LIM/homeobox protein

Overview
NameLIM/homeobox protein
Smed IDSMED30023015
Length (bp)1133
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of LIM/homeobox protein (SMED30023015) t-SNE clustered cells

Violin plots show distribution of expression levels for LIM/homeobox protein (SMED30023015) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of LIM/homeobox protein (SMED30023015) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for LIM/homeobox protein (SMED30023015) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023015

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30023015h1SMcG0003155 SmedASXL_011745SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30023015h1SMcG0003155 dd_Smed_v4_8190_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30023015h1SMcG0003155 dd_Smed_v4_8190_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023015h1SMcG0003155 Contig42891uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023015h1SMcG0003155 Contig42891newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023015h1SMcG0022977 Contig42891uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023015h1SMcG0022977 Contig42891newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
tail regionSMED30023015h1SMcG0022977 dd_Smed_v6_8190_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of LIM/homeobox protein vs. Ensembl Human
Match: LHX9 (LIM homeobox 9 [Source:HGNC Symbol;Acc:HGNC:14222])

HSP 1 Score: 199.519 bits (506), Expect = 8.697e-60
Identity = 104/274 (37.96%), Postives = 153/274 (55.84%), Query Frame = 1
Query:  109 LCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFC--------QDEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISKQ--------KRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRR-------SGLSKSDTNS 861
            LC+GC   I+D+YYL   +  WH  CLKC  C+ +L+   +C+ ++G+ YC+ DY+R +  ++CA+C   I   EMVM+  +SV+H+ CF C  C K L +G++F +  ++++C        Q E       T  +       L   N     +    + +    +GV  D V  N      +   +   +Q        KR+RTSFKHHQ+R M++YF++NHNPD KDLK L++KTGL+KRVLQVWFQNARAKFRR        G+ K+D  S
Sbjct:   61 LCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSLVYCRAHFETLLQGEYPPQLSYTELAAKSGGLALPYFNGTGTVQKGRPRKRKSPALGV--DIVNYNSGCNENEADHLDRDQQPYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTS 332          
BLAST of LIM/homeobox protein vs. Ensembl Human
Match: LHX9 (LIM homeobox 9 [Source:HGNC Symbol;Acc:HGNC:14222])

HSP 1 Score: 199.134 bits (505), Expect = 1.324e-59
Identity = 104/274 (37.96%), Postives = 153/274 (55.84%), Query Frame = 1
Query:  109 LCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFC--------QDEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISKQ--------KRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRR-------SGLSKSDTNS 861
            LC+GC   I+D+YYL   +  WH  CLKC  C+ +L+   +C+ ++G+ YC+ DY+R +  ++CA+C   I   EMVM+  +SV+H+ CF C  C K L +G++F +  ++++C        Q E       T  +       L   N     +    + +    +GV  D V  N      +   +   +Q        KR+RTSFKHHQ+R M++YF++NHNPD KDLK L++KTGL+KRVLQVWFQNARAKFRR        G+ K+D  S
Sbjct:   70 LCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSLVYCRAHFETLLQGEYPPQLSYTELAAKSGGLALPYFNGTGTVQKGRPRKRKSPALGV--DIVNYNSGCNENEADHLDRDQQPYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTS 341          
BLAST of LIM/homeobox protein vs. Ensembl Human
Match: LHX2 (LIM homeobox 2 [Source:HGNC Symbol;Acc:HGNC:6594])

HSP 1 Score: 191.045 bits (484), Expect = 2.401e-56
Identity = 102/291 (35.05%), Postives = 160/291 (54.98%), Query Frame = 1
Query:   79 MDNKNNAQRLLCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQ---DEIRKSSISTIFSGIQSDFR-------------------LGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNIS-------PRH--QDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRRSGLSKSDTN 858
            M + ++ +  LC+GC   I+D+YYL   +  WH  CLKC  C+ +L+   +C+ ++G+ YC+ DY+R +  ++CA+C   I   EMVM+  + V+H++CF C  C K L +G++F +  ++++C+   + + +      F+                          LGL     +      + + R+  G   D    N +         H  +D       K KR+RTSFKHHQ+R M++YF++NHNPD KDLK L++KTGL+KRVLQVWFQNARAKFRR+ L + +T 
Sbjct:   42 MPSISSDRAALCAGCGGKISDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYCRLHFEALLQGEYPAHFNHADVAAAAAAAAAAKSAGLGAAGANPLGLPYYNGVGTVQKGRPRKRKSPGPGADLAAYNAALSCNENDAEHLDRDQPYPSSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENTG 332          
BLAST of LIM/homeobox protein vs. Ensembl Human
Match: LHX2 (LIM homeobox 2 [Source:HGNC Symbol;Acc:HGNC:6594])

HSP 1 Score: 184.111 bits (466), Expect = 1.302e-53
Identity = 102/299 (34.11%), Postives = 160/299 (53.51%), Query Frame = 1
Query:   79 MDNKNNAQRLLCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYF--------RIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQ---DEIRKSSISTIFSGIQSDFR-------------------LGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNIS-------PRH--QDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRRSGLSKSDTN 858
            M + ++ +  LC+GC   I+D+YYL   +  WH  CLKC  C+ +L+   +C+ ++G+ YC+ DY+        R +  ++CA+C   I   EMVM+  + V+H++CF C  C K L +G++F +  ++++C+   + + +      F+                          LGL     +      + + R+  G   D    N +         H  +D       K KR+RTSFKHHQ+R M++YF++NHNPD KDLK L++KTGL+KRVLQVWFQNARAKFRR+ L + +T 
Sbjct:   40 MPSISSDRAALCAGCGGKISDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYSPSLHGPYRRFSVQRCARCHLGISASEMVMRARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYCRLHFEALLQGEYPAHFNHADVAAAAAAAAAAKSAGLGAAGANPLGLPYYNGVGTVQKGRPRKRKSPGPGADLAAYNAALSCNENDAEHLDRDQPYPSSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENTG 338          
BLAST of LIM/homeobox protein vs. Ensembl Human
Match: LHX9 (LIM homeobox 9 [Source:HGNC Symbol;Acc:HGNC:14222])

HSP 1 Score: 169.474 bits (428), Expect = 4.606e-49
Identity = 88/245 (35.92%), Postives = 135/245 (55.10%), Query Frame = 1
Query:  109 LCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFC--------QDEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISKQ--------KRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQ 795
            LC+GC   I+D+YYL   +  WH  CLKC  C+ +L+   +C+ ++G+ YC+ DY+R +  ++CA+C   I   EMVM+  +SV+H+ CF C  C K L +G++F +  ++++C        Q E       T  +       L   N     +    + +    +GV  D V  N      +   +   +Q        KR+RTSFKHHQ+R M++YF++NHNPD KDLK L++KTGL+KRVLQ
Sbjct:   61 LCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSLVYCRAHFETLLQGEYPPQLSYTELAAKSGGLALPYFNGTGTVQKGRPRKRKSPALGV--DIVNYNSGCNENEADHLDRDQQPYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQ 303          
BLAST of LIM/homeobox protein vs. Ensembl Celegans
Match: ttx-3 (LIM/homeobox protein ttx-3 [Source:UniProtKB/Swiss-Prot;Acc:G5EE86])

HSP 1 Score: 169.859 bits (429), Expect = 5.149e-49
Identity = 91/244 (37.30%), Postives = 137/244 (56.15%), Query Frame = 1
Query:  112 CSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNG-NILFCQ---DEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRR 831
            C  C   I DK     D   +H +CL+C +C+   + ++ CY R+G F C+ D+ + YQ + C KC+  +  ++MVMK    +FH  CF+C +CG +LN G+Y+ ++    L+C    + +R + +    +       +          +    + P +P      E + +     +D    G  + KR+RTSFKHHQ+R M+TYF+LNHNPD KDLK L+ KT L+KRVLQVWFQNARAK+RR
Sbjct:   82 CCLCTFAIVDKEISVVDGKYYHNNCLRCQMCDIPFEYSDKCYVRDGVFLCRADHAKRYQ-KCCRKCEIPLNREDMVMKAKEMIFHHACFVCFICGIKLNPGDYYTMSPQGHLYCHAHYNAVRSTVLCEEAAVATVPAVVAPPPPPPTTTTAPPPAAPEQPPREASTEAEASTD---EDGNGSGSQRSKRMRTSFKHHQLRAMKTYFALNHNPDAKDLKQLAAKTNLTKRVLQVWFQNARAKYRR 321          
BLAST of LIM/homeobox protein vs. Ensembl Celegans
Match: ttx-3 (LIM/homeobox protein ttx-3 [Source:UniProtKB/Swiss-Prot;Acc:G5EE86])

HSP 1 Score: 170.244 bits (430), Expect = 6.897e-49
Identity = 91/244 (37.30%), Postives = 137/244 (56.15%), Query Frame = 1
Query:  112 CSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNG-NILFCQ---DEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRR 831
            C  C   I DK     D   +H +CL+C +C+   + ++ CY R+G F C+ D+ + YQ + C KC+  +  ++MVMK    +FH  CF+C +CG +LN G+Y+ ++    L+C    + +R + +    +       +          +    + P +P      E + +     +D    G  + KR+RTSFKHHQ+R M+TYF+LNHNPD KDLK L+ KT L+KRVLQVWFQNARAK+RR
Sbjct:  110 CCLCTFAIVDKEISVVDGKYYHNNCLRCQMCDIPFEYSDKCYVRDGVFLCRADHAKRYQ-KCCRKCEIPLNREDMVMKAKEMIFHHACFVCFICGIKLNPGDYYTMSPQGHLYCHAHYNAVRSTVLCEEAAVATVPAVVAPPPPPPTTTTAPPPAAPEQPPREASTEAEASTD---EDGNGSGSQRSKRMRTSFKHHQLRAMKTYFALNHNPDAKDLKQLAAKTNLTKRVLQVWFQNARAKYRR 349          
BLAST of LIM/homeobox protein vs. Ensembl Celegans
Match: lim-4 (LIM domain family [Source:UniProtKB/TrEMBL;Acc:A0A1X7RC92])

HSP 1 Score: 130.568 bits (327), Expect = 1.774e-34
Identity = 79/249 (31.73%), Postives = 122/249 (49.00%), Query Frame = 1
Query:   88 KNNAQRLLCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQ-QRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQDEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRR 831
            K +A  ++C+ C+  I DK++L  D   +H +CL+C  CE  L  +N C+ ++ TFYC+  YFR  +   KCA C   I+  + V +  N V+H+ CF C  C ++L++GE + L    L C+                    L L    S   S  +K+K                                R+RT+F   Q+ V++TYF+ + NPD  DL+ ++  TGLSKRV QVWFQN+RA+ ++
Sbjct:   90 KPDAVIVICTQCQHQIQDKFFLSIDGRNYHENCLQCSTCENPL--SNKCFYKDKTFYCKGCYFRCRELGPKCASCDRTIQATDWVRRARNYVYHLACFSCNQCKRQLSTGEEYALQEGNLLCKQHF-----------------LELVEGDSGVSSQKAKTK--------------------------------RVRTTFAEDQLSVLQTYFNRDSNPDGADLEKIASMTGLSKRVTQVWFQNSRARQKK 287          
BLAST of LIM/homeobox protein vs. Ensembl Celegans
Match: lim-4 (LIM domain family [Source:UniProtKB/TrEMBL;Acc:A0A1X7RC92])

HSP 1 Score: 130.183 bits (326), Expect = 2.205e-34
Identity = 79/248 (31.85%), Postives = 121/248 (48.79%), Query Frame = 1
Query:   88 KNNAQRLLCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQDEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRR 831
            K +A  ++C+ C+  I DK++L  D   +H +CL+C  CE  L  +N C+ ++ TFYC+  YFR     KCA C   I+  + V +  N V+H+ CF C  C ++L++GE + L    L C+                    L L    S   S  +K+K                                R+RT+F   Q+ V++TYF+ + NPD  DL+ ++  TGLSKRV QVWFQN+RA+ ++
Sbjct:   90 KPDAVIVICTQCQHQIQDKFFLSIDGRNYHENCLQCSTCENPL--SNKCFYKDKTFYCKGCYFRELGP-KCASCDRTIQATDWVRRARNYVYHLACFSCNQCKRQLSTGEEYALQEGNLLCKQHF-----------------LELVEGDSGVSSQKAKTK--------------------------------RVRTTFAEDQLSVLQTYFNRDSNPDGADLEKIASMTGLSKRVTQVWFQNSRARQKK 285          
BLAST of LIM/homeobox protein vs. Ensembl Celegans
Match: lim-4 (LIM domain family [Source:UniProtKB/TrEMBL;Acc:A0A1X7RC92])

