYLRIKLCKKGEPSGMLFLSYMVEDRTASG-PSYVEFLVQVHRQIQ 1076          
BLAST of Protein transport protein Sec24C vs. UniProt/SwissProt
Match: sp|Q9SFU0|SC24A_ARATH (Protein transport protein Sec24-like At3g07100 OS=Arabidopsis thaliana OX=3702 GN=At3g07100 PE=2 SV=2)

HSP 1 Score: 360.147 bits (923), Expect = 4.147e-106
Identity = 233/757 (30.78%), Postives = 400/757 (52.84%), Query Frame = 2
Query:  800 CNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKAR-DERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSG--TDLATDERAYQCFLMNDMDVKHTQVFLYPR-------LLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINRYSLPIHNNNVSLEVNRIVQIIR-STRSRFMMLNIVIQGDRMESAFKKL--LVEDRGERGNSSYVDFLCHIHKEIR 3031
            C+ +Y+R +  A+P +  +    ++P    +CP A+  E E+ +   +    G IRC RC+ Y++P +TF D GR+++CNIC    +V  E F+HLD +GRR+D   RPEL  GS E++A  EY      P PP + F++DVS ++ KSG+L +    +K  +      D L P  P+  +GF+TYD  LHFYN++S++S+PQM+V+S LD+      VPL +  LV+  E+   +   ++++   F+D        GP + A            GKL IF +SLP + A G+LK R D+  + GTDKE  L  +   +Y ++A  C++  + I+++     + D+A+L  L K TGG +Y Y  F  S HG KL  ++   ++   A++AVMR+R   G R   + GNF +++T+ + L  V  DK+  +++   + L  +++V  QVA+LYT+  G+RR+R+H     V T++ ++++  D  ++++  +R A++   +  + + R+ I Q+  + L  YR  +A Q +         L    +Y  SL    F+      +++ T   G   D + DER    F M  + VK     LYP        LL    A  +F    + LP A      +L S G Y+ ++G  ++LW G+  + +  +N+      ++ ++R +     N +S ++ R+V+ +R S  S   M  +V QG++    F  L  L+ED+   G+S YVD++  +H++++
Sbjct:  316 CHSRYLRLTTSAIPNSQSLASRWHLPLGAVVCPLAETPEGEE-VPLIDFGSTGIIRCRRCRTYVNPFVTFTDSGRKWRCNICSMLNDVPGEYFSHLDATGRRMDMDQRPELTKGSVEIIAPTEYMVRP--PMPPIYFFLIDVSISATKSGMLEVVAQTIKSCL------DNL-PGYPRTQIGFITYDSTLHFYNMKSSLSQPQMMVVSDLDDI----FVPLPDDLLVNLSESRTVVDAFLDSLPLMFQDNFNVESAFGPALRAAF---MVMNQLGGKLLIFQNSLPSLGA-GRLKLRGDDPRVYGTDKEYALRVAEDPFYKQMAADCTKFQIGINVYAFSDKYTDIASLGTLAKYTGGQVYYYPGFQSSVHGDKLRHELARDLTRETAWEAVMRIRCGKGIRFSSYHGNFMLRSTDLLALPAVDCDKAYAMQLSLEETLLTSQTVYFQVALLYTASCGERRIRVHTSVAPVVTDLGEMYRQADTGSIVSLYARLAIEKSLSAKLDDARNAIQQKIVKALKEYRNLHAVQHR---------LGSRLVYPESL---KFLPLYGLAITKSTPLLGGPADTSLDERCAAGFTMMALPVKKLLKLLYPNLFRVDEWLLKPSAAHDDFKDVLRRLPLAAE----SLDSRGLYIYDDGFRLVLWFGRMLSPDIAKNLLGVDFAAD-LSRVTFQEQENGMSKKLMRLVKKLRESDPSYHPMCFLVRQGEQPREGFLLLRNLIEDQ-MGGSSGYVDWILQLHRQVQ 1036          
BLAST of Protein transport protein Sec24C vs. TrEMBL
Match: A0A210QA65 (Protein transport protein Sec24C OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT05934 PE=4 SV=1)

HSP 1 Score: 758.059 bits (1956), Expect = 0.000e+0
Identity = 383/799 (47.93%), Postives = 542/799 (67.83%), Query Frame = 2
Query:  644 PQTQSLNPEYMPSAVQVIELDKSNNNAPYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEI-INRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 3037
            P  + L+P+ MPS +QVIE D++N    + T  R   PPLVTT F   DQG CNP+++RS+ Y +P   D+LK+ +IP  L I PFAKL++ E       L   GP+RC RCKAYM+P M FIDGGRRFQC  CG  T+V  E F HLD +GRR+D ++RPELCLGSYE +AT +YCKN TLPN PAFIFM+DVS+NSVKSGL++L C  LK+ IL  L  +    +S +  VGFVTY + +HFYN++ N+++PQMLV+S LD+      VPL++GFLV   E+   I  L+  I   F ++ E   VLGPVI+AG++ALK+A       +IFHSSLP+ EAPGKLK RD+R +LGTDKEKT+ +  +++Y+K+   C  +G S+D+FL P+A+IDVA++SD+ + TGG++YKY +F     G++ ++D++  V S  AFDA++RVRTS G R VDF GNFYM NT DV LA +S  +++ VE++H+DKL E +   +Q+AVL+TS+SGQRRLRIHN+SFN    + D+F+  +LDTL+N+MS+ AV+     + ++VR+ +  + +QILA YR++ A  S   +L+LPE +KLLPLY+N ++K D +Q             G++++TD+R+Y   L++ MDVK + VF YPRL+PL N        +  +P +IR S   L   G YL+ENGIS+ +WIG N +  W+Q++F   S +++ I++  L   +N +S  VN ++Q +R  R R+M L IV Q D++E  F   LVED+G   ++SYVD+LCHIHKEIR +
Sbjct:  438 PAPRKLDPDQMPSPIQVIEDDEANKGGVFSTLERGAAPPLVTTPFTVQDQGNCNPRFMRSTTYTIPCTADLLKTSHIPLALTISPFAKLNDGESAPPIVNLGEVGPVRCKRCKAYMNPFMMFIDGGRRFQCVFCGAQTDVPAEYFQHLDHTGRRVDAYDRPELCLGSYEFVATKDYCKNSTLPNAPAFIFMIDVSYNSVKSGLVHLLCKTLKEEILVNLPKEVGAEES-EIRVGFVTYAKEIHFYNVKGNLAQPQMLVVSDLDDV----FVPLLDGFLVKLSESEAVIDSLLAQIPVMFAESRETETVLGPVIQAGLDALKSADRSGKL-YIFHSSLPIAEAPGKLKNRDDRKLLGTDKEKTILTPQNNFYTKVGQECVVAGCSVDMFLFPNAYIDVASISDVCRLTGGSMYKYSYFQADLDGSRFMEDLKMNVESQAAFDAILRVRTSTGIRPVDFYGNFYMANTTDVELAAMSQGQAIGVEVKHDDKLNEGDGAFVQIAVLFTSVSGQRRLRIHNLSFNCCMQMADLFRSCELDTLVNFMSKQAVRETLNSNPRQVRENVMNQVAQILACYRKSCASPSSAGQLILPECMKLLPLYSNCIIKSDGLQ------------GGSEISTDDRSYLMHLISAMDVKSSHVFFYPRLMPLHN----LEKSAAKMPRSIRCSAERLQDNGVYLLENGISMFMWIGHNVDPHWIQDIFSVQSAAQVDIDKCKLLALDNPLSQRVNEVIQQVREERHRYMKLTIVRQRDKLEPWFNHFLVEDKGLNNSASYVDYLCHIHKEIRGL 1214          
BLAST of Protein transport protein Sec24C vs. TrEMBL
Match: R7U9C7 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_210583 PE=4 SV=1)

HSP 1 Score: 756.518 bits (1952), Expect = 0.000e+0
Identity = 388/798 (48.62%), Postives = 546/798 (68.42%), Query Frame = 2
Query:  647 QTQSLNPEYMPSAVQVIELDKSNNNAPYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEI-INRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 3037
            Q + L+P+ MPS +QVI  DK N +  + +  R  VPPL+TT F+  DQG  NP++IRS++Y +P   DM+K  ++PF L+I PFAKL+  E +    +L   GP+RC RCKAY+ P M FIDGGRRFQC  CG +TEV+ E FAHLD +GRR+D F RPELCLG+YE +ATA+YCK++ LP  PAFIFM+DVS+NS+KSGL++L C +LKD +LP+L  +    +S +  VGFVTY + LHF+NL+S MS+ QM V+S    D     VPL++GFLV   E+   I  L+  I   F ++ E  VVLGPVIEAG++ALK+A        IFHSSLP  EAPGKLK RD+R +LGTDKEKT+ +  ++YY+KL  SC  +G S+DL+L P+++IDV T++++P+ TGG +YKY +F     G +L+ D+++ VS   AFDAV+RVRTS G R VDFLGNFYM NT D+ LA + SDK + VE++H+DKL E +   +Q A+LYTS+SGQRRLR+ N++FNV T + D+F+  +LD L+N +++ A++     + K+VR+++  R +Q+LA YR+N A  S   +L+LPE +KLLP+Y N ++K + +Q              T+++ DER+Y    +N M VK + VF YPRLLPL     +   +S  +P+AIR SY  L   G YLIENG+ +ILW+G   + +W+Q+VF   S ++I I++ ++   +N +S  V  +V+ +R  R R M L IV Q D++E  F++LLVEDRG  G++SYVDFLCHIHKEIR++
Sbjct:    7 QPRRLDPDQMPSPIQVIGDDKRNRSGVFQSAPRGSVPPLITTPFVCEDQGNSNPRFIRSTMYNIPYTNDMMKQCHVPFALSITPFAKLNPKETQPPIVDLGQLGPVRCNRCKAYICPYMQFIDGGRRFQCCFCGCSTEVAPEYFAHLDHTGRRVDTFERPELCLGTYEFVATADYCKDNKLPTSPAFIFMIDVSYNSIKSGLVHLLCQHLKDDVLPHLPRETGATES-EIRVGFVTYAKELHFFNLKSGMSQFQMQVVS----DVEDVFVPLLDGFLVKLSESEGLIESLLSQIPLIFAESRETEVVLGPVIEAGLDALKSADVTGKL-LIFHSSLPTAEAPGKLKNRDDRKLLGTDKEKTVLTPQNTYYTKLGQSCVAAGCSVDLYLFPNSYIDVGTIAEVPRITGGGVYKYTYFQADLDGPRLIADLRNNVSRQIAFDAVLRVRTSTGIRPVDFLGNFYMSNTTDIELAAIDSDKGICVEVKHDDKLSEADGACVQAAILYTSVSGQRRLRVINLAFNVCTQLSDLFRNCELDVLINHLAKMAIRQSLNSNPKQVREDLMNRCAQVLACYRKNCASPSSAGQLILPECMKLLPVYCNCIIKSNLLQ------------GSTEISIDERSYTIHTVNSMSVKASSVFFYPRLLPL----HDIDPDSVSIPTAIRCSYEKLKENGVYLIENGLVLILWVGYGVSPDWVQSVFGVQSAAQIDIDKTTMQDLDNPLSRRVRGLVKRVREDRGRHMKLTIVRQRDKLEPVFQQLLVEDRGSNGSASYVDFLCHIHKEIRNL 782          
BLAST of Protein transport protein Sec24C vs. TrEMBL
Match: V3Z559 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_221280 PE=4 SV=1)

HSP 1 Score: 749.199 bits (1933), Expect = 0.000e+0
Identity = 392/807 (48.57%), Postives = 540/807 (66.91%), Query Frame = 2
Query:  629 GSRYGPQTQ---SLNPEYMPSAVQVIELDKSNNNAPYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEI-INRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 3037
            G+R  PQ Q    L+P+ MPS +QVIE D+ N    + T  R  VPPLV+TDF   DQG CNP+++RS++Y +P   D++K+ +IPF L I PFAKL   E      +    GP+RC RCKAY++P M FIDGGRRFQC  CG  T+V  E FAHLD +GRR DC+NR ELCLGSYE+ AT +YCKN   P  PAFIF++DVS+NSVKSGL+ L C  LKD IL  L  ++ V +S +  VGF TY + LHFYN++  +++PQMLV+S L++      VPL++GFLV   E+   I  L+  I   F ++ E  +VLGPVI+AG++ALK+A       FIFH+SLP+ EAPGKLK RD+R +LGTDKEKTL S  +++Y+KL   C  +G  ++LFL P++++D+A++ ++ + TGGN+YKY +F     G + L+D+   V    AFD ++RVRTS G R VDF GNFYM NT DV LA +  D+++ VEI+H+DKL E +   +QVAVL+TS+SGQRRLRIHN+SFN  T + D+F+  +LDTL+N+ S+ A++     + K+VR+ I    SQILA YR+N A  S   +L+LPE +KLLPLY N ++K D +Q             G++++TD+R+Y   L+N M V+ + VF YPRLLPL         ++K  PSAIR S   L  +G YL+ENG+S+ +WIG N + +W+ +VF  +S ++I I++  L   +N VS  V  I+  IR+ R R++ L IV Q D++ES F   LVED+G  G++SYVDFLCHIHKEIR+I
Sbjct:  143 GTRPAPQPQQPRKLDPDQMPSPIQVIEEDRRNREELFVTNARGAVPPLVSTDFSVQDQGNCNPRFMRSTMYNIPCTSDIIKNSHIPFSLTITPFAKLKPQEPAPPLVDFGELGPVRCKRCKAYINPHMQFIDGGRRFQCVYCGCATDVPNEYFAHLDHTGRRTDCYNRAELCLGSYEMTATKDYCKNGVEPKEPAFIFLIDVSYNSVKSGLVQLICERLKDDILVNLPKEEGVEES-EIRVGFATYGKELHFYNVKGALAQPQMLVVSDLEDV----FVPLLDGFLVKLSESAAVIDSLLAQIPQMFAESRETELVLGPVIQAGLDALKSAERSGKL-FIFHTSLPIAEAPGKLKNRDDRKLLGTDKEKTLLSPQNNFYTKLGQECVAAGCCVELFLFPNSYLDIASIGEVCRLTGGNMYKYSYFQADIDGDRFLEDLSRQVKHSSAFDVILRVRTSTGIRPVDFYGNFYMANTTDVELAALDCDQAINVEIKHDDKLSETDGAYVQVAVLFTSVSGQRRLRIHNLSFNCCTQMADLFRSCELDTLVNYFSKQAIRNILNTNPKQVREHIMNEVSQILACYRKNCANPSSAGQLILPECMKLLPLYGNCVIKNDGIQ------------GGSEISTDDRSYLTHLINSMSVESSSVFFYPRLLPL----HTLDPDTKEFPSAIRCSTERLQDDGVYLLENGLSMFMWIGHNVSSKWVSSVFGVNSAAQIDIDKGQLLALDNPVSHRVMEIISEIRNERHRYLKLTIVRQRDKLESWFNHFLVEDKGLNGSASYVDFLCHIHKEIRNI 927          
BLAST of Protein transport protein Sec24C vs. TrEMBL
Match: A0A1S3HUN3 (protein transport protein Sec24C isoform X2 OS=Lingula unguis OX=7574 GN=LOC106157605 PE=4 SV=1)