HSP 1 Score: 127.872 bits (320), Expect = 1.870e-33
Identity = 79/258 (30.62%), Postives = 122/258 (47.29%), Query Frame = 1
Query:   88 KNNAQRLLCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQR----------KCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQDEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRR 831
            K +A  ++C+ C+  I DK++L  D   +H +CL+C  CE  L  +N C+ ++ TFYC+  YFR +             KCA C   I+  + V +  N V+H+ CF C  C ++L++GE + L    L C+                    L L    S   S  +K+K                                R+RT+F   Q+ V++TYF+ + NPD  DL+ ++  TGLSKRV QVWFQN+RA+ ++
Sbjct:   90 KPDAVIVICTQCQHQIQDKFFLSIDGRNYHENCLQCSTCENPL--SNKCFYKDKTFYCKGCYFRTHVTSTASSCRELGPKCASCDRTIQATDWVRRARNYVYHLACFSCNQCKRQLSTGEEYALQEGNLLCKQHF-----------------LELVEGDSGVSSQKAKTK--------------------------------RVRTTFAEDQLSVLQTYFNRDSNPDGADLEKIASMTGLSKRVTQVWFQNSRARQKK 296          
BLAST of LIM/homeobox protein vs. Ensembl Fly
Match: ap (gene:FBgn0267978 transcript:FBtr0086058)

HSP 1 Score: 199.134 bits (505), Expect = 4.730e-59
Identity = 104/280 (37.14%), Postives = 153/280 (54.64%), Query Frame = 1
Query:  112 CSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFC--------QDEIRKSSISTIFSGIQSDFRLGLQNN--------------------------QSLFESIFSKSKP--RRPIGVLDDEVQLNISPRHQDFV----MMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRR 831
            CSGC   I D++YL   E  WH SCL+C  C Q L++ +SCY R+G  YC++DY+  +  R+C++C   I   E+VM+  N VFH++CF C VC   L  G+ + +   +++C        + +   SS+S  +       + G  +N                            L +    K +P  R+P  +      ++++  + DF     +   S+ KR+RTSFKHHQ+R M++YF++NHNPD KDLK LS+KTGL KRVLQVWFQNARAK+RR
Sbjct:  148 CSGCGRQIQDRFYLSAVEKRWHASCLQCYACRQPLERESSCYSRDGNIYCKNDYYSFFGTRRCSRCLASISSNELVMRARNLVFHVNCFCCTVCHTPLTKGDQYGIIDALIYCRTHYSIAREGDTASSSMSATY---PYSAQFGSPHNDSSSPHSDPSRSIVPTGIFVPASHVINGLPQPARQKGRPRKRKPKDIEAFTANIDLNTEYVDFGRGSHLSSSSRTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLSQKTGLPKRVLQVWFQNARAKWRR 424          
BLAST of LIM/homeobox protein vs. Ensembl Fly
Match: ap (gene:FBgn0267978 transcript:FBtr0300504)

HSP 1 Score: 198.749 bits (504), Expect = 5.086e-59
Identity = 104/280 (37.14%), Postives = 153/280 (54.64%), Query Frame = 1
Query:  112 CSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFC--------QDEIRKSSISTIFSGIQSDFRLGLQNN--------------------------QSLFESIFSKSKP--RRPIGVLDDEVQLNISPRHQDFV----MMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRR 831
            CSGC   I D++YL   E  WH SCL+C  C Q L++ +SCY R+G  YC++DY+  +  R+C++C   I   E+VM+  N VFH++CF C VC   L  G+ + +   +++C        + +   SS+S  +       + G  +N                            L +    K +P  R+P  +      ++++  + DF     +   S+ KR+RTSFKHHQ+R M++YF++NHNPD KDLK LS+KTGL KRVLQVWFQNARAK+RR
Sbjct:  147 CSGCGRQIQDRFYLSAVEKRWHASCLQCYACRQPLERESSCYSRDGNIYCKNDYYSFFGTRRCSRCLASISSNELVMRARNLVFHVNCFCCTVCHTPLTKGDQYGIIDALIYCRTHYSIAREGDTASSSMSATY---PYSAQFGSPHNDSSSPHSDPSRSIVPTGIFVPASHVINGLPQPARQKGRPRKRKPKDIEAFTANIDLNTEYVDFGRGSHLSSSSRTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLSQKTGLPKRVLQVWFQNARAKWRR 423          
BLAST of LIM/homeobox protein vs. Ensembl Fly
Match: Awh (gene:FBgn0013751 transcript:FBtr0073155)

HSP 1 Score: 126.716 bits (317), Expect = 2.838e-34
Identity = 74/237 (31.22%), Postives = 117/237 (49.37%), Query Frame = 1
Query:  112 CSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQDEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAK 822
            C+ C   I+D+++L      WH  CL+C +C   LD+  SC+ R    YC+ DY + +   KC+KC   I   + V +    VFH+ CF C  CG++L++GE F L  + + C+       + T+  G  S       +++      + KSK                               KR+RT+F   Q++V++  F ++ NPD +DL+ ++  TGLSKRV QVWFQN+RA+
Sbjct:    8 CAACGEPISDRFFLEVGGCSWHAHCLRCCMCMCPLDRQQSCFIRERQVYCKADYSKNFGA-KCSKCCRGISASDWVRRARELVFHLACFACDQCGRQLSTGEQFALMDDRVLCKAHY----LETVEGGTTS-------SDEGCDGDGYHKSKT------------------------------KRVRTTFTEEQLQVLQANFQIDSNPDGQDLERIASVTGLSKRVTQVWFQNSRAR 202          
BLAST of LIM/homeobox protein vs. Ensembl Fly
Match: Awh (gene:FBgn0013751 transcript:FBtr0330071)

HSP 1 Score: 126.716 bits (317), Expect = 9.721e-34
Identity = 74/240 (30.83%), Postives = 119/240 (49.58%), Query Frame = 1
Query:  112 CSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQDEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRR 831
            C+ C   I+D+++L      WH  CL+C +C   LD+  SC+ R    YC+ DY + +   KC+KC   I   + V +    VFH+ CF C  CG++L++GE F L  + + C+       + T+  G  S       +++      + KSK                               KR+RT+F   Q++V++  F ++ NPD +DL+ ++  TGLSKRV QVWFQN+RA+ ++
Sbjct:    8 CAACGEPISDRFFLEVGGCSWHAHCLRCCMCMCPLDRQQSCFIRERQVYCKADYSKNFGA-KCSKCCRGISASDWVRRARELVFHLACFACDQCGRQLSTGEQFALMDDRVLCKAHY----LETVEGGTTS-------SDEGCDGDGYHKSKT------------------------------KRVRTTFTEEQLQVLQANFQIDSNPDGQDLERIASVTGLSKRVTQVWFQNSRARQKK 205          
BLAST of LIM/homeobox protein vs. Ensembl Fly
Match: Awh (gene:FBgn0013751 transcript:FBtr0330070)

HSP 1 Score: 127.102 bits (318), Expect = 1.019e-33
Identity = 75/240 (31.25%), Postives = 116/240 (48.33%), Query Frame = 1
Query:  112 CSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQDEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRR 831
            C+ C   I+D+++L      WH  CL+C +C   LD+  SC+ R    YC+ DY + +   KC+KC   I   + V +    VFH+ CF C  CG++L++GE F L  + + C+       + T+  G  S                                     S    D      SK KR+RT+F   Q++V++  F ++ NPD +DL+ ++  TGLSKRV QVWFQN+RA+ ++
Sbjct:    8 CAACGEPISDRFFLEVGGCSWHAHCLRCCMCMCPLDRQQSCFIRERQVYCKADYSKNFGA-KCSKCCRGISASDWVRRARELVFHLACFACDQCGRQLSTGEQFALMDDRVLCKAHY----LETVEGGTTS-------------------------------------SDEGCDGDGYHKSKTKRVRTTFTEEQLQVLQANFQIDSNPDGQDLERIASVTGLSKRVTQVWFQNSRARQKK 205          
BLAST of LIM/homeobox protein vs. Ensembl Zebrafish
Match: lhx2b (LIM homeobox 2b [Source:ZFIN;Acc:ZDB-GENE-051220-1])

HSP 1 Score: 206.068 bits (523), Expect = 3.859e-62
Identity = 104/270 (38.52%), Postives = 159/270 (58.89%), Query Frame = 1
Query:  109 LCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQ---DEIRKSSISTIFS--------GIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNIS---------PRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRRSGLSKSDTN 858
            LC+GC   I+D+YYL   +  WH  CLKC  C+ +L+   +C+ ++G+ YC+ DY+R +  ++CA+C   I   EMVM+  + V+H++CF C  C K L +G++F +  ++++C+   + + +    T F+        G+ S   LGL     +      + + R+  G   D    N +         P  +D       K KR+RTSFKHHQ+R M++YF++NHNPD KDLK L++KTGL+KRVLQVWFQNARAKFRR+ L + +T 
Sbjct:   83 LCAGCGGKISDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYCRLHFETLIQGDFPTHFNHTDVAPNKGLSSTGPLGLSYYNGVNTVQKGRPRKRKSPGPGADLAAYNAALSCNENDGDPMDRDSQYSSSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENTG 352          
BLAST of LIM/homeobox protein vs. Ensembl Zebrafish
Match: lhx2a (LIM homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-091118-109])

HSP 1 Score: 197.208 bits (500), Expect = 7.982e-60
Identity = 97/263 (36.88%), Postives = 159/263 (60.46%), Query Frame = 1
Query:   82 DNKNNAQRLLCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQDEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRR--------PIGVLDD--EVQLNISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRRSGL 840
            +N++ +   +C+GC  +I+D++YL   E  WH  CLKC  C+  L+   +C+ ++G  YC+ DY+R +  ++CA+C   I   E+VM+  + V+H+ CF C  C K L +G+++ +    ++C+  I++   + ++    S      +++    ES   +++ RR         I    D  ++ +++S R      +   K KR+RTSFKHHQ+R M+++F+ NHNPD KDLK L++KTGL+KRVLQVWFQNARAKFRR+ L
Sbjct:    3 NNESGSDAPVCAGCGALISDRFYLLAAERRWHERCLKCSACQTDLESELTCFSKHGDIYCKEDYYRRFSSQRCARCHLGISATEIVMRARDLVYHLSCFSCATCHKVLLTGDHYGMKETSVYCRAHIQRECHADLYYSDMSSRETNSESHTYDEESPVHRARVRRRKNNSTADHIAYSSDVSDLGVDLSER------VSCQKSKRMRTSFKHHQLRSMQSFFTHNHNPDAKDLKELAQKTGLTKRVLQVWFQNARAKFRRNCL 259          
BLAST of LIM/homeobox protein vs. Ensembl Zebrafish
Match: lhx9 (LIM homeobox 9 [Source:NCBI gene;Acc:550405])

HSP 1 Score: 199.134 bits (505), Expect = 8.479e-60
Identity = 107/291 (36.77%), Postives = 163/291 (56.01%), Query Frame = 1
Query:   79 MDNKNNAQRLLCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQ------------DEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRR---PIGVLD--------DEVQLNISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRR-------SGLSKSDTNS 861
            M + +  +  LC+GC   I+D+YYL   +  WH  CLKC  C+ +L+   +C+ ++G+ YC+ DY+R +  ++CA+C   I   EMVM+  +SV+H+ CF C  C K L +G++F +  N+++C+             ++  + ++    G+   +  G    Q        K +PR+   P   +D        +E   +   R Q        K KR+RTSFKHHQ+R M++YF++NHNPD KDLK L++KTGL+KRVLQVWFQNARAKFRR        G+ K+D  S
Sbjct:   60 MPSMSPEKPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDSVYHLSCFTCTTCNKTLTTGDHFGMKDNLVYCRVHFETLIQGEYHPQLNYAELAAKGGGLALPYFNGTGTVQ--------KGRPRKRKSPAMGIDIGSYSSGCNENDADHLDRDQQPYPPS-QKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNVLRQENGGVDKADGTS 341          
BLAST of LIM/homeobox protein vs. Ensembl Zebrafish
Match: lhx2a (LIM homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-091118-109])