HSP 1 Score: 746.117 bits (1925), Expect = 0.000e+0
Identity = 381/798 (47.74%), Postives = 530/798 (66.42%), Query Frame = 2
Query:  647 QTQSLNPEYMPSAVQVIELDKSNNNAPYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEI-INRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 3037
            Q + L+P+ MPS +QVI  D+  N+  + T  R  VPPLVTT+F+  DQG  NP++IRS +Y +P   DM+K  +IP  L I PFA+L   E      +L   GP+RC RCKAYM P M +I+GGRRFQC  CG  T+V  E FAHLD +GRR+DC++RPELCLGSYE++AT EYCKN   P PPA+IFMLDVS+NSVKSGL+ L C+ LK+ IL  L  +    +S +  VGFVTYD+VLHFYN++  +++PQMLV+S +++      +PL++GFLV   E+   I  L+  I   F DT E  + LGPVI+AG++ALKAA       F+FH+SLP+ EAPGKL+ RD+R +LGTDKEKT+ +   ++Y+KL   C  +G  +DLFL P+++IDVA++ ++ + TGG +Y Y +F     G + + D+++ ++ P  FDA+MRVRTS G R VDF GNFYM NT DV LA V +DK++ VEI+H+DKL E E   +QVA+LYTSI+GQRRLRIHN+S N  T + D+F+  +LDTL++ +S+ AVK   +    EVR+++    +QILA YR+N A  S   +L+LPE +KLLP YAN L+K D +Q            +G D++TD+R+Y   L++ M V  + VF YPRL+PL     +   +S  +P  +R S   L   G Y++ENG+S+ +WIG NAN +W+  VF   S +++ I++  L   +N +S+ V  I+  I   R R M L +V Q D++E  F   +VED+G  G SSYVDFLCHIHKEIR++
Sbjct:  403 QPRRLDPDQMPSPIQVITDDQKANSGVFQTAQRGTVPPLVTTEFVTQDQGNANPRFIRSVMYNIPCTNDMIKQCHIPIALTISPFARLQPGELPPPLVDLGEMGPVRCKRCKAYMCPYMQYIEGGRRFQCVFCGAATDVPPEYFAHLDHTGRRVDCYDRPELCLGSYEMVATKEYCKNGVFPKPPAYIFMLDVSYNSVKSGLVELLCSRLKNDILVNLPKETGAAES-EIRVGFVTYDKVLHFYNVKGALAQPQMLVVSDVNDV----FLPLLDGFLVKLSESEAVIDTLLAQIPQLFADTRETEICLGPVIQAGLDALKAADCAGKL-FVFHTSLPIAEAPGKLRNRDDRKLLGTDKEKTILAPHDNFYTKLGVDCVSAGCGVDLFLFPNSYIDVASIGEVCRLTGGQVYMYKYFQGDLDGERFMSDLKNNINRPVGFDAIMRVRTSTGIRPVDFWGNFYMSNTTDVELATVDTDKAISVEIKHDDKLNEEEGAYVQVALLYTSINGQRRLRIHNLSMNCCTQLADVFRSCELDTLISVLSKKAVKDALSVPPAEVREKLINSCAQILACYRKNCASPSSAGQLILPECMKLLPCYANCLIKSDAVQ------------AGGDVSTDDRSYMMHLVSSMPVSASHVFFYPRLMPL----HDLDVDSTSMPPLVRCSAERLKDTGVYILENGLSMFMWIGMNANPDWIHKVFGVQSAAQVDIDKGQLLELDNPMSIRVRGIIAKINQERHRNMKLTVVRQRDKLEPWFMHYMVEDKGSNGTSSYVDFLCHIHKEIRNL 1178          
BLAST of Protein transport protein Sec24C vs. TrEMBL
Match: T1G915 (Uncharacterized protein OS=Helobdella robusta OX=6412 GN=20217562 PE=4 SV=1)

HSP 1 Score: 742.651 bits (1916), Expect = 0.000e+0
Identity = 383/799 (47.93%), Postives = 535/799 (66.96%), Query Frame = 2
Query:  650 TQSLNPEYMPSAVQVIELDKSNNNAPYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEI-INRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSS--YVDFLCHIHKEIRSI 3037
             + L+P+ MPS +QV+E DK  NN  Y TG R  VPPLVT++FI  DQG C+P+++RS++Y +P   D+LK  ++PFV+ + PFAK D  E +    +L   GP+RC RCKAYM P M FIDGGR+FQC  C   TEV  E FAHLD +G+RIDCF +PELCLG+YE +ATA+YCK++ LP  PAFIFM+DVS NS+ SGL+NL C  LK+ IL YL  D+   +S +  VGFVTY   LHFYN+++N+ +PQMLV++    D     VPLV+GFLV   EA   +  L+  I   F +T E+  VLGPVI+AG++AL++A        IFHSS+P  EAPGKLK R+++ +LG++KEKTL +  +++Y+KL   C  +G S+D+FL P+ ++DVAT+S++P+ TGG+LYKY++F     G  L+ D++  +S  FAFD V+R+RTS G R VDF GNF+M NT DV LA +  DK++ +EIRH+DKL E E   +Q AVLYTS+ G+RRLR+ N SFN  T + D+F+  +LD ++N+ ++ A++     SVK+VR+ ++ +  QILASYR+N A  S   +L+LPE +KLLP+Y NSL+K   +Q++N             +  D+R+Y   L+N M +  T  + YPRL+PL+    +   +   LP AIR S   L   GAYL+ENG+ I LW+G + N EW+Q VF   S ++I I++  L   +N VS+ V  +V++IR  R+R+M L IV Q D++E   +  +VEDR    NSS  YVDFLCHIHKEIR+I
Sbjct:    5 ARKLDPDQMPSQIQVLEDDKLKNNGVYVTGQRGSVPPLVTSNFIVDDQGLCSPRFLRSTMYNIPCTSDLLKQSHLPFVVTLSPFAKQDPQENKPPIADLGQMGPLRCNRCKAYMCPNMMFIDGGRKFQCCFCSCTTEVPPEYFAHLDHTGKRIDCFEKPELCLGAYEFVATADYCKDNKLPQAPAFIFMIDVSFNSINSGLINLLCTRLKEDILAYLPKDEGDEES-EVRVGFVTYSNELHFYNIKNNLVQPQMLVVT----DMNDVFVPLVDGFLVKVSEAEAIVDCLLAQIWSMFSNTCEKESVLGPVIQAGLDALRSAERSGKL-IIFHSSMPTAEAPGKLKHREDKNLLGSEKEKTLLTPQTNFYTKLGQECVSAGCSVDIFLFPNMYVDVATISEVPRLTGGSLYKYNYFKADTDGEMLMSDLRTNISRQFAFDVVLRLRTSQGIRAVDFFGNFFMSNTTDVELASLDRDKTISIEIRHDDKLTEAEGAYVQAAVLYTSVGGRRRLRVLNSSFNCCTQVADLFRSCELDVIINFFAKQAIRESLNTSVKQVREHLTNQCVQILASYRKNCATPSSSGQLILPECMKLLPVYINSLIKSGILQTEN-------------INVDDRSYYIHLVNSMSISGTVAYFYPRLIPLL----DIDVDDTSLPHAIRCSSERLKDNGAYLLENGLVIFLWVGLSINAEWIQQVFGVPSVAQIDIDKTKLQDLDNPVSVRVRGMVRMIREERNRYMKLVIVRQRDKLEPVMQMYMVEDRTPLINSSLTYVDFLCHIHKEIRNI 780          
BLAST of Protein transport protein Sec24C vs. Ensembl Cavefish
Match: sec24c (SEC24 homolog C, COPII coat complex component [Source:NCBI gene;Acc:103034639])

HSP 1 Score: 706.442 bits (1822), Expect = 0.000e+0
Identity = 376/798 (47.12%), Postives = 513/798 (64.29%), Query Frame = 2
Query:  659 LNPEYMPSAVQVIELDKSNNNA-PYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKL--DEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPL-VGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEI-INRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 3037
            L+P+ +PS +QVIE DK+N  + P+ TG R + PPLVTT+F   DQG  +P++IR + Y +P   DM K   +P    I P A L  DE    IV  +    GPIRC RCKAYM P M FI+GGRRFQC  C   TEV    F HLD +G+R+DC +RPEL +GSYE MAT +YCKN+ +P PPAFIF++DVS+N+VK+G++ + C  LK  +L YL  +   PD    + VGFVTY++VLHFYN+++++++PQM+V+S    D     VPL++GFLV+  E+   I  L++ I D F DT E   V GPVI+AG+EALKAA       F+FHSSLP+ EAPGKLK R+++ ++GTDKEK+LF    S+Y+ LA  C   G  +DLFL P+ ++DVATL  +P  TGG++YKY +F   +   + L D++  V  P  FDAVMRVRTS G R  DF G+FYM NT DV LA +  DK+V VE RH+DKL E     +Q AVLYTS +GQRRLRIHN++ N    + D+++  + DT++N+ ++ A ++      K VRD +  + +QILA YR+N A  S   +L+LPE +KLLP+Y N +LK D +              G D++ D+RAY   L++ MDV  + VF YPRLLP+     +   ES  LP AIRDS   LS  G YL+E G+++ LW+G NA +E LQN+F   + S+I  +  SLP+  N  S  +  I++  R  RSR+M L +V Q D++E  FK  LVED+   G +SYVDFLCH+HKEIR +
Sbjct:  464 LDPDSIPSPIQVIEDDKANKGSEPFVTGVRGQAPPLVTTNFQVKDQGNASPRFIRCTSYNMPCTSDMAKQSQVPLAAVIKPLATLPPDEIPPYIV--DHGEGGPIRCNRCKAYMCPYMQFIEGGRRFQCGFCSCVTEVPPHYFQHLDHTGKRVDCCDRPELSMGSYEFMATVDYCKNNKIPQPPAFIFLIDVSYNAVKNGMVRMVCQELKT-LLDYLPREN--PDVQSNIRVGFVTYNKVLHFYNVKASLAQPQMMVVS----DVADMFVPLLDGFLVNVSESRVVIESLLDQIPDMFADTRETETVFGPVIQAGLEALKAADCAGKL-FVFHSSLPIAEAPGKLKNREDKKLVGTDKEKSLFQPQISFYANLAKECVTQGCCVDLFLFPNQYVDVATLGVVPTSTGGSVYKYTYFQAQSDQERFLNDLRKDVQKPMGFDAVMRVRTSTGIRATDFFGSFYMSNTTDVELAGLDCDKTVTVEFRHDDKLSEETGALMQCAVLYTSCTGQRRLRIHNMAVNCCAQLADLYRNCETDTIINYFAKYAYRSILNNPTKNVRDSLVNQCAQILACYRKNCASPSSAGQLILPECMKLLPVYLNCVLKSDVLH------------PGADVSLDDRAYLRQLVSAMDVTESHVFFYPRLLPV----HKLDVESDALPVAIRDSEERLSKGGVYLLETGLNLFLWVGANAQQELLQNIFGTPAFSQIDPSMTSLPVLENPYSKRLREIIESFRMQRSRYMKLMVVKQEDKLELIFKHFLVEDKNNSGGASYVDFLCHMHKEIRQL 1235          
BLAST of Protein transport protein Sec24C vs. Ensembl Cavefish
Match: sec24c (SEC24 homolog C, COPII coat complex component [Source:NCBI gene;Acc:103034639])

HSP 1 Score: 704.901 bits (1818), Expect = 0.000e+0
Identity = 375/798 (46.99%), Postives = 513/798 (64.29%), Query Frame = 2
Query:  659 LNPEYMPSAVQVIELDKSNNNA-PYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKL--DEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPL-VGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEI-INRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 3037
            ++P+ +PS +QVIE DK+N  + P+ TG R + PPLVTT+F   DQG  +P++IR + Y +P   DM K   +P    I P A L  DE    IV  +    GPIRC RCKAYM P M FI+GGRRFQC  C   TEV    F HLD +G+R+DC +RPEL +GSYE MAT +YCKN+ +P PPAFIF++DVS+N+VK+G++ + C  LK  +L YL  +   PD    + VGFVTY++VLHFYN+++++++PQM+V+S    D     VPL++GFLV+  E+   I  L++ I D F DT E   V GPVI+AG+EALKAA       F+FHSSLP+ EAPGKLK R+++ ++GTDKEK+LF    S+Y+ LA  C   G  +DLFL P+ ++DVATL  +P  TGG++YKY +F   +   + L D++  V  P  FDAVMRVRTS G R  DF G+FYM NT DV LA +  DK+V VE RH+DKL E     +Q AVLYTS +GQRRLRIHN++ N    + D+++  + DT++N+ ++ A ++      K VRD +  + +QILA YR+N A  S   +L+LPE +KLLP+Y N +LK D +              G D++ D+RAY   L++ MDV  + VF YPRLLP+     +   ES  LP AIRDS   LS  G YL+E G+++ LW+G NA +E LQN+F   + S+I  +  SLP+  N  S  +  I++  R  RSR+M L +V Q D++E  FK  LVED+   G +SYVDFLCH+HKEIR +
Sbjct:  458 IDPDAIPSPIQVIEDDKANKGSEPFVTGVRGQAPPLVTTNFQVKDQGNASPRFIRCTSYNMPCTSDMAKQSQVPLAAVIKPLATLPPDEIPPYIV--DHGEGGPIRCNRCKAYMCPYMQFIEGGRRFQCGFCSCVTEVPPHYFQHLDHTGKRVDCCDRPELSMGSYEFMATVDYCKNNKIPQPPAFIFLIDVSYNAVKNGMVRMVCQELKT-LLDYLPREN--PDVQSNIRVGFVTYNKVLHFYNVKASLAQPQMMVVS----DVADMFVPLLDGFLVNVSESRVVIESLLDQIPDMFADTRETETVFGPVIQAGLEALKAADCAGKL-FVFHSSLPIAEAPGKLKNREDKKLVGTDKEKSLFQPQISFYANLAKECVTQGCCVDLFLFPNQYVDVATLGVVPTSTGGSVYKYTYFQAQSDQERFLNDLRKDVQKPMGFDAVMRVRTSTGIRATDFFGSFYMSNTTDVELAGLDCDKTVTVEFRHDDKLSEETGALMQCAVLYTSCTGQRRLRIHNMAVNCCAQLADLYRNCETDTIINYFAKYAYRSILNNPTKNVRDSLVNQCAQILACYRKNCASPSSAGQLILPECMKLLPVYLNCVLKSDVLH------------PGADVSLDDRAYLRQLVSAMDVTESHVFFYPRLLPV----HKLDVESDALPVAIRDSEERLSKGGVYLLETGLNLFLWVGANAQQELLQNIFGTPAFSQIDPSMTSLPVLENPYSKRLREIIESFRMQRSRYMKLMVVKQEDKLELIFKHFLVEDKNNSGGASYVDFLCHMHKEIRQL 1229          
BLAST of Protein transport protein Sec24C vs. Ensembl Cavefish
Match: sec24c (SEC24 homolog C, COPII coat complex component [Source:NCBI gene;Acc:103034639])