HSP 1 Score: 192.586 bits (488), Expect = 5.410e-58
Identity = 97/264 (36.74%), Postives = 159/264 (60.23%), Query Frame = 1
Query:   82 DNKNNAQRLLCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYF-RIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQDEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRR--------PIGVLDD--EVQLNISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRRSGL 840
            +N++ +   +C+GC  +I+D++YL   E  WH  CLKC  C+  L+   +C+ ++G  YC+ DY+ R +  ++CA+C   I   E+VM+  + V+H+ CF C  C K L +G+++ +    ++C+  I++   + ++    S      +++    ES   +++ RR         I    D  ++ +++S R      +   K KR+RTSFKHHQ+R M+++F+ NHNPD KDLK L++KTGL+KRVLQVWFQNARAKFRR+ L
Sbjct:    3 NNESGSDAPVCAGCGALISDRFYLLAAERRWHERCLKCSACQTDLESELTCFSKHGDIYCKEDYYSRRFSSQRCARCHLGISATEIVMRARDLVYHLSCFSCATCHKVLLTGDHYGMKETSVYCRAHIQRECHADLYYSDMSSRETNSESHTYDEESPVHRARVRRRKNNSTADHIAYSSDVSDLGVDLSER------VSCQKSKRMRTSFKHHQLRSMQSFFTHNHNPDAKDLKELAQKTGLTKRVLQVWFQNARAKFRRNCL 260          
BLAST of LIM/homeobox protein vs. Ensembl Zebrafish
Match: lhx9 (LIM homeobox 9 [Source:NCBI gene;Acc:550405])

HSP 1 Score: 169.088 bits (427), Expect = 6.260e-49
Identity = 91/262 (34.73%), Postives = 145/262 (55.34%), Query Frame = 1
Query:   79 MDNKNNAQRLLCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQ------------DEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRR---PIGVLD--------DEVQLNISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQ 795
            M + +  +  LC+GC   I+D+YYL   +  WH  CLKC  C+ +L+   +C+ ++G+ YC+ DY+R +  ++CA+C   I   EMVM+  +SV+H+ CF C  C K L +G++F +  N+++C+             ++  + ++    G+   +  G    Q        K +PR+   P   +D        +E   +   R Q        K KR+RTSFKHHQ+R M++YF++NHNPD KDLK L++KTGL+KRVLQ
Sbjct:   60 MPSMSPEKPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDSVYHLSCFTCTTCNKTLTTGDHFGMKDNLVYCRVHFETLIQGEYHPQLNYAELAAKGGGLALPYFNGTGTVQ--------KGRPRKRKSPAMGIDIGSYSSGCNENDADHLDRDQQPYPPS-QKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQ 312          
BLAST of LIM/homeobox protein vs. Ensembl Xenopus
Match: zfp36l2 (ZFP36 ring finger protein-like 2 [Source:Xenbase;Acc:XB-GENE-971012])

HSP 1 Score: 199.134 bits (505), Expect = 1.127e-59
Identity = 105/274 (38.32%), Postives = 160/274 (58.39%), Query Frame = 1
Query:   79 MDNKNNAQRLLCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQ------------DEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRR----PIGV----LDDEVQLNISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRRSGL 840
            M + +  +  LC+GC   I+D+YYL   +  WH  CLKC  C+ +L+   +C+ ++G+ YC+ DY+R +  ++CA+C   I   EMVM+   SV+H+ CF C  C K L++G++F +  N+++C+             ++  + +S    GI +   L   +N +       K +PR+     +GV           N +   +D       K KR+RTSFKHHQ+R M++YF++NHNPD KDLK L++KTGL+KRVLQVWFQNARAKFRR+ L
Sbjct:   50 MPSLSPEKPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARESVYHLSCFTCTTCNKTLSTGDHFGMKENLVYCRIHFELLVQGDFHQQLNYTELSAKGGGIAT---LPYFSNGT---GTVQKGRPRKRKSPALGVDIINYSSGCNENETDLDRDQTYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLL 317          
BLAST of LIM/homeobox protein vs. Ensembl Xenopus
Match: zfp36l2 (ZFP36 ring finger protein-like 2 [Source:Xenbase;Acc:XB-GENE-971012])

HSP 1 Score: 199.134 bits (505), Expect = 1.218e-59
Identity = 105/274 (38.32%), Postives = 160/274 (58.39%), Query Frame = 1
Query:   79 MDNKNNAQRLLCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQ------------DEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRR----PIGV----LDDEVQLNISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRRSGL 840
            M + +  +  LC+GC   I+D+YYL   +  WH  CLKC  C+ +L+   +C+ ++G+ YC+ DY+R +  ++CA+C   I   EMVM+   SV+H+ CF C  C K L++G++F +  N+++C+             ++  + +S    GI +   L   +N +       K +PR+     +GV           N +   +D       K KR+RTSFKHHQ+R M++YF++NHNPD KDLK L++KTGL+KRVLQVWFQNARAKFRR+ L
Sbjct:   61 MPSLSPEKPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARESVYHLSCFTCTTCNKTLSTGDHFGMKENLVYCRIHFELLVQGDFHQQLNYTELSAKGGGIAT---LPYFSNGT---GTVQKGRPRKRKSPALGVDIINYSSGCNENETDLDRDQTYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLL 328          
BLAST of LIM/homeobox protein vs. Ensembl Xenopus
Match: LHX2 (LIM homeobox 2 [Source:NCBI gene;Acc:100486746])

HSP 1 Score: 198.364 bits (503), Expect = 2.803e-59
Identity = 108/279 (38.71%), Postives = 160/279 (57.35%), Query Frame = 1
Query:   79 MDNKNNAQRLLCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFC--------QDEIRKS-SISTIFSGIQSDF-----RLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNIS-----------PRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRRSGL 840
            M + ++ +  LC+GC   I+D+YYL   +  WH  CLKC  C+ +L+   +C+ ++G+ YC+ DY+R +  ++CA+C   I   EMVM+  + V+H++CF C  C K L +G++F +  N+++C        Q E +   S S + SG  S        LGL     +      + + R+  G   D    N +            R Q +      K KR+RTSFKHHQ+R M++YF++NHNPD KDLK L++KTGL+KRVLQVWFQNARAKFRR+ L
Sbjct:   42 MPSISSDRAALCAGCGGKISDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDLVYHLNCFTCNTCNKMLTTGDHFGMKDNLVYCRLHFETLIQGEYQVHFSHSDVASGKGSGLGTGAASLGLPYYNGVGTVQKGRPRKRKSPGPGADLAAYNAALSCNENDGDHMDRDQQYTPN--QKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLL 318          
BLAST of LIM/homeobox protein vs. Ensembl Xenopus
Match: LHX2 (LIM homeobox 2 [Source:NCBI gene;Acc:100486746])

HSP 1 Score: 198.749 bits (504), Expect = 3.200e-59
Identity = 108/279 (38.71%), Postives = 160/279 (57.35%), Query Frame = 1
Query:   79 MDNKNNAQRLLCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFC--------QDEIRKS-SISTIFSGIQSDF-----RLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNIS-----------PRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRRSGL 840
            M + ++ +  LC+GC   I+D+YYL   +  WH  CLKC  C+ +L+   +C+ ++G+ YC+ DY+R +  ++CA+C   I   EMVM+  + V+H++CF C  C K L +G++F +  N+++C        Q E +   S S + SG  S        LGL     +      + + R+  G   D    N +            R Q +      K KR+RTSFKHHQ+R M++YF++NHNPD KDLK L++KTGL+KRVLQVWFQNARAKFRR+ L
Sbjct:   63 MPSISSDRAALCAGCGGKISDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDLVYHLNCFTCNTCNKMLTTGDHFGMKDNLVYCRLHFETLIQGEYQVHFSHSDVASGKGSGLGTGAASLGLPYYNGVGTVQKGRPRKRKSPGPGADLAAYNAALSCNENDGDHMDRDQQYTPN--QKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLL 339          
BLAST of LIM/homeobox protein vs. Ensembl Xenopus
Match: zfp36l2 (ZFP36 ring finger protein-like 2 [Source:Xenbase;Acc:XB-GENE-971012])

HSP 1 Score: 171.4 bits (433), Expect = 1.174e-49
Identity = 92/259 (35.52%), Postives = 146/259 (56.37%), Query Frame = 1
Query:   79 MDNKNNAQRLLCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQ------------DEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRR----PIGV----LDDEVQLNISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQ 795
            M + +  +  LC+GC   I+D+YYL   +  WH  CLKC  C+ +L+   +C+ ++G+ YC+ DY+R +  ++CA+C   I   EMVM+   SV+H+ CF C  C K L++G++F +  N+++C+             ++  + +S    GI +   L   +N +       K +PR+     +GV           N +   +D       K KR+RTSFKHHQ+R M++YF++NHNPD KDLK L++KTGL+KRVLQ
Sbjct:   61 MPSLSPEKPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARESVYHLSCFTCTTCNKTLSTGDHFGMKENLVYCRIHFELLVQGDFHQQLNYTELSAKGGGIAT---LPYFSNGT---GTVQKGRPRKRKSPALGVDIINYSSGCNENETDLDRDQTYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQ 313          
BLAST of LIM/homeobox protein vs. Ensembl Mouse
Match: Lhx9 (LIM homeobox protein 9 [Source:MGI Symbol;Acc:MGI:1316721])

HSP 1 Score: 199.134 bits (505), Expect = 7.791e-60
Identity = 104/274 (37.96%), Postives = 153/274 (55.84%), Query Frame = 1
Query:  109 LCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFC--------QDEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISKQ--------KRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRR-------SGLSKSDTNS 861
            LC+GC   I+D+YYL   +  WH  CLKC  C+ +L+   +C+ ++G+ YC+ DY+R +  ++CA+C   I   EMVM+  +SV+H+ CF C  C K L +G++F +  ++++C        Q E       T  +       L   N     +    + +    +GV  D V  N      +   +   +Q        KR+RTSFKHHQ+R M++YF++NHNPD KDLK L++KTGL+KRVLQVWFQNARAKFRR        G+ K+D  S
Sbjct:   61 LCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSLVYCRAHFETLLQGEYPPQLSYTELAAKSGGLALPYFNGTGTVQKGRPRKRKSPALGV--DIVNYNSGCNENEADHLDRDQQPYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTS 332          
BLAST of LIM/homeobox protein vs. Ensembl Mouse
Match: Lhx9 (LIM homeobox protein 9 [Source:MGI Symbol;Acc:MGI:1316721])

HSP 1 Score: 198.749 bits (504), Expect = 1.277e-59
Identity = 104/274 (37.96%), Postives = 153/274 (55.84%), Query Frame = 1
Query:  109 LCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFC--------QDEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISKQ--------KRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRR-------SGLSKSDTNS 861
            LC+GC   I+D+YYL   +  WH  CLKC  C+ +L+   +C+ ++G+ YC+ DY+R +  ++CA+C   I   EMVM+  +SV+H+ CF C  C K L +G++F +  ++++C        Q E       T  +       L   N     +    + +    +GV  D V  N      +   +   +Q        KR+RTSFKHHQ+R M++YF++NHNPD KDLK L++KTGL+KRVLQVWFQNARAKFRR        G+ K+D  S
Sbjct:   70 LCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSLVYCRAHFETLLQGEYPPQLSYTELAAKSGGLALPYFNGTGTVQKGRPRKRKSPALGV--DIVNYNSGCNENEADHLDRDQQPYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTS 341          
BLAST of LIM/homeobox protein vs. Ensembl Mouse
Match: Lhx2 (LIM homeobox protein 2 [Source:MGI Symbol;Acc:MGI:96785])

HSP 1 Score: 194.126 bits (492), Expect = 4.413e-58
Identity = 103/291 (35.40%), Postives = 161/291 (55.33%), Query Frame = 1
Query:   79 MDNKNNAQRLLCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQ---DEIRKSSISTIFS-------------------GIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNIS-------PRH--QDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRRSGLSKSDTN 858
            M + ++ +  LC+GC   I+D+YYL   +  WH  CLKC  C+ +L+   +C+ ++G+ YC+ DY+R +  ++CA+C   I   EMVM+  + V+H++CF C  C K L +G++F +  ++++C+   + + +      F+                   G      LGL     +      + + R+  G   D    N +         H  +D       K KR+RTSFKHHQ+R M++YF++NHNPD KDLK L++KTGL+KRVLQVWFQNARAKFRR+ L + +T 
Sbjct:    1 MPSISSDRAALCAGCGGKISDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYCRLHFEALLQGEYPAHFNHADVAAAAAAAAAAKSAGLGSAGANPLGLPYYNGVGTVQKGRPRKRKSPGPGADLAAYNAALSCNENDAEHLDRDQPYPSSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENTG 291          
BLAST of LIM/homeobox protein vs. Ensembl Mouse
Match: Lhx2 (LIM homeobox protein 2 [Source:MGI Symbol;Acc:MGI:96785])

HSP 1 Score: 194.126 bits (492), Expect = 1.105e-57
Identity = 103/291 (35.40%), Postives = 161/291 (55.33%), Query Frame = 1
Query:   79 MDNKNNAQRLLCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQ---DEIRKSSISTIFS-------------------GIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNIS-------PRH--QDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRRSGLSKSDTN 858
            M + ++ +  LC+GC   I+D+YYL   +  WH  CLKC  C+ +L+   +C+ ++G+ YC+ DY+R +  ++CA+C   I   EMVM+  + V+H++CF C  C K L +G++F +  ++++C+   + + +      F+                   G      LGL     +      + + R+  G   D    N +         H  +D       K KR+RTSFKHHQ+R M++YF++NHNPD KDLK L++KTGL+KRVLQVWFQNARAKFRR+ L + +T 
Sbjct:   42 MPSISSDRAALCAGCGGKISDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYCRLHFEALLQGEYPAHFNHADVAAAAAAAAAAKSAGLGSAGANPLGLPYYNGVGTVQKGRPRKRKSPGPGADLAAYNAALSCNENDAEHLDRDQPYPSSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENTG 332          
BLAST of LIM/homeobox protein vs. Ensembl Mouse
Match: Lhx9 (LIM homeobox protein 9 [Source:MGI Symbol;Acc:MGI:1316721])

HSP 1 Score: 169.474 bits (428), Expect = 3.299e-49
Identity = 88/245 (35.92%), Postives = 135/245 (55.10%), Query Frame = 1
Query:  109 LCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFC--------QDEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISKQ--------KRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQ 795
            LC+GC   I+D+YYL   +  WH  CLKC  C+ +L+   +C+ ++G+ YC+ DY+R +  ++CA+C   I   EMVM+  +SV+H+ CF C  C K L +G++F +  ++++C        Q E       T  +       L   N     +    + +    +GV  D V  N      +   +   +Q        KR+RTSFKHHQ+R M++YF++NHNPD KDLK L++KTGL+KRVLQ
Sbjct:   61 LCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSLVYCRAHFETLLQGEYPPQLSYTELAAKSGGLALPYFNGTGTVQKGRPRKRKSPALGV--DIVNYNSGCNENEADHLDRDQQPYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQ 303          
BLAST of LIM/homeobox protein vs. UniProt/SwissProt
Match: sp|Q80W90|LHX9_RAT (LIM/homeobox protein Lhx9 OS=Rattus norvegicus OX=10116 GN=Lhx9 PE=2 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 5.113e-59
Identity = 104/274 (37.96%), Postives = 153/274 (55.84%), Query Frame = 1
Query:  109 LCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFC--------QDEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISKQ--------KRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRR-------SGLSKSDTNS 861
            LC+GC   I+D+YYL   +  WH  CLKC  C+ +L+   +C+ ++G+ YC+ DY+R +  ++CA+C   I   EMVM+  +SV+H+ CF C  C K L +G++F +  ++++C        Q E       T  +       L   N     +    + +    +GV  D V  N      +   +   +Q        KR+RTSFKHHQ+R M++YF++NHNPD KDLK L++KTGL+KRVLQVWFQNARAKFRR        G+ K+D  S
Sbjct:   61 LCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSLVYCRAHFETLLQGEYPPQLSYTELAAKSGGLALPYFNGTGTVQKGRPRKRKSPALGV--DIVNYNSGCNENEADHLDRDQQPYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTS 332          
BLAST of LIM/homeobox protein vs. UniProt/SwissProt
Match: sp|Q90881|LHX9_CHICK (LIM/homeobox protein Lhx9 OS=Gallus gallus OX=9031 GN=LHX9 PE=2 SV=2)

HSP 1 Score: 199.519 bits (506), Expect = 5.657e-59
Identity = 106/284 (37.32%), Postives = 154/284 (54.23%), Query Frame = 1
Query:   79 MDNKNNAQRLLCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFC--------QDEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISKQ--------KRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRR-------SGLSKSDTNS 861
            M   +  +  LC+GC   I+D+YYL   +  WH  CLKC  C+ +L+   +C+ ++G+ YC+ DY+R +  ++CA+C   I   EMVM+   SV+H+ CF C  C K L +G++F +  N+++C        Q E       T  +       L   N     +    + +    +GV  D V  N      +   M   +Q        KR+ TSFKHHQ+R M++YF++NHNPD KDLK L++KTGL+KRVLQVWFQNARAKFRR        G+ K+D  S
Sbjct:   60 MPPMSPEKPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARESVYHLSCFTCTTCNKTLTTGDHFGMKDNLVYCRAHFESLLQGEYPPQLSYTELAAKSGGLALPYFNGTGTVQKGRPRKRKSPALGV--DIVNYNSGCNENEADHMDRDQQPYPPSQKTKRMATSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTS 341          
BLAST of LIM/homeobox protein vs. UniProt/SwissProt
Match: sp|Q9NQ69|LHX9_HUMAN (LIM/homeobox protein Lhx9 OS=Homo sapiens OX=9606 GN=LHX9 PE=1 SV=3)

HSP 1 Score: 199.134 bits (505), Expect = 6.358e-59
Identity = 104/274 (37.96%), Postives = 153/274 (55.84%), Query Frame = 1
Query:  109 LCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFC--------QDEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISKQ--------KRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRR-------SGLSKSDTNS 861
            LC+GC   I+D+YYL   +  WH  CLKC  C+ +L+   +C+ ++G+ YC+ DY+R +  ++CA+C   I   EMVM+  +SV+H+ CF C  C K L +G++F +  ++++C        Q E       T  +       L   N     +    + +    +GV  D V  N      +   +   +Q        KR+RTSFKHHQ+R M++YF++NHNPD KDLK L++KTGL+KRVLQVWFQNARAKFRR        G+ K+D  S
Sbjct:   70 LCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSLVYCRAHFETLLQGEYPPQLSYTELAAKSGGLALPYFNGTGTVQKGRPRKRKSPALGV--DIVNYNSGCNENEADHLDRDQQPYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTS 341          
BLAST of LIM/homeobox protein vs. UniProt/SwissProt
Match: sp|Q1LWV4|LHX9_DANRE (LIM/homeobox protein Lhx9 OS=Danio rerio OX=7955 GN=lhx9 PE=2 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 6.401e-59
Identity = 107/291 (36.77%), Postives = 163/291 (56.01%), Query Frame = 1
Query:   79 MDNKNNAQRLLCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQ------------DEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRR---PIGVLD--------DEVQLNISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRR-------SGLSKSDTNS 861
            M + +  +  LC+GC   I+D+YYL   +  WH  CLKC  C+ +L+   +C+ ++G+ YC+ DY+R +  ++CA+C   I   EMVM+  +SV+H+ CF C  C K L +G++F +  N+++C+             ++  + ++    G+   +  G    Q        K +PR+   P   +D        +E   +   R Q        K KR+RTSFKHHQ+R M++YF++NHNPD KDLK L++KTGL+KRVLQVWFQNARAKFRR        G+ K+D  S
Sbjct:   60 MPSMSPEKPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDSVYHLSCFTCTTCNKTLTTGDHFGMKDNLVYCRVHFETLIQGEYHPQLNYAELAAKGGGLALPYFNGTGTVQ--------KGRPRKRKSPAMGIDIGSYSSGCNENDADHLDRDQQPYPPS-QKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNVLRQENGGVDKADGTS 341          
BLAST of LIM/homeobox protein vs. UniProt/SwissProt
Match: sp|A0JNI8|LHX9_BOVIN (LIM/homeobox protein Lhx9 OS=Bos taurus OX=9913 GN=LHX9 PE=2 SV=2)