HSP 1 Score: 704.901 bits (1818), Expect = 0.000e+0
Identity = 375/798 (46.99%), Postives = 513/798 (64.29%), Query Frame = 2
Query:  659 LNPEYMPSAVQVIELDKSNNNA-PYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKL--DEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPL-VGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEI-INRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 3037
            ++P+ +PS +QVIE DK+N  + P+ TG R + PPLVTT+F   DQG  +P++IR + Y +P   DM K   +P    I P A L  DE    IV  +    GPIRC RCKAYM P M FI+GGRRFQC  C   TEV    F HLD +G+R+DC +RPEL +GSYE MAT +YCKN+ +P PPAFIF++DVS+N+VK+G++ + C  LK  +L YL  +   PD    + VGFVTY++VLHFYN+++++++PQM+V+S    D     VPL++GFLV+  E+   I  L++ I D F DT E   V GPVI+AG+EALKAA       F+FHSSLP+ EAPGKLK R+++ ++GTDKEK+LF    S+Y+ LA  C   G  +DLFL P+ ++DVATL  +P  TGG++YKY +F   +   + L D++  V  P  FDAVMRVRTS G R  DF G+FYM NT DV LA +  DK+V VE RH+DKL E     +Q AVLYTS +GQRRLRIHN++ N    + D+++  + DT++N+ ++ A ++      K VRD +  + +QILA YR+N A  S   +L+LPE +KLLP+Y N +LK D +              G D++ D+RAY   L++ MDV  + VF YPRLLP+     +   ES  LP AIRDS   LS  G YL+E G+++ LW+G NA +E LQN+F   + S+I  +  SLP+  N  S  +  I++  R  RSR+M L +V Q D++E  FK  LVED+   G +SYVDFLCH+HKEIR +
Sbjct:  487 IDPDAIPSPIQVIEDDKANKGSEPFVTGVRGQAPPLVTTNFQVKDQGNASPRFIRCTSYNMPCTSDMAKQSQVPLAAVIKPLATLPPDEIPPYIV--DHGEGGPIRCNRCKAYMCPYMQFIEGGRRFQCGFCSCVTEVPPHYFQHLDHTGKRVDCCDRPELSMGSYEFMATVDYCKNNKIPQPPAFIFLIDVSYNAVKNGMVRMVCQELKT-LLDYLPREN--PDVQSNIRVGFVTYNKVLHFYNVKASLAQPQMMVVS----DVADMFVPLLDGFLVNVSESRVVIESLLDQIPDMFADTRETETVFGPVIQAGLEALKAADCAGKL-FVFHSSLPIAEAPGKLKNREDKKLVGTDKEKSLFQPQISFYANLAKECVTQGCCVDLFLFPNQYVDVATLGVVPTSTGGSVYKYTYFQAQSDQERFLNDLRKDVQKPMGFDAVMRVRTSTGIRATDFFGSFYMSNTTDVELAGLDCDKTVTVEFRHDDKLSEETGALMQCAVLYTSCTGQRRLRIHNMAVNCCAQLADLYRNCETDTIINYFAKYAYRSILNNPTKNVRDSLVNQCAQILACYRKNCASPSSAGQLILPECMKLLPVYLNCVLKSDVLH------------PGADVSLDDRAYLRQLVSAMDVTESHVFFYPRLLPV----HKLDVESDALPVAIRDSEERLSKGGVYLLETGLNLFLWVGANAQQELLQNIFGTPAFSQIDPSMTSLPVLENPYSKRLREIIESFRMQRSRYMKLMVVKQEDKLELIFKHFLVEDKNNSGGASYVDFLCHMHKEIRQL 1258          
BLAST of Protein transport protein Sec24C vs. Ensembl Cavefish
Match: sec24d (SEC24 homolog D, COPII coat complex component [Source:NCBI gene;Acc:103036498])

HSP 1 Score: 642.114 bits (1655), Expect = 0.000e+0
Identity = 344/801 (42.95%), Postives = 494/801 (61.67%), Query Frame = 2
Query:  641 GPQTQSLNPEYMPSAVQVIELDKSNNNAP-YPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEI-INRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 3037
            GP  + L+P+ +PS  QVIE D++      Y T  R +VPPLVTT+F   DQG  +P+++R + Y+ P   D+ K   +P    I PFAK+ + E  +        GPIRC RCKAYM P M FIDGGRR+QC  C    EV  + F HLD  GRR+D + RPEL LGSYE  AT +YCKN+  PNPPA+IFM+DVS+N++KSGL+ L C  LK  +L  L  ++   +S    VGFVTY+++LHFYN++S +++PQM+V+S    D     VPL++GFLV+  E+   I+ L++ I D F DT E   V  PV++AG+EALKAA       FIFHSSLP  EAPGKLK RD+R ++ T+KEKTLF      Y +L   C   G S+DLF+ P+ ++D+AT+ ++   TGG++YKY  F     G   L D++  V     FDA+MRVRTS G R  D  G  YM NT D+ +A V  DK+V VE +H+D L E     IQ A+LYTSISGQRRLRIHN+S N S+ + +++K  + D L+N+ +++A      + VK VR+ + ++++ +LA YR++ A  S  ++L+LP+ +K+ P+Y NSL+K   +               T+L+TD+RA+    +  + V+ +Q+ +YPRL+P+          S+ +P A+R S   LS  G +L+ENG S+ LW+GQ    E +QN+F+  S + +  +  SLP  +N  S ++  I+  I   R   M + IV Q DR E  F++ LVED+G  G +SY+DFLC++H+EIR +
Sbjct:  298 GPPQKKLDPDSIPSTTQVIEDDQAKRGGQLYTTNLRGQVPPLVTTNFTVQDQGNASPRFMRCTTYSFPCTTDLAKQCQVPLATIIKPFAKVPQNETPLYVVNHGEAGPIRCNRCKAYMCPFMLFIDGGRRYQCAFCNCVNEVPVQYFQHLDHMGRRVDLYERPELSLGSYEFTATLDYCKNNKPPNPPAYIFMIDVSYNNIKSGLVKLICEELKT-LLDRLPKEEGT-ESSAIRVGFVTYNKILHFYNVKSALAQPQMMVVS----DVAEMFVPLLDGFLVNFQESRAVINNLLDQIPDMFGDTNESETVFAPVVQAGVEALKAAECSGKL-FIFHSSLPTAEAPGKLKNRDDRKLVNTEKEKTLFQPQRGVYEQLTKDCVGQGCSVDLFVFPNQYMDIATMGNISTHTGGSVYKYSNFQIQVDGEHFLTDLRRDVERSIGFDAIMRVRTSTGFRATDIFGAIYMNNTTDIEMAAVDCDKAVTVEFKHDDTLSEESGALIQCALLYTSISGQRRLRIHNLSLNCSSQLSELYKSCETDALINFFAKSAYNAVLNQPVKTVREILVKQTAHMLACYRKHCASPSAASQLILPDAMKVFPVYMNSLMKSPVLVGS------------TELSTDDRAFHRLSVMSLGVEESQILMYPRLIPV----HSMDVSSEVVPVAVRCSEERLSETGVFLLENGQSLFLWLGQACPPELVQNLFNVPSLAHLSADMTSLPELDNAHSKKLRSIISTISQQRPNSMKMVIVKQKDRSEMLFRQYLVEDKGLHGGASYMDFLCYVHREIRQL 1075          
BLAST of Protein transport protein Sec24C vs. Ensembl Cavefish
Match: sec24a (protein transport protein Sec24A [Source:NCBI gene;Acc:103040517])

HSP 1 Score: 313.153 bits (801), Expect = 1.525e-90
Identity = 215/796 (27.01%), Postives = 400/796 (50.25%), Query Frame = 2
Query:  677 PSAVQVIELDKSNNNAPYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGT-------KLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSE----FSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEI-INRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEI 3028
            P A+ V+ L +  N    P G      P +  D   ++   C+P+  RS++ ++P    +L    +P  L + PF  L +    +V         +RC  C+ Y++P ++F+D  RR++CN+C    +V EE F +   S    +   RPE+   + E +A +EY      P P  ++F+LDVSHN+V++G L++ C +L +++         +P   +  +G +T+D ++HFYNLQ  +S+PQML++S L++      +P  +  LV+  E+ E +  L++++   F  T E +  LGP ++A  + +   GGR     +F + LP +   G LK+R++     + K+    S  + +Y KLA  CS   V++DLF+  + + D+ATL  + + + G++Y    F PS H         +  KD++  ++    F+AVMR+R + G     F GNF++++T+ ++L  V+ D    V++   + L + + V+ Q A+LYTS  G+RR+R+H +   V  ++ DIF   D+  +   ++  AV      S+ + RD ++  +   L SYR +     +P             L A + L C F     + + ++   +GT    D+R +  + +    + +  + ++P L  L +   E     +  +   P A++ S   LS +GA+L++ G  + LW+G++ N  +L  V    + + + +N+  LP  +   S      +  IR  R  + +L+++     M+S+F + ++EDR E    SY +FL H+ +++
Sbjct:  225 PEALLVLNLLQERNL--LPAGPVPAPTPCLPQDLQKLN---CSPEVFRSTLTSIPQTQSLLNKAKLPLGLLLHPFKDLSQLP--VVTSSTI----VRCRSCRTYINPFVSFLDQ-RRWKCNLCYRVNDVPEE-FMYNPVSRSYGEPHKRPEVQNATIEFIAPSEYMLRP--PQPAVYLFLLDVSHNAVETGYLDVVCQSLLENL-------NSLPGDTRTKIGLITFDSMIHFYNLQDGLSQPQMLIVSDLEDI----FLPTPDSLLVNLSESKELVRDLLKSLPQMFTKTMETHSALGPALQAAFKLMSPTGGRVT---VFQTQLPTLGV-GALKSREDPNQRASAKDVQHLSPATDFYKKLALDCSGQQVAVDLFMLSAQYCDLATLGCISRYSAGSVY----FYPSYHTEHNPAQTERFQKDLKRYLTRKIGFEAVMRIRCTKGLSIHTFHGNFFVRSTDLLSLPNVNPDAGFAVQMSIEENLVDMQVVSFQAALLYTSSKGERRIRVHTMCLPVVNSMSDIFAGADVQAITCLLASMAVDRSVTASLSDARDAVTNAAIDSLVSYRSSVLTIQQPG------------LLAPACL-CLFPLYILALLKQRAFRTGTSTRLDDRVFAMYQLKYQPLSYLMLMIHPALYRLDDLTDEGALNINDRTIPQPRALQLSVEKLSRDGAFLMDTGSDLYLWVGKSCNPTFLNQVLGVQNYANVPLNQNQLPELDTAESARTRAFIGWIREQRPFYPVLHLIRDESPMKSSFMQNMIEDRTESA-LSYYEFLLHVQQQV 972          
BLAST of Protein transport protein Sec24C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008390.1 (pep scaffold:Pmarinus_7.0:GL476543:210227:241126:1 gene:ENSPMAG00000007550.1 transcript:ENSPMAT00000008390.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 670.233 bits (1728), Expect = 0.000e+0
Identity = 355/806 (44.04%), Postives = 505/806 (62.66%), Query Frame = 2
Query:  626 TGSRYGPQTQSLNPEYMPSAVQVIELDK-SNNNAPYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINRYS-LPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 3037
            +G +  P  + L+P+ +PS +QVIE D+   +N PY T  R +VPPLVTTDF+  DQG  +P++IR + Y +P   +M K   +P    I P A L   E      +    GP+RC RCKAY+ P M FI+GGRRFQC  C   TEV +  F HLD +GRR+D ++RPEL LGSYE +AT +YCK +  PNPPAFIFM+DVS+N++KSGL++L C  LK  +       Q+   + +  VGFVTY++ LHFYNL++++++PQM+V+S    D     VPL++GFLV+  E+   I  L+E I + F DT E   V  PVI+AGME+LKAA       F+FH+SLP+ EAPGKLK RD+R ++ TDKEKTLF + S+ Y  LA  C  +G  +DLFL P+ F+DVATL  +   TGG++YKY++F  ++ G + L D++  V     FDAVMRVRTS G R  DF G  YM NT DV LA +  DK+V VEI+H+DKL E     +Q A+LYTS+SGQRRLR+HN++ N    + D+++  + D+++N+ ++   +       K VR+ +  + +Q+L+ YR+N A  S   +L+LPE +KLLP+Y N +LKC+ +              G D+ATD+RAY   L+   D   +  F YPRLLPL     E    S+ LP ++R S   L   G Y++ENG+S+ LW+G +   + L+ +F+  +  +I    + LP+ +N  +  V  ++  IR+ R R+M L +V Q D+ME  FK LLVED+   G ++YVDFLCH+HKEIR +
Sbjct:  309 SGPQQPPGPRRLDPDSIPSPIQVIEDDRMQRSNDPYITSVRGQVPPLVTTDFLVKDQGNASPRFIRCTSYNLPCTSEMAKQSQVPLAAIIKPLATLPVEETPPYIVDHGETGPVRCNRCKAYICPNMQFIEGGRRFQCGFCNCVTEVPQHYFQHLDHTGRRVDHWDRPELSLGSYEFIATVDYCKENKPPNPPAFIFMIDVSYNAIKSGLVSLVCEELKTLVNHLPREGQMEQSALR--VGFVTYNKTLHFYNLKASLAQPQMMVVS----DVADVFVPLLDGFLVNAVESRPVIESLLEQIPEMFADTRETETVFVPVIQAGMESLKAAECAGKL-FVFHTSLPIAEAPGKLKNRDDRKLVNTDKEKTLFQAQSNIYHSLAKDCVAAGCCVDLFLFPNQFVDVATLGLVTLQTGGSIYKYNYFQSNSDGERFLNDLRRDVQKTIGFDAVMRVRTSTGVRATDFFGAIYMSNTTDVELAAIDCDKAVTVEIKHDDKLNEETGAFLQCALLYTSVSGQRRLRVHNLALNCCNQMSDMYRNCETDSMINYFAKATFRAVAHNPTKTVRESLVNQCAQVLSCYRKNCASPSSAGQLILPECMKLLPVYLNCVLKCEVLL------------GGADIATDDRAYLQQLLLSADNTQSAAFFYPRLLPL-----ELDVASEELPVSVRCSEERLQDGGLYILENGLSLFLWVGISVPHDLLKALFNVDTFGQIDGEMTMLPVLDNPFNKRVRDMIDSIRAERPRYMKLMVVKQRDKMELLFKHLLVEDKSLNGGATYVDFLCHMHKEIRQL 1090          
BLAST of Protein transport protein Sec24C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000115.1 (pep scaffold:Pmarinus_7.0:GL477477:43963:54842:1 gene:ENSPMAG00000000098.1 transcript:ENSPMAT00000000115.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 298.13 bits (762), Expect = 2.162e-87
Identity = 222/763 (29.10%), Postives = 373/763 (48.89%), Query Frame = 2
Query:  785 IDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNV--VLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGT-------KLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHL----PSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEII--NRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEI 3028
            + Q  C+P   R ++  +P  P +L    +P  L + PF  L +         +     +RC  C+ Y++P +TFID  RR++CN+C    EV + +F +   +    +   RPE+   + E +A +EY      P P  +IF+LDVS ++V+ G L + CN++ +H+      D+L  DS +  VG VT+D  +HFY+LQ   ++PQM+V++ +D+      +P   G LV+  E+ E    L++++   F    ER     LGP ++A    L A GGR     +F S LP V  PG LK R+    +G    + L S  + +Y KLA  CS    ++DLFL  S + D+ATLS + + + G +Y Y    PS H         +L  D+Q  ++    F+AVMR+R + G     F GNF++++T+ ++L  V+ D    V++   + L +  +V+ Q A+LYTS  G+RR+R+H +   V T ++DI+   D+  +   +++ AV    + S+ + RD +   +   LA+YR        PA+  L     L  L   +           + + ++   SG  +  DERA+    M    +    + ++P L  + N   +       +    P  ++ S   LS +GA+L+++G  + LW+G+     +L  V    + + I    ++SLP   N  S  V   V  +R  R+    L I+       SAF + LVEDR E    SY + L H+ +++
Sbjct:   63 MQQRNCHPDIFRCTLTNIPQTPSLLSKAKLPLGLLLHPFKDLQQLP------VITASTIVRCRACRTYINPFVTFIDQ-RRWKCNLCFRVNEVPD-DFMYNPLTRSYGEPQKRPEIRNATIEFIAPSEYMVRP--PQPAVYIFLLDVSFHAVECGYLPVVCNSILEHL------DRLPGDS-RTKVGIVTFDSAIHFYSLQEGQARPQMVVVTDIDDV----FIPSPEGLLVNLQESKELFRELLQSLPTVFPSGAERETQSALGPALQAAHSLLGATGGRVT---VFQSQLPSV-GPGALKPRE----VGAKGTEGL-SPVTDFYKKLALDCSAQQTAVDLFLLSSQYADLATLSCISRFSSGAVYYY----PSPHPVHAPAQLERLRSDLQRYLTRKIGFEAVMRIRCTKGLSIHTFHGNFFVRSTDLLSLPNVNPDAGFAVQVSIEEALGDAATVSFQAALLYTSSKGERRIRVHTLCLPVVTTLVDIYAGADVQAVTALLAKMAVDRTLSSSLSDARDALVNAAVDFLAAYR---GSGGGPAQSGLTAPHGLRLLPLYA----------LALLKQKAFGSGKSVRLDERAFAMCEMKHQPLGQLMLAVHPSLYRVDNLTEKGGVMEGDVLVPQPPVLQLSAERLSGDGAFLLDSGTVLQLWVGRGVGLAFLHEVLGVQNVAAIQTNTQWSLPELPNAASERVRAFVSWLRRHRAFPPPLQIIRDDGASRSAFVQSLVEDRTESA-MSYYELLLHVQQQV 777          
BLAST of Protein transport protein Sec24C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000116.1 (pep scaffold:Pmarinus_7.0:GL477477:44390:54842:1 gene:ENSPMAG00000000098.1 transcript:ENSPMAT00000000116.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 294.278 bits (752), Expect = 4.317e-86
Identity = 220/766 (28.72%), Postives = 375/766 (48.96%), Query Frame = 2
Query:  785 IDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNV--VLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARD---ERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGT-------KLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHL----PSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEII--NRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEI 3028
            + Q  C+P   R ++  +P  P +L    +P  L + PF  L +         +     +RC  C+ Y++P +TFID  RR++CN+C    EV + +F +   +    +   RPE+   + E +A +EY      P P  +IF+LDVS ++V+ G L + CN++ +H+      D+L  DS +  VG VT+D  +HFY+LQ   ++PQM+V++ +D+      +P   G LV+  E+ E    L++++   F    ER     LGP ++A    L A GGR     +F S LP V  PG LK R+   ++ +  +  E+ +    + +Y KLA  CS    ++DLFL  S + D+ATLS + + + G +Y Y    PS H         +L  D+Q  ++    F+AVMR+R + G     F GNF++++T+ ++L  V+ D    V++   + L +  +V+ Q A+LYTS  G+RR+R+H +   V T ++DI+   D+  +   +++ AV    + S+ + RD +   +   LA+YR        PA+  L     L  L   +           + + ++   SG  +  DERA+    M    +    + ++P L  + N   +       +    P  ++ S   LS +GA+L+++G  + LW+G+     +L  V    + + I    ++SLP   N  S  V   V  +R  R+    L I+       SAF + LVEDR E    SY + L H+ +++
Sbjct:   53 MQQRNCHPDIFRCTLTNIPQTPSLLSKAKLPLGLLLHPFKDLQQLP------VITASTIVRCRACRTYINPFVTFIDQ-RRWKCNLCFRVNEVPD-DFMYNPLTRSYGEPQKRPEIRNATIEFIAPSEYMVRP--PQPAVYIFLLDVSFHAVECGYLPVVCNSILEHL------DRLPGDS-RTKVGIVTFDSAIHFYSLQEGQARPQMVVVTDIDDV----FIPSPEGLLVNLQESKELFRELLQSLPTVFPSGAERETQSALGPALQAAHSLLGATGGRVT---VFQSQLPSV-GPGALKPREVGAKKLLKVSIHERAI----TDFYKKLALDCSAQQTAVDLFLLSSQYADLATLSCISRFSSGAVYYY----PSPHPVHAPAQLERLRSDLQRYLTRKIGFEAVMRIRCTKGLSIHTFHGNFFVRSTDLLSLPNVNPDAGFAVQVSIEEALGDAATVSFQAALLYTSSKGERRIRVHTLCLPVVTTLVDIYAGADVQAVTALLAKMAVDRTLSSSLSDARDALVNAAVDFLAAYR---GSGGGPAQSGLTAPHGLRLLPLYA----------LALLKQKAFGSGKSVRLDERAFAMCEMKHQPLGQLMLAVHPSLYRVDNLTEKGGVMEGDVLVPQPPVLQLSAERLSGDGAFLLDSGTVLQLWVGRGVGLAFLHEVLGVQNVAAIQTNTQWSLPELPNAASERVRAFVSWLRRHRAFPPPLQIIRDDGASRSAFVQSLVEDRTESA-MSYYELLLHVQQQV 771          
BLAST of Protein transport protein Sec24C vs. Ensembl Sea Lamprey
Match: sec24b (SEC24 homolog B, COPII coat complex component [Source:ZFIN;Acc:ZDB-GENE-030131-6565])

HSP 1 Score: 275.404 bits (703), Expect = 2.232e-79
Identity = 209/763 (27.39%), Postives = 377/763 (49.41%), Query Frame = 2
Query:  785 IDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGT-------KLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSA----ESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFD----CSSPSEIINRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEI 3028
            + +  C+P+ +RS++  +P +P +L    +P  L + PF   D A+  ++   +     +RC  C+ Y++P + FID  RR++CNIC    +  EE F +   +    +   RPE+   + E +A +EY      P P  ++F+ DVS+ ++ SG L++ C +L +++      D+  P   +  +GFVT+D  +HFY +  ++S+P MLV+   D D     +P     LV+  +  E +  L+  +   F+ T E    LGP ++A  + +   GGR     +F + LP +   G L++R++  +  + K       G+ +Y KLA  CS   +++DLFL    + D+ATL+ + + + G +Y    F PS H         +L KD+Q  ++    F+AVMR+R S G     F GNF++++T+ ++L  V+ D    V++  ++ L +    + Q A+LYTS  G RR+R+H +   V   + +I+   D+  +   ++  AV+     S+ + RD +    +  L+ +R   +   +   LV P +L LLPLY ++LLK    +             GT    DER +    M    + H    ++P L  + N   + +     +S   P  ++ S  +L+++GA+L++ G  + +W+G+N +  ++++V       S P+ +++   LP  +N  S      +  IR  R      +I+         F + LVEDR E  + SY +FL HI ++I
Sbjct:   57 LSKRNCSPEVLRSTLTNLPQSPALLAKAKLPLGLVLHPFK--DLAQLPVITSSVI----VRCRSCRTYINPFVAFIDQ-RRWRCNICYRINDAPEE-FMYNPITRSYGEPQKRPEVQNSTVEFIAPSEYMLRP--PQPAVYLFLFDVSYGAIDSGYLSMVCESLLENL------DR--PGDSRTKIGFVTFDSSVHFYQMHESLSQPHMLVVP--DIDAIDVFIPTSEHLLVNLQDRKELVRELVRALPGRFRRTHETRSALGPALQAAHKLVAPTGGRVT---VFQTQLPNL-GHGALQSREDPNVRASTKNVQHLRPGTDFYKKLALDCSGHQIAVDLFLLSGQYADLATLACVSRYSSGAVY----FYPSFHRVHTPVQVERLEKDLQRYLTRKIGFEAVMRIRCSKGVSIHTFHGNFFVRSTDLLSLPNVNPDAGFAVQMSIDETLTDTTLCSFQAALLYTSSKGDRRIRVHTLCLPVVNTLAEIYHGADVQAITGLLATMAVERSVTSSLPDARDALVNAVADSLSGFRSTVSNLQQ-GGLVAPRSLSLLPLYVHALLKHTAFR------------LGTSTRLDERVFAMCQMKSQPLVHLMPMIHPHLYRIDNLMQQVTMNINDKSVPQPPILQLSSEHLNTDGAFLLDCGSVLYIWVGRNCSNRFIKDVLGFPNYISIPNTMVD---LPELDNTTSERTRDFLSWIREPRPFHSTQHIIKDDSTNRMIFIEHLVEDRSE-SSMSYSEFLQHIQRQI 774          
BLAST of Protein transport protein Sec24C vs. Ensembl Yeast
Match: SFB3 (Component of the Sec23p-Sfb3p heterodimer of the COPII vesicle coat; COPII coat is required for cargo selection during vesicle formation in ER to Golgi transport; scaffolding function of Lst1p required to generate vesicles that can accommodate difficult cargo proteins that include large oligomeric assemblies and asymmetrically distributed membrane proteins; homologous to Sec24p and Sfb2p [Source:SGD;Acc:S000001140])

HSP 1 Score: 228.409 bits (581), Expect = 2.255e-62
Identity = 206/795 (25.91%), Postives = 361/795 (45.41%), Query Frame = 2
Query:  743 RDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKG-PIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEY-CKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQIS---ILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFH-SSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYV-----SEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSE-----FSAESKHLPS--------AIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVF--DCSSPSEIINRYS--LPIHNNNVSLEVNRIV----QIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIR 3031
            RD VPPL TT F  +DQG+C+P  +  S+Y +P +  +  +  +P  L I PF+ L   +  +    L   G P+RC RC+AY +P   F        CNIC    +V  E+FA +  +G+R D   + EL  G+ + +  + Y    +    P  ++F++DVS  + ++G        ++  I  Y++  Q     P   V  + YD  L F+NL+ ++   Q  ++S LD+      +P  NG  V P  +++ I+   I +   I   K +    V  G  ++A   AL    G  G   I   +SLP +   G L  + +   +   K        + +Y KLA    +S +S+DL++T + FID+AT+    + T G L  Y  F        L+ D+   VS+   + A+++VR S G     +  +       D  +  ++ D ++ V ++++ K++    V+ Q A+LYT I G R++R  N S  VS NI +IFK  + + +M  M ++ +KT       ++R  I  +  +IL  YR   +  S                 +  L+  D +++  +Y+     SE  + +      +ER Y     + ++       LYP+++P      E     + A  K L          ++R S+ N  + G YLI  G +I LW  +N NR  LQ++   D S P   I+ +S  LP    +++ + + ++    Q++  +    ++L   +      +   +LL ED+      SY ++L  +HK+I+
Sbjct:  144 RDSVPPLPTTQFYCVDQGSCDPHLMSLSMYNIPESEHLRAATKLPLGLTIQPFSTLTPNDAEVPTIPLPMDGTPLRCRRCRAYANPKFQFTYDSSVI-CNICRVKMQVPGEHFAPMGPNGQRSDLNEKSELLHGTVDFLVPSIYNAIQEKELLPLHYVFLIDVSLLANENGSSLAMVEGVRSCI-EYISDFQ-----PNCEVAIIVYDNKLRFFNLRPDLDNAQEYIVSELDDV----FLPFYNGLFVKPGNSMKIINDTLIKISGYISTDKYSHVPQVCYGSALQAAKLALDTVTGGQGGKIICSLNSLPTI-GNGNLSLKRDNAHIAHVK------CDNGFYKKLASDFLKSYISLDLYVTNAGFIDMATVGHPVEMTSGILKYYPHFQQETDAFTLVNDMVTNVSNIVGYQALLKVRCSTGLSVEQYYCDSSDNTDHDPIIPVLTRDTTLDVLLKYDSKIKTGTDVHFQTALLYTDIDGVRKVRSINTSGAVSNNIREIFKFINQNPVMRIMIKDVIKTLGDCDFVKIRRLIDDKMVEILTQYRGLVSSNS-----------------STQLILPDSIKTLPAYMLAFEKSELMKPNAQSTRGNERIYDLLKYDSLNSAQLCYKLYPQIVPFHVLLEETDLTFYDANDKLLQINSSSINNLSVRASHSNFINGGCYLIFQGDTIYLWFNENTNRMLLQDLLSVDESLPVSQISLFSGTLPETGTSINQKASNVIKNWQQVVNKSSLPLVLLRPNVD-QYYSNVMSQLLCEDKTVNRIESYDNYLVIMHKKIQ 902          
BLAST of Protein transport protein Sec24C vs. Ensembl Yeast
Match: SFB2 (Component of the Sec23p-Sfb2p heterodimer of the COPII vesicle coat; required for cargo selection during vesicle formation in ER to Golgi transport; homologous to Sfb3p; SFB2 has a paralog, SEC24, that arose from the whole genome duplication [Source:SGD;Acc:S000004994])