HSP 1 Score: 199.134 bits (505), Expect = 8.034e-59
Identity = 104/274 (37.96%), Postives = 152/274 (55.47%), Query Frame = 1
Query:  109 LCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFC--------QDEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISKQ--------KRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRR-------SGLSKSDTNS 861
            LC+GC   I D+YYL   +  WH  CLKC  C+ +L+   +C+ ++G+ YC+ DY+R +  ++CA+C   I   EMVM+  +SV+H+ CF C  C K L +G++F +  ++++C        Q E       T  +       L   N     +    + +    +GV  D V  N      +   +   +Q        KR+RTSFKHHQ+R M++YF++NHNPD KDLK L++KTGL+KRVLQVWFQNARAKFRR        G+ K+D  S
Sbjct:   70 LCAGCGGKIADRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSLVYCRAHFETLLQGEYPPQLSYTELAAKSGGLALPYFNGTGTVQKGRPRKRKSPALGV--DIVNYNSGCNENEADHLDRDQQPYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTS 341          
BLAST of LIM/homeobox protein vs. TrEMBL
Match: R7U050 (Uncharacterized protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_43751 PE=4 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 1.049e-63
Identity = 111/272 (40.81%), Postives = 161/272 (59.19%), Query Frame = 1
Query:  109 LCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFC--------QDEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFS----KSKPRRPIGVLDDEVQLNISPRH----QDFVMMG-----ISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRRSGLSKSDTNS 861
            LC+GC   ITD+YYL+  E  WH +CL+C  C+  LD   +CY R+G+ +C+ DY+R++  ++C+ C   I   E+VMK  +SV+H++CF C  C K L +GE+F +  N+++C        Q E   S        +      G      +F  + +    K +PR+     +DE+++     H     D   +G      ++QKR+RTSFKHHQ+R+M++YF LNHNPD KDLK L++KTGLSKRVLQVWFQNARAK RR+ L K D + 
Sbjct:    1 LCAGCGEKITDRYYLQAVERAWHANCLRCAQCKLPLDSEVTCYARDGSIFCKEDYYRLFAIKRCSGCHLAISANELVMKARDSVYHMNCFTCASCHKLLITGEHFGMKENLIYCRMHYEMVVQGEFYPSPGHGGLDSVSFPALHGPGAMPHVFNGVHAPSAPKGRPRKRKRQAEDELEMCGRSLHGFNENDLPGLGNDMSMQARQKRMRTSFKHHQLRIMKSYFQLNHNPDAKDLKQLAQKTGLSKRVLQVWFQNARAKHRRN-LLKQDADG 271          
BLAST of LIM/homeobox protein vs. TrEMBL
Match: A7RYP5 (Predicted protein (Fragment) OS=Nematostella vectensis OX=45351 GN=v1g98128 PE=4 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 6.905e-62
Identity = 104/259 (40.15%), Postives = 158/259 (61.00%), Query Frame = 1
Query:   91 NNAQRLLCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQDEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPR-RPIGVLDDEVQ---LNISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRRSGLSKSDT 855
             + Q+ +C+GC   I +++YL   +  WH  CLKC  CE  LD   +C+ ++G   C+ DY+R +  +KC+ C + I  KE+VM+  + V+H++CF C  C + L +GEYF + G  ++C+++  +         ++ + R     N +   S+ SK +PR R I    + +     ++S R  +       + KR+RTSFKHHQ+R M+TYF++NHNPD KDLK LS+KTGL+KRVLQVWFQNARAKFRR+  + S T
Sbjct:    2 GDKQQAVCAGCGSRILERFYLMAVDQEWHADCLKCSDCELRLDNELTCFSKDGVILCREDYYRRFSVKKCSSCSQAISSKELVMRARDQVYHVNCFACDRCKRMLATGEYFGMRGIRIYCKEDYEEL--------LREESR-----NPTKINSL-SKGRPRKRRIATAIESITNLGYDLSDRPGELTTGADGRPKRVRTSFKHHQLRAMKTYFAMNHNPDAKDLKQLSQKTGLTKRVLQVWFQNARAKFRRTVCNTSQT 246          
BLAST of LIM/homeobox protein vs. TrEMBL
Match: A0A1S4GZT4 (LIM homeobox protein 2/9 OS=Anopheles gambiae OX=7165 PE=4 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 9.941e-61
Identity = 109/279 (39.07%), Postives = 155/279 (55.56%), Query Frame = 1
Query:  112 CSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQDEIRKSSISTIFSGI---------QSDFRLGLQNNQSLFESIFSKSK-------PRRPIGVLDDEVQLNISPR----------------HQDFVMMGI-------SKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRR 831
            C+GC+  I D++YL   E  WH SCL+C IC Q+L+  NSC+ R+G  YC+ DY+R++  R+C+KC   I   E+VM+  + VFHI CF C VC   LN G+++ +  + +FC+  I     +    G+         QS +        S  +S  S  K       P   +  L  + +    PR                + +++ +G        S+ KR+RTSFKHHQ+R M++YF++NHNPD KDLK LS+KTGL KRVLQVWFQNARAK+RR
Sbjct:  139 CAGCDMPIQDRFYLSAVERKWHASCLQCCICRQTLEGANSCFSRDGNIYCKTDYYRVFGSRRCSKCLASISSSELVMRARHLVFHIRCFSCAVCNTPLNKGDHYTIRDSAVFCRSHIELPLEAATTPGLPGMPMQCPYQSQYGTSPVAPLSPSDSTTSGGKLNPATYYPPHGVTGLPQQPRQKGRPRKRKPKDIEAMTASLDLNTEYLDLGFSRGLGSSSRAKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLSQKTGLPKRVLQVWFQNARAKWRR 417          
BLAST of LIM/homeobox protein vs. TrEMBL
Match: A0A499FSX8 (Uncharacterized protein OS=Anopheles arabiensis OX=7173 PE=4 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 1.102e-60
Identity = 109/279 (39.07%), Postives = 155/279 (55.56%), Query Frame = 1
Query:  112 CSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQDEIRKSSISTIFSGI---------QSDFRLGLQNNQSLFESIFSKSK-------PRRPIGVLDDEVQLNISPR----------------HQDFVMMGI-------SKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRR 831
            C+GC+  I D++YL   E  WH SCL+C IC Q+L+  NSC+ R+G  YC+ DY+R++  R+C+KC   I   E+VM+  + VFHI CF C VC   LN G+++ +  + +FC+  I     +    G+         QS +        S  +S  S  K       P   +  L  + +    PR                + +++ +G        S+ KR+RTSFKHHQ+R M++YF++NHNPD KDLK LS+KTGL KRVLQVWFQNARAK+RR
Sbjct:  142 CAGCDMPIQDRFYLSAVERKWHASCLQCCICRQTLEGANSCFSRDGNIYCKTDYYRVFGSRRCSKCLASISSSELVMRARHLVFHIRCFSCAVCNTPLNKGDHYTIRDSAVFCRSHIELPLEAATTPGLPGMPMQCPYQSQYGTSPVAPLSPSDSTTSGGKLNPATYYPPHGVTGLPQQPRQKGRPRKRKPKDIEAMTASLDLNTEYLDLGFSRGLGSSSRAKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLSQKTGLPKRVLQVWFQNARAKWRR 420          
BLAST of LIM/homeobox protein vs. TrEMBL
Match: Q49QW5 (Apterous OS=Euprymna scolopes OX=6613 PE=2 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 2.092e-59
Identity = 104/263 (39.54%), Postives = 158/263 (60.08%), Query Frame = 1
Query:   88 KNNAQRLLCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQDEIRKSSISTIFSGIQSDFRLGLQNNQSLFESI--FSKSKP--RRPIGVLDDEVQLNIS------PRHQDFV----MMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRRS 834
            +++ +  +C+GC  +IT++YYL    + WH +CLKC  C+ +LD   SCY+R G +YC+ DY R++  ++CA+C   I+  ++VM+  N V+H+ CF C  C K L +G+ F L  ++++CQ    ++S    +  +  D   G       +  +    K +P  RR   +  DE   NI        R  D +         +QKR+RTSFKHHQ+R +++YF++NHNP  KDLK L++KTGL+KRVLQVWFQNARAKFRR+
Sbjct:   84 QDDHKPFICAGCGDLITERYYLNVANNAWHFNCLKCYECKSTLDTERSCYERMGNYYCRDDYQRLFSTQRCARCNMGIQSTDLVMRARNHVYHLTCFTCFTCNKALQAGDTFGLREHLVYCQVHY-ENSYHAEYIALSPDMNAG---QMPYYNGVGTLQKGRPRKRRSPNISSDEFAHNIGLGADSLDRAGDMIDRDTYQNAPRQKRMRTSFKHHQLRTLKSYFAVNHNPGAKDLKHLAQKTGLTKRVLQVWFQNARAKFRRN 342          
BLAST of LIM/homeobox protein vs. Ensembl Cavefish
Match: lhx2b (LIM homeobox 2b [Source:ZFIN;Acc:ZDB-GENE-051220-1])

HSP 1 Score: 202.986 bits (515), Expect = 3.146e-61
Identity = 102/270 (37.78%), Postives = 155/270 (57.41%), Query Frame = 1
Query:  109 LCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQ---DEIRKSSISTIFS--------GIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNIS---------PRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRRSGLSKSDTN 858
            LC+GC   I+D+YYL   +  WH  CLKC  C+ +L+   +C+ ++G+ YC+ DY+R +  ++CA+C   I   EMVM+  + V+H++CF C  C K L +G++F +  ++++C+   + + +      F         G      LGL     +      + + R+  G   D    N +         P  +D       K KR+RTSFKHHQ+R M++YF++NHNPD KDLK L++KTGL+KRVLQVWFQNARAKFRR+ L + +T 
Sbjct:   52 LCAGCGGRISDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDLVYHLNCFTCTTCSKMLTTGDHFGMKDSLVYCRLHFETLVQGDYGAPFGHADVAHGKGAVPAGPLGLAYYNGVGTVQKGRPRKRKSPGPGADLAAYNAALSCNENDGDPMDRDSQYSSGQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENTG 321          
BLAST of LIM/homeobox protein vs. Ensembl Cavefish
Match: lhx9 (LIM homeobox 9 [Source:NCBI gene;Acc:103038813])

HSP 1 Score: 197.208 bits (500), Expect = 1.346e-59
Identity = 108/287 (37.63%), Postives = 158/287 (55.05%), Query Frame = 1
Query:   79 MDNKNNAQRLLCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFC--------QDEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRR---PIGVLD--------DEVQLNISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRR-------SGLSKSDTNS 861
            M + +  +  LC+GC   I+D+YYL   +  WH  CLKC  C+ +L+   +C+ ++G+ YC+ DY+R +  ++CA+C   I   EMVM+  +SV+H+ CF C  C K L +G++F +  N+++C        Q E          +       L   N     +    K +PR+   P   +D        +E   +   R Q        K KR+RTSFKHHQ+R M++YF++NHNPD KDLK L++KTGL+KRVLQVWFQNARAKFRR        G+ K+D  S
Sbjct:   19 MPSVSPEKPALCAGCGSKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDSVYHLSCFTCTSCNKTLTTGDHFGMRENLVYCRAHFESLVQGEYHAPLNYAELAAKGGGLALPYFNGAGAVQ----KGRPRKRKSPAMGIDINTYNSGCNENDADHLDRDQQPYPPS-QKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNVLRQENGGVDKADGTS 300          
BLAST of LIM/homeobox protein vs. Ensembl Cavefish
Match: lhx9 (LIM homeobox 9 [Source:NCBI gene;Acc:103038813])

HSP 1 Score: 167.933 bits (424), Expect = 1.124e-48
Identity = 86/253 (33.99%), Postives = 136/253 (53.75%), Query Frame = 1
Query:   79 MDNKNNAQRLLCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFC--------QDEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFV------MMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQ 795
            M + +  +  LC+GC   I+D+YYL   +  WH  CLKC  C+ +L+   +C+ ++G+ YC+ DY+R +  ++CA+C   I   EMVM+  +SV+H+ CF C  C K L +G++F +  N+++C        Q E          +       L   N     +    + +    +G+  +      +    D +           K KR+RTSFKHHQ+R M++YF++NHNPD KDLK L++KTGL+KRVLQ
Sbjct:   60 MPSVSPEKPALCAGCGSKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDSVYHLSCFTCTSCNKTLTTGDHFGMRENLVYCRAHFESLVQGEYHAPLNYAELAAKGGGLALPYFNGAGAVQKGRPRKRKSPAMGIDINTYNSGCNENDADHLDRDQQPYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQ 312          
BLAST of LIM/homeobox protein vs. Ensembl Cavefish
Match: ENSAMXT00000051669.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002054.1:401899:417880:1 gene:ENSAMXG00000041554.1 transcript:ENSAMXT00000051669.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 162.925 bits (411), Expect = 2.213e-46
Identity = 87/246 (35.37%), Postives = 122/246 (49.59%), Query Frame = 1
Query:   97 AQRLLCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQDEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRRS 834
            A   +C GC   ++D++ L      WHG+CL+C  C   L   +S Y R+G  YCQ DY  ++   +CA+C + I    +VM+  +  FH+HCF C  C   L  G  + + G  L+CQ   +    +               ++Q   E   S  +PR     L++  +   + R          + KR+RT F+  Q+R +  YFS  HNPD KD   LS  TGL KRVLQVWFQNARAK RRS
Sbjct:   48 AAPPVCGGCGERVSDRFVLLAAGQAWHGACLRCSSCHCELQSHSSLYCRDGNIYCQQDYCSLFGVGRCARCSQPIPSSALVMRSGDMTFHLHCFSCQECDVTLLPGNLYCVEGRSLYCQSHYQPDGTTLSLH----------SSSQGEAEEPVSSPEPR-----LEERARGGGACR----------RVKRMRTCFRREQLRALEAYFSQKHNPDGKDWVNLSNHTGLPKRVLQVWFQNARAKLRRS 268          
BLAST of LIM/homeobox protein vs. Ensembl Cavefish
Match: lmx1ba (LIM homeobox transcription factor 1, beta a [Source:NCBI gene;Acc:554361])

HSP 1 Score: 142.895 bits (359), Expect = 3.606e-39
Identity = 83/241 (34.44%), Postives = 129/241 (53.53%), Query Frame = 1
Query:  109 LCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQDEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRR 831
            +C+GC+  I D++ LR +E  WH  CL+C +C+Q L  T SCY R+   YC+HDY R++   KC+ C E I   E VM+ L SV+H+ CF C VC ++L  G+ F+L  + L C+ +  +     + + I  +    + +++S  E +    KP +  G  +     +   R          + KR RT     Q R  +  F ++  P  K  +TL+ +TGLS RV+QVWFQN RAK ++
Sbjct:   30 VCAGCQRPIADRFLLRVNESSWHEECLQCAVCQQPL--TMSCYCRDRKVYCKHDYQRLFAT-KCSGCLEKIAPTEFVMRALKSVYHLGCFCCCVCERQLCKGDEFVLKDSQLLCKKDYERE--KDLLNAISPE----MSDSKSEDEDV--DVKPEKGSGGQNKGSDDSKDSR----------RPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKK 249          
BLAST of LIM/homeobox protein vs. Ensembl Sea Lamprey
Match: lmo4b (LIM domain only 4b [Source:ZFIN;Acc:ZDB-GENE-030131-3570])