HSP 1 Score: 226.098 bits (575), Expect = 7.865e-62
Identity = 195/723 (26.97%), Postives = 344/723 (47.58%), Query Frame = 2
Query:  809 KYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPI-RCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQS--GRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPD-SPKPLVGFVTYDRVLHFYNL-----------------------------QSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQ-ISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKT-LFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPS--NHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVF---LYPRLLPLINAKSEFSA---ESKH-LPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEI-INRYSLPIHNNN 2842
            +Y+RS++ AVP    +LK   +PF + I P+  L +++ ++    LN  G I RC RC++YM+P + FI+ GR++QCNIC    +V        DQ+  G  I+ + R E+     + +A  EY   +  P P  ++F+LDVS N+VK+GLL      + ++I       + +P+   +  +  +  D  LH++ +                               N    QM  I  LD       +P+ +  LV P +  +  +  L++ I + F+DT      LGP ++A    +K+ GG+     +  S+LP     GKLK R E+ IL T KE + L S   S+Y      C++  +++D+FL    ++DVATLS L + +GG  + Y  F+ +  N  TK  +++   +S   + +AVMRVR S G R   F G+F+ ++++    + +  D+S +  I   D L   E   +QV+ L T  +G+RR+R+  ++   S +  ++F   D   + ++M++NAV      S+   RD I++    IL +Y++  +  +         ++  L L AN  +    M   + +++ +     +D       Y+   +N ++ +        +YP +  L +   E      E K  LP  I  +       G YLI+N   + LW+G +A  E L +VF+  + S+I + +  LP+ N++
Sbjct:  113 QYVRSTLKAVPKTNSLLKKTKLPFAIVIRPYLHLQDSDNQV---PLNTDGVIVRCRRCRSYMNPFVVFINQGRKWQCNICRFKNDVP----FGFDQNLQGAPINRYERNEIKNSVVDYLAPVEYSVRE--PPPSVYVFLLDVSQNAVKNGLLATSARTILENI-------EFLPNHDGRTRIAIICVDHSLHYFYVPLDDDYEVSDEDDEESDGEEEDEDEEEEDVDNSETIQMFDIGDLD----EPFLPMPSDELVVPLKYCKNNLETLLKKIPEIFQDTHSSKFALGPALKAASNLIKSTGGKVE---VISSTLPNT-GIGKLKKRSEQGILNTPKESSQLLSCKDSFYKTFTIECNKLQITVDMFLASEDYMDVATLSHLGRFSGGQTHFYPGFNATSLNDVTKFTRELSRHLSMDISMEAVMRVRCSTGLRATSFFGHFFNRSSDLCAFSTMPRDQSYLFGISIEDSLMA-EYCYLQVSTLLTLNTGERRIRVMTLALPTSESAREVFASADQLAITDFMTQNAVTKALNSSMYSARDFITKSLEDILNAYKKEISMSN-------INSVTSLNLCANLRMLPLLMNGLSKHIALRPGVVPSD-------YRASALNRLETEPLHYLIKSIYPTVYSLHDMPDEVGLPDFEGKTVLPEPINATISLFERYGLYLIDNSAELFLWVGGDAVPELLIDVFNTDTISQIPVGKSELPLLNDS 796          
BLAST of Protein transport protein Sec24C vs. Ensembl Yeast
Match: SEC24 (Component of the Sec23p-Sec24p heterodimer of the COPII vesicle coat; required for cargo selection during vesicle formation in ER to Golgi transport; homologous to Sfb3p; SEC24 has a paralog, SFB2, that arose from the whole genome duplication [Source:SGD;Acc:S000001371])

HSP 1 Score: 205.297 bits (521), Expect = 7.556e-55
Identity = 190/715 (26.57%), Postives = 329/715 (46.01%), Query Frame = 2
Query:  800 CNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPI-RCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRR--IDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYN--LQSNMSKPQMLVISYLD-NDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKT-LFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHG--TKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEF----------SAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEI-INRYSLP-IHNNNVSLEVNRIVQIIR 2881
             +P YIRS++ AVP    +LK   +PF L I P+  L +    I    LN  G I RC RC++YM+P +TFI+ GRR++CN C    +V  +    +DQS        ++R E+     E MA  EY      P P  + F++DVS +S+KSGLL    N L  ++      D +     +  +  +  D  +H++   L S  ++     I+ +D  D     +P  N  +V      + I  L+  I   F+     N  LGP +++        GG  GK+ +   +LP +   GKL+ R+E  ++ T KE   L S   S+Y      CS+  +++DLFL    ++DVA+LS+L + T G  + Y  FS  N     K   +    +S  F  + VMR R S G R   F G+F+ ++++    + +  D+S + E+  ++ +  +    +QVAVL +  + QRR+RI  ++   + ++ +++   D   + ++ +  AV+     S+ + R  I++    ILA+Y++     +      L          AN  +    M S   +++ +   SG  + +D RA     +  + +K+    +YP +  L +   E           +  +  LP  I  +       G YLI+NG  + LW+G +A    + +VF      +I I +  +P + N+  +  V  I+  +R
Sbjct:  177 ASPDYIRSTLNAVPKNSSLLKKSKLPFGLVIRPYQHLYD---DIDPPPLNEDGLIVRCRRCRSYMNPFVTFIEQGRRWRCNFCRLANDVPMQ----MDQSDPNDPKSRYDRNEIKCAVMEYMAPKEYTLRQ--PPPATYCFLIDVSQSSIKSGLLATTINTLLQNL------DSIPNHDERTRISILCVDNAIHYFKIPLDSENNEESADQINMMDIADLEEPFLPRPNSMVVSLKACRQNIETLLTKIPQIFQSNLITNFALGPALKSAYH---LIGGVGGKIIVVSGTLPNL-GIGKLQRRNESGVVNTSKETAQLLSCQDSFYKNFTIDCSKVQITVDLFLASEDYMDVASLSNLSRFTAGQTHFYPGFSGKNPNDIVKFSTEFAKHISMDFCMETVMRARGSTGLRMSRFYGHFFNRSSDLCAFSTMPRDQSYLFEVNVDESIMADYCY-VQVAVLLSLNNSQRRIRIITLAMPTTESLAEVYASADQLAIASFYNSKAVEKALNSSLDDARVLINKSVQDILATYKKEIVVSNTAGGAPLRLC-------ANLRMFPLLMHSLTKHMAFR---SGI-VPSDHRASALNNLESLPLKYLIKNIYPDVYSLHDMADEAGLPVQTEDGEATGTIVLPQPINATSSLFERYGLYLIDNGNELFLWMGGDAVPALVFDVFGTQDIFDIPIGKQEIPVVENSEFNQRVRNIINQLR 860          
BLAST of Protein transport protein Sec24C vs. Ensembl Nematostella
Match: EDO41706 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3D9])

HSP 1 Score: 669.848 bits (1727), Expect = 0.000e+0
Identity = 347/803 (43.21%), Postives = 527/803 (65.63%), Query Frame = 2
Query:  647 QTQSLNPEYMPSAVQVIELDK-SNNNAPYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFC---NNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEI-INRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNS-SYVDFLCHIHKEIRSI 3037
            Q + ++P+ MPS +QV++ D+ ++ + P+ T TRD++PPLVT+ F+  D G C+P++IRS++Y VP   D+L++ +IP    I PFA++   E  +        GP+RC RCKAY++P + FIDGGRRF CNIC  ++EV  + F HLD  G R+D + RPEL LGSYE++ATA+YCK+   P PPA+IFM+DVS+ S++ G++ L     N L +H+     ++Q      +  VGFVTY   LHFYN++ N+++PQM+V+S +D+      VPL++GFLV  DEA   I  L+E I   F +T +   VLGPV++AG+EALK+AG      FIFHSSLP+ EAPGKLK R++R +L TDKEKT+ S  +++Y  LA  C E+GV++DLFL P+A++DVAT+  +   TGG++Y+Y +F    HG +  +D++ A+     FDAVMR+RTS G R VDF+G+FYM NT DV LA +S +K++ +EI+H+DKL E+ +  +Q A+LYTSISGQRRLRIHN++ N  + + ++F+  ++D+ +N++S+ A++     + K++R+++  + +QILA YRRN A  S   +L+LPE +KLLPLY N +LK D +              G+++++D+R++    +  MD   +  + YPRL P+     +   E+  LP  IR S   +S  G Y++ENGIS++LW+G   +   LQ +F  S+  ++ I   SLP+ +N +S  +  I+  IR+ R  ++ L +V Q D++E  FK  LVED+G   +  SYVDFLC +HKEIR++
Sbjct:  156 QQKRIDPDQMPSPIQVMKDDRETHKDQPFMTNTRDRIPPLVTSSFVVKDNGNCSPRFIRSTMYNVPCNKDLLQASDIPLAAIITPFAQIPAEEGYLPIVNHGASGPVRCNRCKAYINPFVQFIDGGRRFVCNICTYSSEVPADYFCHLDHQGLRVDLYERPELHLGSYEMVATADYCKDQKFPGPPAYIFMIDVSYQSMQCGMVRLLMREMNELLEHLPKEFNSEQ-----SQVRVGFVTYSNQLHFYNIKGNLAQPQMMVVSDVDDM----FVPLLDGFLVSVDEARSVIESLLEQIPLMFAETRDTETVLGPVVQAGIEALKSAGISGKL-FIFHSSLPITEAPGKLKNREDRKLLATDKEKTILSPQTTFYENLAKQCVEAGVAVDLFLFPNAYVDVATIGAIATQTGGDIYRYSYFKEVTHGEQFREDLKRAIECNMGFDAVMRLRTSTGLRPVDFVGSFYMSNTTDVELAGISPNKAIGIEIKHDDKLPEDSTAYLQCALLYTSISGQRRLRIHNLALNTCSQLSELFRCCEMDSFVNYVSKKAIRAVLTTAPKDIREQLVNQCAQILACYRRNCASPSSAGQLILPECMKLLPLYINCVLKSDALV------------GGSEMSSDDRSWLMRRVISMDQNASVPYFYPRLFPV----HDVDVEATGLPEQIRCSIERMSDNGIYVLENGISMLLWVGLQVDPGMLQQIFGVSTIGQVDIEMTSLPVLDNPLSARIQDIISSIRAERPNYLKLTVVRQRDKLEPWFKHFLVEDKGMSASCPSYVDFLCLMHKEIRNL 932          
BLAST of Protein transport protein Sec24C vs. Ensembl Nematostella
Match: EDO29943 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T276])

HSP 1 Score: 270.396 bits (690), Expect = 8.582e-78
Identity = 199/718 (27.72%), Postives = 366/718 (50.97%), Query Frame = 2
Query:  785 IDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLK---DIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKH----LPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEII-NRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNI 2914
            + +  C+P  +  ++ A+P    +L    +P  +++ PF  L           ++     RC  C+ Y++P +TF D  RR++C +C  + EV EE F     +    D   RPE+   + E +A +EY      P P  F+F+ DVS N++++G L++ C  LK+++       + +P   + LVGF+++D  +HFY+L+  +++PQM ++S LD+      +P  +  LV+  E+ E I  L++ +   F  +   +   G  +++ ++     G R     +F ++LP +  PG+LK R+E     + K+    +  + +Y K A  C+   V++D+FL    + D+ATL    K +GG +Y Y  F  S + T + K   +    ++    F+AVMRVR + G     F GNF++++T+ V+L  V+ D S  ++I   D L E+  V  Q A+LYTS  G+RR+R+H ++  V+T + D++   D   + + +S+ AV    + S+ + R+ +       L  YR + A Q +  +++ P +L+LLPL+  +LLK         +VS +    GT  + DER +    +  M +    + +YP L PL +   E +  +K      P     S   LS +G +L++ G +  +W+G++   E +Q +F+ ++ + I  N   LP  +N +S +V   V  ++S R+   ++++
Sbjct:   32 LQKRNCDPSVLCCTLNAIPETKSLLTKSKLPLGIHLHPFKDLQSLPV------IHSSVITRCRSCRTYINPFVTFTDA-RRWRCPMCFRSNEVPEE-FCFDPATKTYGDPSRRPEIKSATVEFIAPSEYMLRP--PQPSVFLFVFDVSFNAIETGYLHVACKLLKENL-------EKLPGDSRTLVGFLSFDSTVHFYSLKPKLTQPQMFIVSDLDDI----FLPAPDDLLVNLKESKELIYQLLDALPTMFSGSRNIHSAAGAALQSALKLCGPTGSRVT---LFQTALPNL-GPGELKRREEPNQKSSPKDFVNLAPATDFYKKFALDCAAEQVAVDVFLLAGQYADIATLMCASKYSGGCVYYYPDFHASRNPTAVEKFENEFTRYLTRKIGFEAVMRVRCTRGLAIHTFHGNFFVRSTDLVSLPNVNPDSSFCLQIDIEDSLTESNIVCFQSALLYTSSKGERRIRVHTLAMPVTTKLQDVYAHADQQAIASLLSKMAVDRTLSSSLGDAREALMNACIDFLTIYRGSVANQPQSNQIIAPYSLRLLPLFILALLK---------HVSFRL---GTTNSLDERCFAMQQLKTMPLSLAMLTIYPSLYPLHDISDEGALHTKAGVIPQPHRYHLSAEKLSRQGVFLMDTGHAFYIWVGKDTPEEIIQQLFNVANYNNIAENMGCLPELDNPLSTKVRSFVDYLQSQRTCHAVMHV 712          
BLAST of Protein transport protein Sec24C vs. Ensembl Medaka
Match: SEC24C (SEC24 homolog C, COPII coat complex component [Source:NCBI gene;Acc:100529191])

HSP 1 Score: 705.286 bits (1819), Expect = 0.000e+0
Identity = 372/800 (46.50%), Postives = 512/800 (64.00%), Query Frame = 2
Query:  644 PQTQS-LNPEYMPSAVQVIELDKSNNNAPYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINRY-SLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 3037
            PQ Q  L+P+ +PS +QVIE DK+    P+ TG R + PPLVTT+F   DQG  +P+++R + Y +P   DM K   +P    I P A L   E      +    GPIRC RCKAYM P M FI+GGRRFQC+ C   TEV    F HLD +GRR+DC++RPEL LGSYE +AT +YCKN+ +P PPA+IF++DVS+N+VKSGL+++ C  LK  +L +L  +    DS    VGFVTY++VLHFYN++S++++PQMLV+S    D     VPL++GFLV+ +E+ + I  L++ I + F DT E   V GPVI+AG+EALKAA       F+FH+SLP+ EAPGKLK R+++ ++GTDKEK+LF   + +Y+ LA  C   G  +DLFL P+ ++DVATL  +P  TGG++YKY +F   +   + L D++  V  P  FDAVMRVRTS G R  DF G+F+M NT DV LA +  DK++ VE +H+DKL E     +Q AVLYTS SGQRRLRIHN++ N  + + D+++  + DT++N++S+ A +       K VRD +  + +QILA YR+N A  S   +L+LPE +KLLP+Y N +LK D +              G D++ D+RAY   L++ MDV  T VF YPRLLPL+        ES  LP A+RDS   LS  G YL+E G+ + LW+G +  +E L N+F   S  +I +   SLP+  N +S  +  I+   R+ RSR+M L +V Q DR E  FK  LVED+   G +SYVDFLCH+HKEIR +
Sbjct:  420 PQAQKRLDPDAIPSPIQVIEDDKAKTTEPFTTGVRGQAPPLVTTNFQVKDQGNASPRFVRCTAYNMPCTADMAKQSQVPLAAVIKPLAILPPDETPPYLVDHGEGGPIRCNRCKAYMCPYMQFIEGGRRFQCSFCSCVTEVPPHYFQHLDHTGRRVDCYDRPELSLGSYEFLATVDYCKNNKIPQPPAYIFLIDVSYNAVKSGLVSIICQELKS-LLDHLPRENPEMDSVI-RVGFVTYNKVLHFYNVKSSLAQPQMLVVS----DVSDMFVPLLDGFLVNVNESRQVIESLLDQIPEMFADTRETETVFGPVIQAGLEALKAADCAGKL-FVFHTSLPIAEAPGKLKNREDKKLIGTDKEKSLFQPQAGFYNNLAKECVTQGCCVDLFLFPNQYVDVATLGVVPVSTGGSIYKYTYFQAESDQERFLNDLRRDVQKPVGFDAVMRVRTSTGIRATDFFGSFFMNNTTDVELAGLDCDKAITVEFKHDDKLSEETGALMQCAVLYTSCSGQRRLRIHNMAVNCCSQLADLYRNCETDTIINFLSKYAFRGVLNNPTKAVRDTLVNQCAQILACYRKNCASPSSAGQLILPECMKLLPVYLNCVLKSDVLL------------PGADVSLDDRAYLRQLISCMDVAETHVFFYPRLLPLVK------LESGALPVAVRDSEERLSKGGVYLLETGLHLFLWVGASVQQELLLNIFGTPSFGQIDSSMTSLPVLENPISQRLREIIDSFRAQRSRYMKLILVKQEDRAELMFKHFLVEDKSASGGASYVDFLCHMHKEIRQL 1194          
BLAST of Protein transport protein Sec24C vs. Ensembl Medaka
Match: SEC24C (SEC24 homolog C, COPII coat complex component [Source:NCBI gene;Acc:100529191])

HSP 1 Score: 703.36 bits (1814), Expect = 0.000e+0
Identity = 368/794 (46.35%), Postives = 509/794 (64.11%), Query Frame = 2
Query:  659 LNPEYMPSAVQVIELDKSNNNAPYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINRY-SLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 3037
            ++P+ +PS +QVIE DK+    P+ TG R + PPLVTT+F   DQG  +P+++R + Y +P   DM K   +P    I P A L   E      +    GPIRC RCKAYM P M FI+GGRRFQC+ C   TEV    F HLD +GRR+DC++RPEL LGSYE +AT +YCKN+ +P PPA+IF++DVS+N+VKSGL+++ C  LK  +L +L  +    DS    VGFVTY++VLHFYN++S++++PQMLV+S    D     VPL++GFLV+ +E+ + I  L++ I + F DT E   V GPVI+AG+EALKAA       F+FH+SLP+ EAPGKLK R+++ ++GTDKEK+LF   + +Y+ LA  C   G  +DLFL P+ ++DVATL  +P  TGG++YKY +F   +   + L D++  V  P  FDAVMRVRTS G R  DF G+F+M NT DV LA +  DK++ VE +H+DKL E     +Q AVLYTS SGQRRLRIHN++ N  + + D+++  + DT++N++S+ A +       K VRD +  + +QILA YR+N A  S   +L+LPE +KLLP+Y N +LK D +              G D++ D+RAY   L++ MDV  T VF YPRLLPL+        ES  LP A+RDS   LS  G YL+E G+ + LW+G +  +E L N+F   S  +I +   SLP+  N +S  +  I+   R+ RSR+M L +V Q DR E  FK  LVED+   G +SYVDFLCH+HKEIR +
Sbjct:  476 IDPDAIPSPIQVIEDDKAKTTEPFTTGVRGQAPPLVTTNFQVKDQGNASPRFVRCTAYNMPCTADMAKQSQVPLAAVIKPLAILPPDETPPYLVDHGEGGPIRCNRCKAYMCPYMQFIEGGRRFQCSFCSCVTEVPPHYFQHLDHTGRRVDCYDRPELSLGSYEFLATVDYCKNNKIPQPPAYIFLIDVSYNAVKSGLVSIICQELKS-LLDHLPRENPEMDSVI-RVGFVTYNKVLHFYNVKSSLAQPQMLVVS----DVSDMFVPLLDGFLVNVNESRQVIESLLDQIPEMFADTRETETVFGPVIQAGLEALKAADCAGKL-FVFHTSLPIAEAPGKLKNREDKKLIGTDKEKSLFQPQAGFYNNLAKECVTQGCCVDLFLFPNQYVDVATLGVVPVSTGGSIYKYTYFQAESDQERFLNDLRRDVQKPVGFDAVMRVRTSTGIRATDFFGSFFMNNTTDVELAGLDCDKAITVEFKHDDKLSEETGALMQCAVLYTSCSGQRRLRIHNMAVNCCSQLADLYRNCETDTIINFLSKYAFRGVLNNPTKAVRDTLVNQCAQILACYRKNCASPSSAGQLILPECMKLLPVYLNCVLKSDVLL------------PGADVSLDDRAYLRQLISCMDVAETHVFFYPRLLPLVK------LESGALPVAVRDSEERLSKGGVYLLETGLHLFLWVGASVQQELLLNIFGTPSFGQIDSSMTSLPVLENPISQRLREIIDSFRAQRSRYMKLILVKQEDRAELMFKHFLVEDKSASGGASYVDFLCHMHKEIRQL 1244          
BLAST of Protein transport protein Sec24C vs. Ensembl Medaka
Match: sec24d (SEC24 homolog D, COPII coat complex component [Source:NCBI gene;Acc:100529193])

HSP 1 Score: 653.284 bits (1684), Expect = 0.000e+0
Identity = 350/805 (43.48%), Postives = 500/805 (62.11%), Query Frame = 2
Query:  629 GSRYGPQTQSLNPEYMPSAVQVIELDKSNNNAP-YPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINRYS-LPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 3037
            G+  GP  + L+P+ +PS  QVIE DK+ N    Y T  R ++PPLVTTDF   DQG  +P++IR + Y +P   ++ K   +P    + P A L + E  +        GPIRC RCKAYM P M FIDGGRR+QC  C    EV    F HLD  GRR+D + RPEL LGSYE +AT +YCKN+  PNPPAFIFM+DVS+N++KSGL+ L C+ LK  +L  L  ++   D     VGFVTYD+VLHFYN++S +++PQM+V+S    D     VPL++GFLV   ++   I  L++ I   F DT E   V  PVI+AG+EA KAA       FIF S +P  EAPGKLK RD++ ++ TDKEKTLF      Y +L   C   G  +DLFL P+ ++D+AT++D+P  TGG++YKY+ F     G   L D++ +V     FDA+MRVRTS G R  DF G  +M NT DV +A V  DK+V VE +H+D L E     IQ A+LYT+ISGQRRLR+HN+S N S+ + +++K  + D+L+N+ +++A +    + +K VR+ +  +++ +LA YR+N A  S  ++L+LP+ +K+ P+Y NSL+K   +               T+L+TD+RA+Q   +  M V+ TQ+ LYPRL+PL N       +S+  P+ +R S   L+  G +L+ENG S+ LWIGQ A+ + +Q +F+  S +      S LP  +N +S +V  I++ +++ R   M L IV Q D+ E  F++LLVED+G  G +SYVDFLC++H+EIR +
Sbjct:  281 GAMAGPPQKKLDPDAIPSTTQVIEDDKAKNGGQVYCTNIRGQLPPLVTTDFTVQDQGNASPRFIRCTTYTLPCTAELAKQCQVPLAAVVKPLANLPKNEAPLYAVNHGETGPIRCNRCKAYMCPYMQFIDGGRRYQCTFCNCVNEVPVFYFQHLDHMGRRVDFYERPELSLGSYEFVATLDYCKNNKPPNPPAFIFMIDVSYNNIKSGLVKLICDELKT-LLEKLPREEGA-DGSAVKVGFVTYDKVLHFYNVKSALAQPQMMVVS----DTTEMFVPLLDGFLVSYQDSKAVICNLLDQIPTMFADTAESETVFAPVIQAGVEAFKAAECSGKL-FIFQSFMPTAEAPGKLKNRDDKKLVNTDKEKTLFQPQKGVYEQLCKDCVVQGCCVDLFLFPNQYLDLATMADVPSHTGGSVYKYNNFQMETDGEHFLADLRKSVQKHIGFDAIMRVRTSTGFRATDFFGAIHMNNTTDVEMAAVDCDKAVTVEFKHDDALSEESGALIQCALLYTNISGQRRLRVHNLSLNCSSQLSELYKSCETDSLINFFAKSAYRAILNQPLKNVREILVNQTAHMLACYRKNCASPSAASQLILPDAMKVFPVYMNSLMKTAPLVGS------------TELSTDDRAHQRLAVMAMGVEDTQLLLYPRLIPLHN----MDVDSEVAPAPVRCSEERLTDSGLFLLENGHSMFLWIGQAASPDLIQGIFNLPSLAHFQGLTSTLPDLDNPLSKKVRAIIRDLQNKRPNSMKLQIVRQKDKPEMLFRQLLVEDKGLHGGASYVDFLCYVHREIRQL 1062          
BLAST of Protein transport protein Sec24C vs. Ensembl Medaka
Match: sec24d (SEC24 homolog D, COPII coat complex component [Source:NCBI gene;Acc:100529193])

HSP 1 Score: 652.514 bits (1682), Expect = 0.000e+0
Identity = 350/805 (43.48%), Postives = 500/805 (62.11%), Query Frame = 2
Query:  629 GSRYGPQTQSLNPEYMPSAVQVIELDKSNNNAP-YPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINRYS-LPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 3037
            G+  GP  + L+P+ +PS  QVIE DK+ N    Y T  R ++PPLVTTDF   DQG  +P++IR + Y +P   ++ K   +P    + P A L + E  +        GPIRC RCKAYM P M FIDGGRR+QC  C    EV    F HLD  GRR+D + RPEL LGSYE +AT +YCKN+  PNPPAFIFM+DVS+N++KSGL+ L C+ LK  +L  L  ++   D     VGFVTYD+VLHFYN++S +++PQM+V+S    D     VPL++GFLV   ++   I  L++ I   F DT E   V  PVI+AG+EA KAA       FIF S +P  EAPGKLK RD++ ++ TDKEKTLF      Y +L   C   G  +DLFL P+ ++D+AT++D+P  TGG++YKY+ F     G   L D++ +V     FDA+MRVRTS G R  DF G  +M NT DV +A V  DK+V VE +H+D L E     IQ A+LYT+ISGQRRLR+HN+S N S+ + +++K  + D+L+N+ +++A +    + +K VR+ +  +++ +LA YR+N A  S  ++L+LP+ +K+ P+Y NSL+K   +               T+L+TD+RA+Q   +  M V+ TQ+ LYPRL+PL N       +S+  P+ +R S   L+  G +L+ENG S+ LWIGQ A+ + +Q +F+  S +      S LP  +N +S +V  I++ +++ R   M L IV Q D+ E  F++LLVED+G  G +SYVDFLC++H+EIR +
Sbjct:  273 GAMAGPPQKKLDPDAIPSTTQVIEDDKAKNGGQVYCTNIRGQLPPLVTTDFTVQDQGNASPRFIRCTTYTLPCTAELAKQCQVPLAAVVKPLANLPKNEAPLYAVNHGETGPIRCNRCKAYMCPYMQFIDGGRRYQCTFCNCVNEVPVFYFQHLDHMGRRVDFYERPELSLGSYEFVATLDYCKNNKPPNPPAFIFMIDVSYNNIKSGLVKLICDELKT-LLEKLPREEGA-DGSAVKVGFVTYDKVLHFYNVKSALAQPQMMVVS----DTTEMFVPLLDGFLVSYQDSKAVICNLLDQIPTMFADTAESETVFAPVIQAGVEAFKAAECSGKL-FIFQSFMPTAEAPGKLKNRDDKKLVNTDKEKTLFQPQKGVYEQLCKDCVVQGCCVDLFLFPNQYLDLATMADVPSHTGGSVYKYNNFQMETDGEHFLADLRKSVQKHIGFDAIMRVRTSTGFRATDFFGAIHMNNTTDVEMAAVDCDKAVTVEFKHDDALSEESGALIQCALLYTNISGQRRLRVHNLSLNCSSQLSELYKSCETDSLINFFAKSAYRAILNQPLKNVREILVNQTAHMLACYRKNCASPSAASQLILPDAMKVFPVYMNSLMKTAPLVGS------------TELSTDDRAHQRLAVMAMGVEDTQLLLYPRLIPLHN----MDVDSEVAPAPVRCSEERLTDSGLFLLENGHSMFLWIGQAASPDLIQGIFNLPSLAHFQGLTSTLPDLDNPLSKKVRAIIRDLQNKRPNSMKLQIVRQKDKPEMLFRQLLVEDKGLHGGASYVDFLCYVHREIRQL 1054          
BLAST of Protein transport protein Sec24C vs. Ensembl Medaka
Match: sec24d (SEC24 homolog D, COPII coat complex component [Source:NCBI gene;Acc:100529193])

HSP 1 Score: 651.744 bits (1680), Expect = 0.000e+0
Identity = 350/805 (43.48%), Postives = 500/805 (62.11%), Query Frame = 2
Query:  629 GSRYGPQTQSLNPEYMPSAVQVIELDKSNNNAP-YPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINRYS-LPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 3037
            G+  GP  + L+P+ +PS  QVIE DK+ N    Y T  R ++PPLVTTDF   DQG  +P++IR + Y +P   ++ K   +P    + P A L + E  +        GPIRC RCKAYM P M FIDGGRR+QC  C    EV    F HLD  GRR+D + RPEL LGSYE +AT +YCKN+  PNPPAFIFM+DVS+N++KSGL+ L C+ LK  +L  L  ++   D     VGFVTYD+VLHFYN++S +++PQM+V+S    D     VPL++GFLV   ++   I  L++ I   F DT E   V  PVI+AG+EA KAA       FIF S +P  EAPGKLK RD++ ++ TDKEKTLF      Y +L   C   G  +DLFL P+ ++D+AT++D+P  TGG++YKY+ F     G   L D++ +V     FDA+MRVRTS G R  DF G  +M NT DV +A V  DK+V VE +H+D L E     IQ A+LYT+ISGQRRLR+HN+S N S+ + +++K  + D+L+N+ +++A +    + +K VR+ +  +++ +LA YR+N A  S  ++L+LP+ +K+ P+Y NSL+K   +               T+L+TD+RA+Q   +  M V+ TQ+ LYPRL+PL N       +S+  P+ +R S   L+  G +L+ENG S+ LWIGQ A+ + +Q +F+  S +      S LP  +N +S +V  I++ +++ R   M L IV Q D+ E  F++LLVED+G  G +SYVDFLC++H+EIR +
Sbjct:  228 GAMAGPPQKKLDPDAIPSTTQVIEDDKAKNGGQVYCTNIRGQLPPLVTTDFTVQDQGNASPRFIRCTTYTLPCTAELAKQCQVPLAAVVKPLANLPKNEAPLYAVNHGETGPIRCNRCKAYMCPYMQFIDGGRRYQCTFCNCVNEVPVFYFQHLDHMGRRVDFYERPELSLGSYEFVATLDYCKNNKPPNPPAFIFMIDVSYNNIKSGLVKLICDELKT-LLEKLPREEGA-DGSAVKVGFVTYDKVLHFYNVKSALAQPQMMVVS----DTTEMFVPLLDGFLVSYQDSKAVICNLLDQIPTMFADTAESETVFAPVIQAGVEAFKAAECSGKL-FIFQSFMPTAEAPGKLKNRDDKKLVNTDKEKTLFQPQKGVYEQLCKDCVVQGCCVDLFLFPNQYLDLATMADVPSHTGGSVYKYNNFQMETDGEHFLADLRKSVQKHIGFDAIMRVRTSTGFRATDFFGAIHMNNTTDVEMAAVDCDKAVTVEFKHDDALSEESGALIQCALLYTNISGQRRLRVHNLSLNCSSQLSELYKSCETDSLINFFAKSAYRAILNQPLKNVREILVNQTAHMLACYRKNCASPSAASQLILPDAMKVFPVYMNSLMKTAPLVGS------------TELSTDDRAHQRLAVMAMGVEDTQLLLYPRLIPLHN----MDVDSEVAPAPVRCSEERLTDSGLFLLENGHSMFLWIGQAASPDLIQGIFNLPSLAHFQGLTSTLPDLDNPLSKKVRAIIRDLQNKRPNSMKLQIVRQKDKPEMLFRQLLVEDKGLHGGASYVDFLCYVHREIRQL 1009          
BLAST of Protein transport protein Sec24C vs. Planmine SMEST
Match: SMESG000060905.1 (SMESG000060905.1)