HSP 1 Score: 88.9669 bits (219), Expect = 1.930e-21
Identity = 49/138 (35.51%), Postives = 65/138 (47.10%), Query Frame = 1
Query:  112 CSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSL-DKTNSCYKRNGTFYCQHDYFRIY-QQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQ-DEIRKSSISTIFSGIQSDFRL 516
            C+GC   I D++ L + +  WH  CLKC  C+  L D   SCY R G   C+ DY R++     C  C + I   E+VMK   +V+H+ CF C  C  RL  G+ F      LFC+ D        T   G   D  L
Sbjct:   18 CAGCGGKIADRFLLYSMDCYWHSRCLKCSCCQAQLGDLGTSCYTRQGMILCRDDYIRMFGSSGACNACGQSIPASELVMKTQGNVYHLKCFACATCRTRLVPGDRFHYVNGSLFCEHDRPAGPGPLTAHRGTLGDGSL 155          
BLAST of LIM/homeobox protein vs. Ensembl Sea Lamprey
Match: lmo2 (LIM domain only 2 (rhombotin-like 1) [Source:NCBI gene;Acc:30332])

HSP 1 Score: 87.4261 bits (215), Expect = 6.348e-21
Identity = 45/125 (36.00%), Postives = 67/125 (53.60%), Query Frame = 1
Query:  106 LLCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNS-CYKRNGTFYCQHDYFRIY-QQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQDEIRKSS 474
            L+C GC   I+D+Y L+  E  WH  CL CD+C   L +     Y + G   C+ DY R++ Q   CA C + I   EM M+V + V+H+ CF C  C K    G+ +LL  + + C+ +I + S
Sbjct:   28 LMCGGCRQPISDRYLLKAIEQFWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGHCASCGKRIRAFEMTMRVRDKVYHLECFKCAACQKHFCVGDRYLLVNSDIICEQDIYEWS 152          
BLAST of LIM/homeobox protein vs. Ensembl Sea Lamprey
Match: lmo2 (LIM domain only 2 (rhombotin-like 1) [Source:NCBI gene;Acc:30332])

HSP 1 Score: 86.2705 bits (212), Expect = 1.555e-20
Identity = 48/132 (36.36%), Postives = 70/132 (53.03%), Query Frame = 1
Query:  106 LLCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNS-CYKRNGTFYCQHDYFRIY-QQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGE-YFLLNGNILFCQDEIRKSSISTIFS 492
            L+C GC   I+D+Y L+  E  WH  CL CD+C   L +     Y + G   C+ DY R++ Q   CA C + I   EM M+V + V+H+ CF C  C K    G+ Y L+N +I+  QD    S I+ + +
Sbjct:   27 LMCGGCRQPISDRYLLKAIEQFWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGHCASCGKRIRAFEMTMRVRDKVYHLECFKCAACQKHFCVGDRYLLVNSDIICEQDIYEWSKINIMMT 158          
BLAST of LIM/homeobox protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002189.1 (pep scaffold:Pmarinus_7.0:GL483992:1961:4872:1 gene:ENSPMAG00000001979.1 transcript:ENSPMAT00000002189.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.9442 bits (180), Expect = 3.411e-15
Identity = 50/180 (27.78%), Postives = 79/180 (43.89%), Query Frame = 1
Query:  295 KCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLL-NGNILFCQDEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRR 831
            KCAKC       + VM+  + ++H+ CF C  C ++L  G+ F L +G  L C+ +          +G                      +   RP   +     L++S      +  G  K  R+RT     Q++ +RT ++ N  PD    + L E TGLS RV++VWFQN R K ++
Sbjct:    6 KCAKCNASFSKTDFVMRARSHIYHMECFRCETCSRQLLPGDEFALRDGGGLLCRADQHHGGGGGGGAGGAG-------GGAGGGGGGLLGTALTRPGSPVHSSRSLHLS----GGIPSGPEKATRVRTVLNEKQLQTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKK 174          
BLAST of LIM/homeobox protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006267.1 (pep scaffold:Pmarinus_7.0:GL478686:5064:37345:-1 gene:ENSPMAG00000005668.1 transcript:ENSPMAT00000006267.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 7.200e-10
Identity = 39/138 (28.26%), Postives = 61/138 (44.20%), Query Frame = 1
Query:  151 LRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQD-------EIRKSSISTIFSGIQSDFRLGLQNNQSLF 543
            LR +   +H SC  C +C   L +    + +NG + C  DY R+Y  R C  C + +E +  V+  L   +H  CF+C VC +   SG     NG    C +        +R  S  +  +G   D    ++N Q+L 
Sbjct:   37 LRVENRHFHVSCFTCKVCGCDLAQCGF-FVKNGEYVCTLDYQRLYGTR-CQACGDFVEGE--VVTALGRTYHPRCFVCSVCRQPFPSGARVTFNGRECLCHECTQPISPVLRDPSNPSNCAGCGRD----IKNGQALL 166          
BLAST of LIM/homeobox protein vs. Ensembl Nematostella
Match: EDO43354 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYP5])

HSP 1 Score: 208.764 bits (530), Expect = 9.549e-66
Identity = 104/259 (40.15%), Postives = 158/259 (61.00%), Query Frame = 1
Query:   91 NNAQRLLCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQDEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPR-RPIGVLDDEVQ---LNISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRRSGLSKSDT 855
             + Q+ +C+GC   I +++YL   +  WH  CLKC  CE  LD   +C+ ++G   C+ DY+R +  +KC+ C + I  KE+VM+  + V+H++CF C  C + L +GEYF + G  ++C+++  +         ++ + R     N +   S+ SK +PR R I    + +     ++S R  +       + KR+RTSFKHHQ+R M+TYF++NHNPD KDLK LS+KTGL+KRVLQVWFQNARAKFRR+  + S T
Sbjct:    2 GDKQQAVCAGCGSRILERFYLMAVDQEWHADCLKCSDCELRLDNELTCFSKDGVILCREDYYRRFSVKKCSSCSQAISSKELVMRARDQVYHVNCFACDRCKRMLATGEYFGMRGIRIYCKEDYEEL--------LREESR-----NPTKINSL-SKGRPRKRRIATAIESITNLGYDLSDRPGELTTGADGRPKRVRTSFKHHQLRAMKTYFAMNHNPDAKDLKQLSQKTGLTKRVLQVWFQNARAKFRRTVCNTSQT 246          
BLAST of LIM/homeobox protein vs. Ensembl Nematostella
Match: EDO34370 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPK5])

HSP 1 Score: 148.288 bits (373), Expect = 8.504e-42
Identity = 78/242 (32.23%), Postives = 125/242 (51.65%), Query Frame = 1
Query:  112 CSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQDEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRRSG 837
            C GCE  I D+Y ++     WH  CLKC +C   L +  +CY ++G  YC+ DY R +   KCA+C   I   + V +  N V+H+ CF C  C ++L++GE F L    + C+                              E++ +    R    V   +V  + SP   + +  G  K KR+RT+F   Q+++++  F+++ NPD +DL+ +++ TGLSKRV QVWFQN+RA+ ++ G
Sbjct:   28 CVGCEAKIVDRYLVKVSGRAWHTKCLKCCLCSDELGREATCYTKDGKIYCKADYARQFGT-KCARCGRSIHANDWVRRAKNCVYHLACFACDNCKRQLSTGEEFALKDGHVLCK--------------------------LHYLEALDTSPAERDYQEVFSPDVDGDDSP---NSLKSGRHKAKRVRTTFTEDQLQILQANFNIDSNPDGQDLERIAQLTGLSKRVTQVWFQNSRARQKKYG 239          
BLAST of LIM/homeobox protein vs. Ensembl Nematostella
Match: EDO46073 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR95])

HSP 1 Score: 138.272 bits (347), Expect = 6.693e-38
Identity = 85/250 (34.00%), Postives = 121/250 (48.40%), Query Frame = 1
Query:  109 LCSGCECVITDKYYLRTDEHV-WHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQD--EIRKSSISTIFS------GIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRR 831
            +C GC   I D+Y LR    + WH SCLKC  C   LD+  +C+ R G  YC+ DY R++   KCAKC  +    + VM+  N ++HI CF C  C ++L  G+ F L  + LFC+   EI + + +T  +      G +S    G  N Q+  +S  SK K  RP                            R+RT     Q+  +RT ++ N  PD    + L E TGLS RV++VWFQN R K ++
Sbjct:   16 MCVGCGSQIHDQYILRVAPDLEWHASCLKCADCHMYLDEKCTCFVREGKTYCKRDYVRLFGT-KCAKCSLNFSKNDFVMRARNKIYHIDCFRCVACSRQLVPGDEFALREDGLFCKADHEIVEKATATAQATHVRNNGQRSSQSGGQTNGQTTPDSTPSKRKTDRPT---------------------------RVRTVLNEKQLHTLRTCYNANPRPDAMMKEQLVEMTGLSPRVIRVWFQNKRCKDKK 237          
BLAST of LIM/homeobox protein vs. Ensembl Nematostella
Match: LHX1 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9E9])

HSP 1 Score: 122.479 bits (306), Expect = 3.635e-33
Identity = 69/242 (28.51%), Postives = 125/242 (51.65%), Query Frame = 1
Query:  112 CSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGE--YFLLNGNILFCQDEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRR 831
            C+GC+  I DK+ L+  + VWH  C++C  C+  L  T  C+ R G  +C+ D++R Y   KC+ C + I   +MV +  + VFH+ CF+C  C +++ +G+  Y++ +G+ + C+D+   S  + +   I                      +P+     LD+++   ++           SK++  RT+ K  Q+  +++ F+    P     + L+++TGL+ RV+QVWFQN R+K RR
Sbjct:    5 CAGCQLPIADKFLLKVLDGVWHAQCVQCSDCKCPL--TERCFSREGKLFCKTDFYRRYGT-KCSGCDQGISPNDMVRRAKHLVFHVDCFVCSYCKRQITTGDELYYIGDGSFI-CRDDYYHSHPTNLDDAI---------------------DEPKDLSYGLDEDLDAALA-----------SKRRGPRTTIKAKQLEALKSTFAATPKPSRNIREKLAQETGLNMRVIQVWFQNRRSKERR 210          
BLAST of LIM/homeobox protein vs. Ensembl Nematostella
Match: EDO37316 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG43])

HSP 1 Score: 94.3597 bits (233), Expect = 2.602e-23
Identity = 48/123 (39.02%), Postives = 68/123 (55.28%), Query Frame = 1
Query:   97 AQRLLCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTN-SCYKRNGTFYCQHDYFRIY-QQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQDE 459
            A   +C+GC   I D++ L   +  WH +CLKC  CE  L +   SCY + G   C+ DY R+Y     CA C + I   E+VMKVL  V+H+HCF C  C  +L  G+ F +    LFC+++
Sbjct:   14 ASMRVCAGCGEKIIDRFLLLALDQYWHVNCLKCSCCEARLGEIGTSCYSKGGMILCKTDYVRLYGNSGACAVCAKLIPATELVMKVLGKVYHLHCFTCTTCHNQLVPGDRFHVVNGRLFCEND 136          
BLAST of LIM/homeobox protein vs. Ensembl Medaka
Match: lhx2b (LIM homeobox 2 [Source:NCBI gene;Acc:101154958])

HSP 1 Score: 200.29 bits (508), Expect = 5.372e-60
Identity = 103/270 (38.15%), Postives = 156/270 (57.78%), Query Frame = 1
Query:  109 LCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQ---DEIRKSSISTIFS--------GIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNIS---------PRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRRSGLSKSDTN 858
            LC+GC   I D+YYL   +  WH  CLKC  C+ +L+   +C+ ++G+ YC+ DY+R +  ++CA+C   I   EMVM+  + V+H++CF C  CGK L +G++F +  ++++C+   + + +    T F+        G+     LGL     L      + + R+  G   +    N +            +D       K KR+RTSFKHHQ+R M++YF++NHNPD KDLK L++KTGL+KRVLQVWFQNARAKFRR+ L +  T 
Sbjct:   73 LCAGCGRKIADRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDLVYHLNCFTCTTCGKMLTTGDHFGMKDSLVYCRLHFETLIQGEYQTNFNHADIVPHKGLGPANTLGLSYFNGLGTVQKGRPRKRKSPGPGAELAAYNAALSCNENDGESMDRDSQYSSSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQETTG 342          
BLAST of LIM/homeobox protein vs. Ensembl Medaka
Match: lhx9 (LIM homeobox 9 [Source:NCBI gene;Acc:100049461])

HSP 1 Score: 197.593 bits (501), Expect = 2.847e-59
Identity = 105/282 (37.23%), Postives = 159/282 (56.38%), Query Frame = 1
Query:  109 LCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQ-------------DEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRR---PIGVLD--------DEVQLNISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRR-------SGLSKSDTNS 861
            LC+GC   I+D+YYL   +  WH  CLKC  C+ +L+   +C+ ++G+ YC+ DY+R +  ++CA+C   I   EMVM+  +SV+H+ CF C  C K L +G++F +  ++++C+              ++  + ++    G+   +  G    Q        K +PR+   P   +D        +E   +   R Q        K KR+RTSFKHHQ+R M++YF++NHNPD KDLK L++KTGL+KRVLQVWFQNARAKFRR        G+ K+D  S
Sbjct:   72 LCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDSVYHLSCFTCTTCNKTLTTGDHFGMKDSLVYCRLHFETLVQGPDYHPQLNFAELAAKGGGLALPYFNGTGTTQ--------KGRPRKRKSPAMGIDIPSYNTGCNENDTDHLDRDQQ-AYPPTQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNVLRQENGGVDKADGTS 344          
BLAST of LIM/homeobox protein vs. Ensembl Medaka
Match: ENSORLT00000039212.1 (LIM/homeobox protein Lhx2-like [Source:NCBI gene;Acc:101155206])

HSP 1 Score: 160.614 bits (405), Expect = 1.142e-45
Identity = 95/249 (38.15%), Postives = 132/249 (53.01%), Query Frame = 1
Query:  106 LLCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQDEIRKSSISTIFSGIQSDFRLGL-----QNNQS-LFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRRS 834
            ++C+GC  ++ D+++L     VWHG+CL+C +C   L    S Y R+G  YCQ DY RI+   +CA+C + I    +VM+  +  FH  CF C  C  +L  G  + + G  L+C+   ++   S   S      RL L     QN+ S   E   S  +PR     LDD+     S            + KR+RT F+  Q+R + +YF+  HNPD KD   L+ KTGL KRVLQVWFQNARAK RRS
Sbjct:    1 MVCAGCGELVCDRFFLLAAGRVWHGACLRCSLCHCELQTHASLYWRDGNIYCQQDYCRIFGGGRCARCFQPIPPSALVMRSGDLTFHPQCFSCQECDVKLLPGNLYCMQGANLYCESHYQEDGGSV--SHHDPSMRLSLSEEPGQNHVSGEGEDSVSSPEPR-----LDDKAGGGRS----------RRRSKRIRTCFRREQLRALESYFAQKHNPDGKDWTCLAHKTGLPKRVLQVWFQNARAKLRRS 232          
BLAST of LIM/homeobox protein vs. Ensembl Medaka
Match: isl1 (ISL LIM homeobox 1 [Source:NCBI gene;Acc:101165983])

HSP 1 Score: 142.895 bits (359), Expect = 6.601e-39
Identity = 86/257 (33.46%), Postives = 126/257 (49.03%), Query Frame = 1
Query:   79 MDNKNNAQRL--LCSGCECVITDKYYLRTDEHV-WHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQ---DEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRR 831
            M +    +RL  LC GC   I D+Y LR    + WH +CLKC  C Q LD++ +C+ R+G  YC+ DY R+Y   KCAKC       + VM+  + V+HI CF C  C ++L  G+ F L  + LFC+   D + ++S+ T                        S   P RP+ +  + +     P  +  V     K  R+RT     Q+  +RT ++ N  PD    + L E TGLS RV++VWFQN R K ++
Sbjct:    4 MGDPPKKKRLVSLCVGCGNQIHDQYILRVSPDLEWHAACLKCAECSQYLDESCTCFVRDGKTYCKRDYIRLYGI-KCAKCNIGFSKNDFVMRARSKVYHIECFRCVACSRQLIPGDEFALREDGLFCRADHDVVERASLGT--------------------GDPLSPLHPARPLQMAAEPISAR-QPALRPHVHKQPEKTTRVRTVLNEKQLHTLRTCYNANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKK 238          
BLAST of LIM/homeobox protein vs. Ensembl Medaka
Match: ENSORLT00000016493.2 (LIM/homeobox protein Lhx8 [Source:NCBI gene;Acc:101170874])

HSP 1 Score: 141.739 bits (356), Expect = 1.180e-38
Identity = 82/243 (33.74%), Postives = 125/243 (51.44%), Query Frame = 1
Query:  103 RLLCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQDEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRR 831
            + LC+ C   I D+Y L+ ++  WH  CL C +C  SL +  SCY ++   +C+ DYFR Y  R CA+C  +I   + V +   S FH+ CF C  C ++L++GE   L  N +FC+           +     + +   +N Q   E   S +K    +G                         KR RTSF   Q++VM+T F+ ++NPD + L+ L+EKTGLS+RV+QVWFQN RA+ ++
Sbjct:   45 KTLCTSCGQEIVDRYLLKVNDLCWHVRCLSCSVCNTSLGRHVSCYVKDSQVFCKLDYFRRYGTR-CARCGRNIHSTDWVRRAKGSTFHLACFSCASCKRQLSTGEECGLFENRVFCRPH---------YDVAMENLKRSKENEQPQPED-RSANKESSTVG----------------------RPAKRARTSFTVDQLQVMQTQFAKDNNPDAQTLQKLAEKTGLSRRVIQVWFQNCRARQKK 254          
BLAST of LIM/homeobox protein vs. Planmine SMEST
Match: SMESG000001774.1 (SMESG000001774.1)

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 293/293 (100.00%), Postives = 293/293 (100.00%), Query Frame = 1
Query:   79 MDNKNNAQRLLCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQDEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRRSGLSKSDTNSQTNEXXXXXXXXXXXXXXXQEVINKENESDER 957
            MDNKNNAQRLLCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQDEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRRSGLSKSDTNSQTNEDILDSTLSYSDDTSSQEVINKENESDER
Sbjct:    1 MDNKNNAQRLLCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQDEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRRSGLSKSDTNSQTNEDILDSTLSYSDDTSSQEVINKENESDER 293          
BLAST of LIM/homeobox protein vs. Planmine SMEST
Match: SMESG000010916.1 (SMESG000010916.1)

HSP 1 Score: 228.024 bits (580), Expect = 1.233e-70
Identity = 121/280 (43.21%), Postives = 173/280 (61.79%), Query Frame = 1
Query:   94 NAQRLLCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNGNILFCQDEIRKSSISTIFSGIQSDFRLGLQNNQS------LFESI----------------FSKSKPRRPIGVLDDEVQL-NISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRRSGLSKSDTNSQ 864
            N   + C+GC+  ITD+++L+  + +WH +CL+C IC   L    SC+ R+G  YC+ DY R++ ++ C +C   I + E+VM+V N VFH+ CF C  CG+ LN GEYF L G + FCQD++ K+ I+     I  + + GL N+Q+      LF  +                F    P+          +L N+    +DF +   S+QKR+RTSFKHHQ+R M++YF+LNHNPD KDLK+LSEKTGLSKRVLQVWFQNARAK+RR+ +S+++  SQ
Sbjct:   25 NQNSMNCAGCKSKITDRFFLKAADKMWHVNCLRCWICHVELHSEMSCFTRDGVVYCKEDYSRLFGRKCCIRCGVKITYDELVMRVKNLVFHVTCFCCVQCGRMLNPGEYFGLKGLLPFCQDDLIKNPINMSEDFIH-NLQNGLTNSQASVPHLFLFHPLSRLNNFYHSPLNDSHNFHSIIPKVRGKKKRKGSELDNLYETSEDFCIGNASRQKRMRTSFKHHQLRAMKSYFALNHNPDAKDLKSLSEKTGLSKRVLQVWFQNARAKYRRN-VSRNENTSQ 302          
BLAST of LIM/homeobox protein vs. Planmine SMEST
Match: SMESG000005304.1 (SMESG000005304.1)

HSP 1 Score: 115.931 bits (289), Expect = 1.725e-28
Identity = 85/291 (29.21%), Postives = 136/291 (46.74%), Query Frame = 1
Query:  112 CSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYK-RNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGEYFLLNG--NILFCQDEIRKSSI----STIFSGIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISK--QKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRR-SGLSKSDTNSQTNEXXXXXXXXXXXXXXXQEVINKENESDE 954
            C+GC  VI DKY    ++  WH SC  C ICE+ L++  SC+  ++   +C++ Y++     KC+ C   ++  E+ M  LN V+H+ CF C  C + L  G+ F+L+G  ++L C+ +    +     S   +     F     N  S+ E   S        G        N   +  ++     SK   KR RT+    Q R +  +F    NP+ K  + L+E+  L  +V+QVWFQN RAK R+   LS   +NSQ +     S +           +NKE++ D+
Sbjct:   34 CTGCNGVINDKYLFSLNDTFWHKSCALCSICEEVLEE--SCFMLKDNKLFCRNHYYKSSFATKCSGCNLPMQTHEVAMHALNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRADYESGAYLHCSSNTLNDCDQSFSHKDSNETSMKELQISYQYHEDGTGKHSSTDSSN--GKQYNYFSSYNSKVSSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRAKVRQIKKLSNQISNSQHHSSDDPSNVDNEPLDQCVSSVNKESDIDQ 320          
BLAST of LIM/homeobox protein vs. Planmine SMEST
Match: SMESG000071273.1 (SMESG000071273.1)

HSP 1 Score: 110.153 bits (274), Expect = 1.398e-26
Identity = 71/241 (29.46%), Postives = 103/241 (42.74%), Query Frame = 1
Query:  112 CSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSG-EYFLLNGNILFCQDEIRKSSISTIFSGIQSDFRLGLQNNQSLFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISKQKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRR 831
            C  C+  I D+  L+     WH  CL C  C   L   + CY ++   +C+ D+FR Y  R CA C E I   E++ K  N+++H+ CF C  C ++LN+G E+FLL+   L C                + DF +     Q L +                                      KR RT+    Q+  ++  +S +  P     + LS KTGL  RV+QVWFQN RAK +R
Sbjct:   46 CIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPL--IDKCYSKSDEIFCKEDFFRRYGTR-CAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMC----------------RPDFEIAKTKEQELDQG------------------------------------NKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKR 231          
BLAST of LIM/homeobox protein vs. Planmine SMEST
Match: SMESG000022856.1 (SMESG000022856.1)