HSP 1 Score: 1834.69 bits (4751), Expect = 0.000e+0
Identity = 979/980 (99.90%), Postives = 979/980 (99.90%), Query Frame = 2
Query:   98 MMSQNNPQYAINGNTQYATYNEPHYESEPYDSNQLNINKFSNLNINATPNISNYPLHMPPPVXXXXXXXXNAPQQMYNQPTQSLGYQTGPVHNYSNMPFQSPSSQDPNITSGXXXXXXXXXXXXXXYEYFPNTGSYPPNPTQQQSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGSRYGPQTQSLNPEYMPSAVQVIELDKSNNNAPYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 3037
            MMS NNPQYAINGNTQYATYNEPHYESEPYDSNQLNINKFSNLNINATPNISNYPLHMPPPVSQQQYSQYNAPQQMYNQPTQSLGYQTGPVHNYSNMPFQSPSSQDPNITSGPNVQPIQPNINPVQYEYFPNTGSYPPNPTQQQSQPLPNNFPPMHPPNMPLQSNNPPLPSQLPNQTGSRYGPQTQSLNPEYMPSAVQVIELDKSNNNAPYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEALKAAGGRAGKLFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAELVLPENLKLLPLYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI
Sbjct:    1 MMSHNNPQYAINGNTQYATYNEPHYESEPYDSNQLNINKFSNLNINATPNISNYPLHMPPPVSQQQYSQYNAPQQMYNQPTQSLGYQTGPVHNYSNMPFQSPSSQDPNITSGPNVQPIQPNINPVQYEYFPNTGSYPPNPTQQQSQPLPNNFPPMHPPNMPLQSNNPPLPSQLPNQTGSRYGPQTQSLNPEYMPSAVQVIELDKSNNNAPYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEALKAAGGRAGKLFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAELVLPENLKLLPLYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 980          
BLAST of Protein transport protein Sec24C vs. Planmine SMEST
Match: SMESG000060905.1 (SMESG000060905.1)

HSP 1 Score: 1831.61 bits (4743), Expect = 0.000e+0
Identity = 978/979 (99.90%), Postives = 978/979 (99.90%), Query Frame = 2
Query:  101 MSQNNPQYAINGNTQYATYNEPHYESEPYDSNQLNINKFSNLNINATPNISNYPLHMPPPVXXXXXXXXNAPQQMYNQPTQSLGYQTGPVHNYSNMPFQSPSSQDPNITSGXXXXXXXXXXXXXXYEYFPNTGSYPPNPTQQQSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGSRYGPQTQSLNPEYMPSAVQVIELDKSNNNAPYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 3037
            MS NNPQYAINGNTQYATYNEPHYESEPYDSNQLNINKFSNLNINATPNISNYPLHMPPPVSQQQYSQYNAPQQMYNQPTQSLGYQTGPVHNYSNMPFQSPSSQDPNITSGPNVQPIQPNINPVQYEYFPNTGSYPPNPTQQQSQPLPNNFPPMHPPNMPLQSNNPPLPSQLPNQTGSRYGPQTQSLNPEYMPSAVQVIELDKSNNNAPYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEALKAAGGRAGKLFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAELVLPENLKLLPLYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI
Sbjct:    1 MSHNNPQYAINGNTQYATYNEPHYESEPYDSNQLNINKFSNLNINATPNISNYPLHMPPPVSQQQYSQYNAPQQMYNQPTQSLGYQTGPVHNYSNMPFQSPSSQDPNITSGPNVQPIQPNINPVQYEYFPNTGSYPPNPTQQQSQPLPNNFPPMHPPNMPLQSNNPPLPSQLPNQTGSRYGPQTQSLNPEYMPSAVQVIELDKSNNNAPYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEALKAAGGRAGKLFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAELVLPENLKLLPLYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 979          
BLAST of Protein transport protein Sec24C vs. Planmine SMEST
Match: SMESG000060905.1 (SMESG000060905.1)

HSP 1 Score: 1801.95 bits (4666), Expect = 0.000e+0
Identity = 967/980 (98.67%), Postives = 967/980 (98.67%), Query Frame = 2
Query:   98 MMSQNNPQYAINGNTQYATYNEPHYESEPYDSNQLNINKFSNLNINATPNISNYPLHMPPPVXXXXXXXXNAPQQMYNQPTQSLGYQTGPVHNYSNMPFQSPSSQDPNITSGXXXXXXXXXXXXXXYEYFPNTGSYPPNPTQQQSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGSRYGPQTQSLNPEYMPSAVQVIELDKSNNNAPYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 3037
            MMS NNPQYAINGNTQYATYNEPHYESEPYDSNQLNINKFSNLNINATPNISNYPLHMPPPVSQQQYSQYNAPQQMYNQPTQSLGYQTGPVHNYSNMPFQSPSSQDPNITSGPNVQPIQPNINPVQYEYFPNTGSYPPNPTQQQSQPLPNNFPPMHPPNMPLQSNNPPLPSQLPNQTGSRYGPQTQSLNPEYMPSAVQVIELDKSNNNAPYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEALKAAGGRAGKLFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAELVLPENLKLLPLYANSLLKCDFMQ            SGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI
Sbjct:    1 MMSHNNPQYAINGNTQYATYNEPHYESEPYDSNQLNINKFSNLNINATPNISNYPLHMPPPVSQQQYSQYNAPQQMYNQPTQSLGYQTGPVHNYSNMPFQSPSSQDPNITSGPNVQPIQPNINPVQYEYFPNTGSYPPNPTQQQSQPLPNNFPPMHPPNMPLQSNNPPLPSQLPNQTGSRYGPQTQSLNPEYMPSAVQVIELDKSNNNAPYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEALKAAGGRAGKLFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAELVLPENLKLLPLYANSLLKCDFMQ------------SGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 968          
BLAST of Protein transport protein Sec24C vs. Planmine SMEST
Match: SMESG000060905.1 (SMESG000060905.1)

HSP 1 Score: 1798.48 bits (4657), Expect = 0.000e+0
Identity = 966/979 (98.67%), Postives = 966/979 (98.67%), Query Frame = 2
Query:  101 MSQNNPQYAINGNTQYATYNEPHYESEPYDSNQLNINKFSNLNINATPNISNYPLHMPPPVXXXXXXXXNAPQQMYNQPTQSLGYQTGPVHNYSNMPFQSPSSQDPNITSGXXXXXXXXXXXXXXYEYFPNTGSYPPNPTQQQSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGSRYGPQTQSLNPEYMPSAVQVIELDKSNNNAPYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAXXXXXXXXXXXXXYANSLLKCDFMQSDNSYVSEQTRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 3037
            MS NNPQYAINGNTQYATYNEPHYESEPYDSNQLNINKFSNLNINATPNISNYPLHMPPPVSQQQYSQYNAPQQMYNQPTQSLGYQTGPVHNYSNMPFQSPSSQDPNITSGPNVQPIQPNINPVQYEYFPNTGSYPPNPTQQQSQPLPNNFPPMHPPNMPLQSNNPPLPSQLPNQTGSRYGPQTQSLNPEYMPSAVQVIELDKSNNNAPYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEALKAAGGRAGKLFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAELVLPENLKLLPLYANSLLKCDFMQ            SGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI
Sbjct:    1 MSHNNPQYAINGNTQYATYNEPHYESEPYDSNQLNINKFSNLNINATPNISNYPLHMPPPVSQQQYSQYNAPQQMYNQPTQSLGYQTGPVHNYSNMPFQSPSSQDPNITSGPNVQPIQPNINPVQYEYFPNTGSYPPNPTQQQSQPLPNNFPPMHPPNMPLQSNNPPLPSQLPNQTGSRYGPQTQSLNPEYMPSAVQVIELDKSNNNAPYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEALKAAGGRAGKLFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFSPSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQILASYRRNYAEQSKPAELVLPENLKLLPLYANSLLKCDFMQ------------SGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAESKHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSPSEIINRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAFKKLLVEDRGERGNSSYVDFLCHIHKEIRSI 967          
BLAST of Protein transport protein Sec24C vs. Planmine SMEST
Match: SMESG000019563.1 (SMESG000019563.1)

HSP 1 Score: 189.889 bits (481), Expect = 5.369e-50
Identity = 140/519 (26.97%), Postives = 247/519 (47.59%), Query Frame = 2
Query:  803 NPKYIRSSIYAVPAAPDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSPLMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSYELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPYLATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGSDLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGMEXXXXXXXXXXXXFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGSSYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKY-DFFSPSNHGTKL-----------LKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTEDVNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNISFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRD 2323
            +PK ++ ++  +P   ++L    +P  ++I PF   D     I+    N    +RC  C+ Y++P +T  D  RR+ CN+CG   ++ +E F +   +    +   RPEL   S E  A +EY      P    ++F+LDVS +++ SG L+  C  + +++         +P   +  + F +Y   L+FY ++ N  K   L+ + +D       +PL    LV+  +  + I   +EN+  NF+ T +    LG  I+  M+ +   GGR     I ++SLP V  PG+LK R+ +     D +       + +Y  LA  C+   +S+DLF     + D+A++S + + + G +  Y  F + +  G +L            KD    ++    F+AVMR R + G     F GN +M++T  + L  V+ D S +++ + N+ L E   V IQ A+LYT+    RR+R+H +   +S  + DIF  T+   +   +++ AV          VR+
Sbjct:  200 DPKIMQCTLNTIPVEANLLSKSRLPLGVHIQPFKDSD-----IITVSTN--SVVRCRPCRTYINPFVTLTDNQRRWHCNVCGKVNDIPDE-FMYDPTTKSYGNPSQRPELKFSSIEYTANSEYTVRP--PMCTMYVFLLDVSKSAISSGYLSHACKIIAENL-------NKMPGDSRTQIAFFSYSSCLNFYQIRDNSYK--TLIWTDIDEVE----LPLSEDLLVNLQDRKDIILEFLENLPSNFEATNDSGNCLGFAIQVAMKLISHNGGRVT---IINASLPNV-GPGELKVREYK-----DGDLKTLQPATDFYKSLALQCANDQISVDLFFINRQYSDLASISAVSRHSSGCMQYYGSFRAITTEGQRLEPEEQLDFDRFTKDFTRYLTRKIGFEAVMRTRFTKGLDLTAFHGNLFMRSTNVIALPVVNPDNSYLIQFKINNSLSEWNYVIIQSALLYTTSESDRRIRVHTMCLPISNKLEDIFLNTNGSAITGLITKIAVDKCVNNGFSNVRE 686          
The following BLAST results are available for this feature:
BLAST of Protein transport protein Sec24C vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SEC24C0.000e+046.42SEC24 homolog C, COPII coat complex component [Sou... [more]
SEC24C0.000e+046.42SEC24 homolog C, COPII coat complex component [Sou... [more]
SEC24D0.000e+043.68SEC24 homolog D, COPII coat complex component [Sou... [more]
SEC24C0.000e+046.31SEC24 homolog C, COPII coat complex component [Sou... [more]
SEC24D2.263e-17943.84SEC24 homolog D, COPII coat complex component [Sou... [more]
back to top
BLAST of Protein transport protein Sec24C vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sec-24.10.000e+039.85Yeast SEC homolog [Source:UniProtKB/TrEMBL;Acc:Q1... [more]
sec-24.26.428e-6025.56Yeast SEC homolog [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
back to top
BLAST of Protein transport protein Sec24C vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sec24CD0.000e+043.25gene:FBgn0262126 transcript:FBtr0329965[more]
Sec24CD0.000e+043.25gene:FBgn0262126 transcript:FBtr0077810[more]
Sec24CD0.000e+043.25gene:FBgn0262126 transcript:FBtr0329964[more]
Sec24AB4.546e-5622.80gene:FBgn0033460 transcript:FBtr0339407[more]
Sec24AB5.502e-5622.80gene:FBgn0033460 transcript:FBtr0088451[more]
back to top
BLAST of Protein transport protein Sec24C vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sec24c0.000e+047.49SEC24 homolog C, COPII coat complex component [Sou... [more]
sec24c0.000e+047.36SEC24 homolog C, COPII coat complex component [Sou... [more]
sec24d0.000e+043.82SEC24 homolog D, COPII coat complex component [Sou... [more]
sec24a3.491e-8628.21SEC24 homolog A, COPII coat complex component [Sou... [more]
sec24b4.385e-8328.10SEC24 homolog B, COPII coat complex component [Sou... [more]
back to top
BLAST of Protein transport protein Sec24C vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc34a20.000e+046.54solute carrier family 34 member 2 [Source:Xenbase;... [more]
slc34a20.000e+046.42solute carrier family 34 member 2 [Source:Xenbase;... [more]
slc34a20.000e+046.42solute carrier family 34 member 2 [Source:Xenbase;... [more]
slc34a20.000e+046.42solute carrier family 34 member 2 [Source:Xenbase;... [more]
slc34a20.000e+046.42solute carrier family 34 member 2 [Source:Xenbase;... [more]
back to top
BLAST of Protein transport protein Sec24C vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sec24c0.000e+046.55Sec24 related gene family, member C (S. cerevisiae... [more]
Sec24c0.000e+046.54Sec24 related gene family, member C (S. cerevisiae... [more]
Sec24d0.000e+043.39Sec24 related gene family, member D (S. cerevisiae... [more]
Sec24a1.258e-8928.52Sec24 related gene family, member A (S. cerevisiae... [more]
Sec24a2.313e-8928.52Sec24 related gene family, member A (S. cerevisiae... [more]
back to top
BLAST of Protein transport protein Sec24C vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P53992|SC24C_HUMAN0.000e+046.42Protein transport protein Sec24C OS=Homo sapiens O... [more]
sp|O94855|SC24D_HUMAN0.000e+043.68Protein transport protein Sec24D OS=Homo sapiens O... [more]
sp|Q9M291|SC24C_ARATH2.072e-11831.33Protein transport protein Sec24-like CEF OS=Arabid... [more]
sp|Q9M081|SC24B_ARATH1.524e-10628.87Protein transport protein Sec24-like At4g32640 OS=... [more]
sp|Q9SFU0|SC24A_ARATH4.147e-10630.78Protein transport protein Sec24-like At3g07100 OS=... [more]
back to top
BLAST of Protein transport protein Sec24C vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210QA650.000e+047.93Protein transport protein Sec24C OS=Mizuhopecten y... [more]
R7U9C70.000e+048.62Uncharacterized protein OS=Capitella teleta OX=283... [more]
V3Z5590.000e+048.57Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A1S3HUN30.000e+047.74protein transport protein Sec24C isoform X2 OS=Lin... [more]
T1G9150.000e+047.93Uncharacterized protein OS=Helobdella robusta OX=6... [more]
back to top
BLAST of Protein transport protein Sec24C vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sec24c0.000e+047.12SEC24 homolog C, COPII coat complex component [Sou... [more]
sec24c0.000e+046.99SEC24 homolog C, COPII coat complex component [Sou... [more]
sec24c0.000e+046.99SEC24 homolog C, COPII coat complex component [Sou... [more]
sec24d0.000e+042.95SEC24 homolog D, COPII coat complex component [Sou... [more]
sec24a1.525e-9027.01protein transport protein Sec24A [Source:NCBI gene... [more]
back to top
BLAST of Protein transport protein Sec24C vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000008390.10.000e+044.04pep scaffold:Pmarinus_7.0:GL476543:210227:241126:1... [more]
ENSPMAT00000000115.12.162e-8729.10pep scaffold:Pmarinus_7.0:GL477477:43963:54842:1 g... [more]
ENSPMAT00000000116.14.317e-8628.72pep scaffold:Pmarinus_7.0:GL477477:44390:54842:1 g... [more]
sec24b2.232e-7927.39SEC24 homolog B, COPII coat complex component [Sou... [more]
back to top
BLAST of Protein transport protein Sec24C vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
SFB32.255e-6225.91Component of the Sec23p-Sfb3p heterodimer of the C... [more]
SFB27.865e-6226.97Component of the Sec23p-Sfb2p heterodimer of the C... [more]
SEC247.556e-5526.57Component of the Sec23p-Sec24p heterodimer of the ... [more]
back to top
BLAST of Protein transport protein Sec24C vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO417060.000e+043.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO299438.582e-7827.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein transport protein Sec24C vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SEC24C0.000e+046.50SEC24 homolog C, COPII coat complex component [Sou... [more]
SEC24C0.000e+046.35SEC24 homolog C, COPII coat complex component [Sou... [more]
sec24d0.000e+043.48SEC24 homolog D, COPII coat complex component [Sou... [more]
sec24d0.000e+043.48SEC24 homolog D, COPII coat complex component [Sou... [more]
sec24d0.000e+043.48SEC24 homolog D, COPII coat complex component [Sou... [more]
back to top
BLAST of Protein transport protein Sec24C vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060905.10.000e+099.90SMESG000060905.1[more]
SMESG000060905.10.000e+099.90SMESG000060905.1[more]
SMESG000060905.10.000e+098.67SMESG000060905.1[more]
SMESG000060905.10.000e+098.67SMESG000060905.1[more]
SMESG000019563.15.369e-5026.97SMESG000019563.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023022 ID=SMED30023022|Name=Protein transport protein Sec24C|organism=Schmidtea mediterranea sexual|type=transcript|length=3288bp
ACACGAACGTCATAAGAGTATACGCTGTAATTTGGATTATTTTTTGAAAA
TTATAAATTTAATTTTTTCTTTAAAGAATTTCATATTTTAGTCGAATATG
ATGTCACAAAATAATCCTCAATATGCAATTAATGGAAACACTCAATATGC
CACATATAACGAACCTCATTATGAATCGGAACCTTATGATTCTAATCAAT
TAAACATTAATAAATTTTCTAATTTGAATATTAATGCAACACCAAATATT
TCAAATTATCCTCTACACATGCCTCCACCTGTTTCTCAGCAACAGTACTC
ACAATATAATGCACCACAGCAGATGTACAATCAACCAACTCAGTCTTTAG
GATATCAAACTGGACCTGTGCATAATTATTCAAATATGCCATTTCAATCT
CCATCCTCACAAGACCCTAACATAACAAGTGGACCAAACGTTCAACCTAT
ACAACCAAATATAAATCCTGTTCAATATGAATATTTTCCAAATACGGGGT
CATATCCTCCCAATCCTACTCAACAACAATCTCAACCTTTACCGAATAAT
TTTCCCCCTATGCACCCACCAAATATGCCTTTACAGTCTAACAATCCCCC
GTTGCCATCTCAATTACCTAACCAGACAGGATCACGATATGGCCCCCAGA
CTCAATCACTAAATCCTGAATACATGCCAAGTGCTGTCCAGGTAATTGAA
TTAGATAAATCGAATAATAACGCCCCTTATCCAACGGGAACCCGAGATAA
AGTTCCTCCATTAGTTACAACGGATTTTATTGCCATAGATCAGGGAACTT
GCAATCCCAAATATATCAGATCGTCTATCTATGCAGTGCCAGCTGCACCT
GATATGTTAAAATCTTTAAATATTCCATTCGTTCTTAATATTTGTCCATT
TGCTAAGTTGGATGAAGCAGAACAAAGAATTGTCTGTGGTGAATTGAATC
CAAAGGGGCCTATTCGTTGTATTCGCTGTAAAGCATATATGAGCCCACTT
ATGACCTTTATTGATGGCGGGCGAAGGTTTCAATGCAATATCTGCGGAGG
AAATACAGAAGTTTCCGAGGAGAATTTTGCCCATTTGGATCAAAGCGGTA
GAAGAATCGACTGTTTTAATAGACCGGAACTCTGCCTGGGAAGCTATGAA
TTAATGGCCACAGCGGAATACTGCAAAAACGATACGCTACCGAATCCACC
AGCATTTATATTCATGCTGGACGTTTCGCATAATAGCGTGAAATCCGGCT
TATTGAATTTGTTTTGCAACAACTTGAAAGATCACATTCTACCGTATTTG
GCAACCGATCAGCTGGTTCCGGATTCACCGAAACCTCTCGTGGGATTTGT
AACCTACGATCGGGTTCTTCATTTCTACAATCTCCAATCCAACATGAGCA
AGCCACAAATGCTCGTCATATCCTATCTCGACAATGATAACGGATCGGAT
CTTGTTCCGCTTGTCAATGGGTTTCTTGTGGATCCCGATGAAGCAATTGA
ACAGATTTCCATTCTCATGGAGAATATTATTGACAATTTTAAAGACACTG
AAGAGCGAAATGTTGTTCTCGGTCCTGTAATCGAGGCAGGGATGGAAGCC
TTGAAAGCAGCCGGAGGACGTGCGGGAAAACTATTTATTTTCCATTCTTC
TCTTCCAATGGTCGAAGCTCCAGGTAAATTGAAAGCTCGAGATGAACGAA
CGATTCTAGGTACAGACAAAGAAAAAACTTTATTTTCATCTGGATCAAGC
TATTATTCAAAATTGGCCGACTCTTGTTCTGAATCCGGAGTCAGCATTGA
CTTGTTTTTGACTCCATCTGCTTTCATCGATGTCGCAACGTTATCCGATC
TGCCTAAATGTACCGGAGGAAATCTGTACAAATATGACTTTTTCTCGCCT
TCAAACCACGGTACGAAATTATTGAAAGATATTCAACATGCAGTTTCATC
ACCGTTTGCTTTCGATGCTGTGATGCGTGTAAGAACGAGTCTCGGTACGA
GAACGGTGGATTTCTTGGGAAATTTCTATATGAAGAACACAGAAGATGTC
AATCTGGCCTGTGTCAGTTCAGACAAGTCAGTGATTGTGGAGATTAGACA
CAATGATAAATTACAGGAAAATGAGTCAGTTAATATCCAAGTTGCTGTAT
TGTATACATCAATTTCTGGTCAAAGGCGTCTGCGAATCCATAATATATCA
TTCAATGTGTCAACAAATATATTAGATATCTTCAAGCTAACTGATCTCGA
TACACTAATGAACTGGATGTCGAGAAATGCTGTTAAAACTTTCCAGGCAA
AATCAGTAAAAGAAGTTCGTGATGAAATAAGTCAAAGGTCATCACAAATT
CTAGCTTCATATCGCAGAAATTACGCTGAACAAAGTAAACCAGCAGAATT
GGTATTGCCAGAAAATTTGAAACTTTTACCTCTTTATGCCAACAGTTTAC
TAAAATGTGATTTCATGCAATCTGACAATTCTTATGTCTCTGAACAGACT
AGAGATTCAGGCACTGATTTGGCTACCGATGAAAGGGCGTATCAGTGTTT
TTTGATGAATGATATGGATGTGAAGCACACTCAAGTTTTCTTATATCCAA
GACTTTTACCATTGATAAATGCTAAGTCAGAGTTCAGTGCTGAATCAAAA
CATTTACCGTCAGCAATTCGAGACAGTTATGTTAATCTTTCATCAGAGGG
CGCTTATTTGATAGAAAACGGTATTAGTATCATTTTATGGATCGGTCAAA
ATGCTAACAGGGAATGGTTACAAAATGTTTTCGACTGTTCTTCACCTTCA
GAAATTATCAATCGATATTCACTTCCTATCCACAATAACAATGTTTCACT
TGAAGTTAATCGAATTGTCCAAATAATACGATCGACCAGATCTCGTTTTA
TGATGCTAAATATTGTTATCCAAGGGGATAGAATGGAAAGTGCTTTCAAA
AAATTACTAGTAGAAGATCGTGGTGAAAGAGGAAATTCGAGTTACGTGGA
TTTCTTGTGTCACATTCACAAAGAAATCAGAAGCATACTGAACTATTAAT
TGCTACTCTTAAATAAAACTTTGTTAATGGTTTCATGACGTTTATTTTCA
ACTGAAATTTACAATATATTGTATTAGTGCTTATTTGTAAGATTTTCACC
AGTTTTGTGAAATCTATTGCAGCTTTCACAGCGCTATAGAATGTGCATGT
TTGAAGGTCATCATTATTGATTTACAAATAAATATTTCCAGTTTATAAAT
CCGACTGAATTTGTTATGAGAGTGCTTGTAGAAATGGC
back to top

protein sequence of SMED30023022-orf-1

>SMED30023022-orf-1 ID=SMED30023022-orf-1|Name=SMED30023022-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=984bp
MMSQNNPQYAINGNTQYATYNEPHYESEPYDSNQLNINKFSNLNINATPN
ISNYPLHMPPPVSQQQYSQYNAPQQMYNQPTQSLGYQTGPVHNYSNMPFQ
SPSSQDPNITSGPNVQPIQPNINPVQYEYFPNTGSYPPNPTQQQSQPLPN
NFPPMHPPNMPLQSNNPPLPSQLPNQTGSRYGPQTQSLNPEYMPSAVQVI
ELDKSNNNAPYPTGTRDKVPPLVTTDFIAIDQGTCNPKYIRSSIYAVPAA
PDMLKSLNIPFVLNICPFAKLDEAEQRIVCGELNPKGPIRCIRCKAYMSP
LMTFIDGGRRFQCNICGGNTEVSEENFAHLDQSGRRIDCFNRPELCLGSY
ELMATAEYCKNDTLPNPPAFIFMLDVSHNSVKSGLLNLFCNNLKDHILPY
LATDQLVPDSPKPLVGFVTYDRVLHFYNLQSNMSKPQMLVISYLDNDNGS
DLVPLVNGFLVDPDEAIEQISILMENIIDNFKDTEERNVVLGPVIEAGME
ALKAAGGRAGKLFIFHSSLPMVEAPGKLKARDERTILGTDKEKTLFSSGS
SYYSKLADSCSESGVSIDLFLTPSAFIDVATLSDLPKCTGGNLYKYDFFS
PSNHGTKLLKDIQHAVSSPFAFDAVMRVRTSLGTRTVDFLGNFYMKNTED
VNLACVSSDKSVIVEIRHNDKLQENESVNIQVAVLYTSISGQRRLRIHNI
SFNVSTNILDIFKLTDLDTLMNWMSRNAVKTFQAKSVKEVRDEISQRSSQ
ILASYRRNYAEQSKPAELVLPENLKLLPLYANSLLKCDFMQSDNSYVSEQ
TRDSGTDLATDERAYQCFLMNDMDVKHTQVFLYPRLLPLINAKSEFSAES
KHLPSAIRDSYVNLSSEGAYLIENGISIILWIGQNANREWLQNVFDCSSP
SEIINRYSLPIHNNNVSLEVNRIVQIIRSTRSRFMMLNIVIQGDRMESAF
KKLLVEDRGERGNSSYVDFLCHIHKEIRSILNY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002032epidermal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036465vWFA_dom_sf
IPR036180Gelsolin-like_dom_sf
IPR036175Sec23/24_helical_dom_sf
IPR036174Znf_Sec23_Sec24_sf
IPR006896Sec23/24_trunk_dom
IPR006900Sec23/24_helical_dom
IPR006895Znf_Sec23_Sec24
IPR012990Sec23_24_beta_S
IPR029006ADF-H/Gelsolin-like_dom_sf
IPR002035VWF_A
IPR007123Gelsolin-like_dom
Vocabulary: biological process
TermDefinition
GO:0006888ER to Golgi vesicle-mediated transport
GO:0006886intracellular protein transport
GO:0006810transport
GO:0015031protein transport
Vocabulary: cellular component
TermDefinition
GO:0030127COPII vesicle coat
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.120.730coord: 705..976
e-value: 4.7E-252
score: 839.9
NoneNo IPR availableGENE3DG3DSA:2.60.40.1670coord: 235..704
e-value: 4.7E-252
score: 839.9
NoneNo IPR availableGENE3DG3DSA:2.30.30.380coord: 231..347
e-value: 4.7E-252
score: 839.9
NoneNo IPR availablePANTHERPTHR13803:SF5PROTEIN TRANSPORT PROTEIN SEC24Ccoord: 55..981
NoneNo IPR availablePANTHERPTHR13803SEC24-RELATED PROTEINcoord: 55..981
NoneNo IPR availableSUPERFAMILYSSF81995beta-sandwich domain of Sec23/24coord: 119..713
IPR036465von Willebrand factor A-like domain superfamilyGENE3DG3DSA:3.40.50.410coord: 367..618
e-value: 4.7E-252
score: 839.9
IPR036465von Willebrand factor A-like domain superfamilySUPERFAMILYSSF53300vWA-likecoord: 365..617
IPR006900Sec23/Sec24, helical domainPFAMPF04815Sec23_helicalcoord: 716..828
e-value: 5.4E-19
score: 67.9
IPR006895Zinc finger, Sec23/Sec24-typePFAMPF04810zf-Sec23_Sec24coord: 288..323
e-value: 3.3E-12
score: 46.2
IPR006896Sec23/Sec24, trunk domainPFAMPF04811Sec23_trunkcoord: 365..615
e-value: 2.6E-63
score: 213.9
IPR029006ADF-H/Gelsolin-like domain superfamilyGENE3DG3DSA:3.40.20.10coord: 834..957
e-value: 4.7E-252
score: 839.9
IPR012990Sec23/Sec24 beta-sandwichPFAMPF08033Sec23_BScoord: 621..704
e-value: 1.6E-16
score: 60.8
IPR036180Gelsolin-like domain superfamilySUPERFAMILYSSF82754C-terminal, gelsolin-like domain of Sec23/24coord: 846..978
IPR036175Sec23/Sec24 helical domain superfamilySUPERFAMILYSSF81811Helical domain of Sec23/24coord: 716..833
IPR036174Zinc finger, Sec23/Sec24-type superfamilySUPERFAMILYSSF82919Zn-finger domain of Sec23/24coord: 285..361