HSP 1 Score: 108.227 bits (269), Expect = 2.212e-26
Identity = 82/273 (30.04%), Postives = 127/273 (46.52%), Query Frame = 1
Query:  109 LCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCFICGVCGKRLNSGE--YFLLNGNILFCQ-----------------DEIRKSSISTIFSGIQSDFRLGLQNNQS----LFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISK-----QKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRRSGLS 843
            +C  C   I DK+  R  +H WH  CL+C+ C   L  T+ C++ +  F C  DY R   ++            +++     S+FH +CF C  C ++L SG+  Y    G+++ CQ                 ++I K+ +  IFS I S      +NN+      F +I S  + R   G L D++   I P   +       K     ++  RT+ K  Q+  ++  FS+   P  +  + L+E TGLS RV+QVWFQN R+K RRS LS
Sbjct:    5 ICYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQL--TSKCFELDNEFLCPEDYSRKKFKKCSKCKGPIFPSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHELFGDDSNCEQINKTEL--IFSDIDSQ-----ENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQNRRSKERRSKLS 268          
The following BLAST results are available for this feature:
BLAST of LIM/homeobox protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LHX98.697e-6037.96LIM homeobox 9 [Source:HGNC Symbol;Acc:HGNC:14222][more]
LHX91.324e-5937.96LIM homeobox 9 [Source:HGNC Symbol;Acc:HGNC:14222][more]
LHX22.401e-5635.05LIM homeobox 2 [Source:HGNC Symbol;Acc:HGNC:6594][more]
LHX21.302e-5334.11LIM homeobox 2 [Source:HGNC Symbol;Acc:HGNC:6594][more]
LHX94.606e-4935.92LIM homeobox 9 [Source:HGNC Symbol;Acc:HGNC:14222][more]
back to top
BLAST of LIM/homeobox protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttx-35.149e-4937.30LIM/homeobox protein ttx-3 [Source:UniProtKB/Swis... [more]
ttx-36.897e-4937.30LIM/homeobox protein ttx-3 [Source:UniProtKB/Swis... [more]
lim-41.774e-3431.73LIM domain family [Source:UniProtKB/TrEMBL;Acc:A0... [more]
lim-42.205e-3431.85LIM domain family [Source:UniProtKB/TrEMBL;Acc:A0... [more]
lim-41.870e-3330.62LIM domain family [Source:UniProtKB/TrEMBL;Acc:A0... [more]
back to top
BLAST of LIM/homeobox protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ap4.730e-5937.14gene:FBgn0267978 transcript:FBtr0086058[more]
ap5.086e-5937.14gene:FBgn0267978 transcript:FBtr0300504[more]
Awh2.838e-3431.22gene:FBgn0013751 transcript:FBtr0073155[more]
Awh9.721e-3430.83gene:FBgn0013751 transcript:FBtr0330071[more]
Awh1.019e-3331.25gene:FBgn0013751 transcript:FBtr0330070[more]
back to top
BLAST of LIM/homeobox protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lhx2b3.859e-6238.52LIM homeobox 2b [Source:ZFIN;Acc:ZDB-GENE-051220-1... [more]
lhx2a7.982e-6036.88LIM homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-091118-1... [more]
lhx98.479e-6036.77LIM homeobox 9 [Source:NCBI gene;Acc:550405][more]
lhx2a5.410e-5836.74LIM homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-091118-1... [more]
lhx96.260e-4934.73LIM homeobox 9 [Source:NCBI gene;Acc:550405][more]
back to top
BLAST of LIM/homeobox protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zfp36l21.127e-5938.32ZFP36 ring finger protein-like 2 [Source:Xenbase;A... [more]
zfp36l21.218e-5938.32ZFP36 ring finger protein-like 2 [Source:Xenbase;A... [more]
LHX22.803e-5938.71LIM homeobox 2 [Source:NCBI gene;Acc:100486746][more]
LHX23.200e-5938.71LIM homeobox 2 [Source:NCBI gene;Acc:100486746][more]
zfp36l21.174e-4935.52ZFP36 ring finger protein-like 2 [Source:Xenbase;A... [more]
back to top
BLAST of LIM/homeobox protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lhx97.791e-6037.96LIM homeobox protein 9 [Source:MGI Symbol;Acc:MGI:... [more]
Lhx91.277e-5937.96LIM homeobox protein 9 [Source:MGI Symbol;Acc:MGI:... [more]
Lhx24.413e-5835.40LIM homeobox protein 2 [Source:MGI Symbol;Acc:MGI:... [more]
Lhx21.105e-5735.40LIM homeobox protein 2 [Source:MGI Symbol;Acc:MGI:... [more]
Lhx93.299e-4935.92LIM homeobox protein 9 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of LIM/homeobox protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q80W90|LHX9_RAT5.113e-5937.96LIM/homeobox protein Lhx9 OS=Rattus norvegicus OX=... [more]
sp|Q90881|LHX9_CHICK5.657e-5937.32LIM/homeobox protein Lhx9 OS=Gallus gallus OX=9031... [more]
sp|Q9NQ69|LHX9_HUMAN6.358e-5937.96LIM/homeobox protein Lhx9 OS=Homo sapiens OX=9606 ... [more]
sp|Q1LWV4|LHX9_DANRE6.401e-5936.77LIM/homeobox protein Lhx9 OS=Danio rerio OX=7955 G... [more]
sp|A0JNI8|LHX9_BOVIN8.034e-5937.96LIM/homeobox protein Lhx9 OS=Bos taurus OX=9913 GN... [more]
back to top
BLAST of LIM/homeobox protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7U0501.049e-6340.81Uncharacterized protein (Fragment) OS=Capitella te... [more]
A7RYP56.905e-6240.15Predicted protein (Fragment) OS=Nematostella vecte... [more]
A0A1S4GZT49.941e-6139.07LIM homeobox protein 2/9 OS=Anopheles gambiae OX=7... [more]
A0A499FSX81.102e-6039.07Uncharacterized protein OS=Anopheles arabiensis OX... [more]
Q49QW52.092e-5939.54Apterous OS=Euprymna scolopes OX=6613 PE=2 SV=1[more]
back to top
BLAST of LIM/homeobox protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lhx2b3.146e-6137.78LIM homeobox 2b [Source:ZFIN;Acc:ZDB-GENE-051220-1... [more]
lhx91.346e-5937.63LIM homeobox 9 [Source:NCBI gene;Acc:103038813][more]
lhx91.124e-4833.99LIM homeobox 9 [Source:NCBI gene;Acc:103038813][more]
ENSAMXT00000051669.12.213e-4635.37pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
lmx1ba3.606e-3934.44LIM homeobox transcription factor 1, beta a [Sourc... [more]
back to top
BLAST of LIM/homeobox protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmo4b1.930e-2135.51LIM domain only 4b [Source:ZFIN;Acc:ZDB-GENE-03013... [more]
lmo26.348e-2136.00LIM domain only 2 (rhombotin-like 1) [Source:NCBI ... [more]
lmo21.555e-2036.36LIM domain only 2 (rhombotin-like 1) [Source:NCBI ... [more]
ENSPMAT00000002189.13.411e-1527.78pep scaffold:Pmarinus_7.0:GL483992:1961:4872:1 gen... [more]
ENSPMAT00000006267.17.200e-1028.26pep scaffold:Pmarinus_7.0:GL478686:5064:37345:-1 g... [more]
back to top
BLAST of LIM/homeobox protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LIM/homeobox protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO433549.549e-6640.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343708.504e-4232.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460736.693e-3834.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
LHX13.635e-3328.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373162.602e-2339.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of LIM/homeobox protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lhx2b5.372e-6038.15LIM homeobox 2 [Source:NCBI gene;Acc:101154958][more]
lhx92.847e-5937.23LIM homeobox 9 [Source:NCBI gene;Acc:100049461][more]
ENSORLT00000039212.11.142e-4538.15LIM/homeobox protein Lhx2-like [Source:NCBI gene;A... [more]
isl16.601e-3933.46ISL LIM homeobox 1 [Source:NCBI gene;Acc:101165983... [more]
ENSORLT00000016493.21.180e-3833.74LIM/homeobox protein Lhx8 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of LIM/homeobox protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000001774.10.000e+0100.00SMESG000001774.1[more]
SMESG000010916.11.233e-7043.21SMESG000010916.1[more]
SMESG000005304.11.725e-2829.21SMESG000005304.1[more]
SMESG000071273.11.398e-2629.46SMESG000071273.1[more]
SMESG000022856.12.212e-2630.04SMESG000022856.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023015 ID=SMED30023015|Name=LIM/homeobox protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1133bp
CCAGTCACAATCAAGATCGCTCAATGTGCAATTCGAATTGAATAAATTTA
TATTATTCGATTAATTGAGTATTTGATAATGGACAACAAAAATAATGCTC
AAAGGCTTTTATGCAGTGGCTGCGAATGCGTAATTACGGACAAATATTAT
CTACGGACTGATGAGCATGTTTGGCACGGATCTTGCCTCAAGTGTGACAT
TTGCGAACAATCGCTTGACAAAACAAATTCATGCTACAAACGCAACGGAA
CTTTCTACTGCCAGCATGACTACTTCCGAATTTATCAACAGCGAAAATGT
GCAAAGTGTCAGGAACACATTGAACACAAGGAAATGGTGATGAAAGTTCT
TAATTCAGTGTTCCACATTCATTGTTTTATCTGCGGCGTGTGCGGCAAGA
GACTTAATTCAGGTGAATATTTCCTCCTCAATGGCAATATTCTATTTTGT
CAAGATGAGATCAGGAAGAGCAGCATTTCCACTATTTTTTCTGGTATTCA
ATCTGATTTCAGACTTGGTTTGCAGAACAATCAGAGCCTTTTCGAATCAA
TTTTCAGTAAATCTAAACCACGAAGGCCAATCGGAGTTCTAGATGATGAG
GTTCAGCTAAATATCAGCCCTAGGCATCAGGATTTTGTAATGATGGGCAT
TAGCAAACAGAAAAGGCTCAGAACGTCCTTCAAGCATCATCAAGTGAGAG
TAATGCGCACCTATTTCTCACTGAATCACAACCCCGACACGAAAGATCTG
AAGACATTATCAGAAAAAACAGGTCTTTCAAAAAGAGTTCTGCAAGTCTG
GTTCCAAAACGCGCGAGCGAAATTTCGTCGTAGTGGTCTCAGTAAATCGG
ATACGAACTCCCAGACGAACGAGGACATACTCGACTCAACACTATCATAC
AGCGACGATACGTCGTCACAAGAGGTCATCAACAAGGAAAATGAATCTGA
TGAAAGATGAGTTTAAAGATGAGAAATTGACTGGAACATAGAGAGAAAGT
TTCACTTATTTGTGACATTTATTTGTGGTTATTTATTGATTGATCCGAAT
GATTCTCGGTTTTACAGAGACTATTTTGATTAAATTGATTATGCTTATCT
ATACCAAATGTTTACTCACAGAACGGTGCTAGC
back to top

protein sequence of SMED30023015-orf-1

>SMED30023015-orf-1 ID=SMED30023015-orf-1|Name=SMED30023015-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=294bp
MDNKNNAQRLLCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTN
SCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNSVFHIHCF
ICGVCGKRLNSGEYFLLNGNILFCQDEIRKSSISTIFSGIQSDFRLGLQN
NQSLFESIFSKSKPRRPIGVLDDEVQLNISPRHQDFVMMGISKQKRLRTS
FKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFR
RSGLSKSDTNSQTNEDILDSTLSYSDDTSSQEVINKENESDER*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000421tail
PLANA:0002075pigment cell
Vocabulary: INTERPRO
TermDefinition
IPR001356Homeobox_dom
IPR001781Znf_LIM
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0008270zinc ion binding
GO:0043565sequence-specific DNA binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0007411axon guidance
GO:0007420brain development
GO:0007634optokinetic behavior
GO:0009416response to light stimulus
GO:0010468regulation of gene expression
GO:0021537telencephalon development
GO:0021554optic nerve development
GO:0021794thalamus development
GO:0030900forebrain development
GO:0031290retinal ganglion cell axon guidance
GO:0043010camera-type eye development
GO:0071632optomotor response
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001781Zinc finger, LIM-typeSMARTSM00132lim_4coord: 11..64
e-value: 6.3E-12
score: 55.6
coord: 73..127
e-value: 5.8E-13
score: 59.1
IPR001781Zinc finger, LIM-typePFAMPF00412LIMcoord: 12..67
e-value: 2.7E-12
score: 46.7
coord: 74..127
e-value: 2.4E-14
score: 53.3
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 12..46
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 74..109
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 10..71
score: 13.127
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 72..134
score: 12.355
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 194..256
e-value: 1.3E-19
score: 81.1
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 195..251
e-value: 9.0E-17
score: 60.7
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 192..252
score: 16.601
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 195..252
e-value: 1.68312E-16
score: 70.35
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 190..255
e-value: 5.4E-25
score: 89.0
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 1..67
e-value: 5.2E-13
score: 50.7
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 68..153
e-value: 2.4E-17
score: 65.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 252..293
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 254..281
NoneNo IPR availablePANTHERPTHR24208:SF168PROTEIN APTEROUScoord: 3..282
NoneNo IPR availablePANTHERPTHR24208FAMILY NOT NAMEDcoord: 3..282
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 7..37
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 38..105
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 227..250
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 185..251