HSP27

Overview
NameHSP27
Smed IDSMED30023008
Length (bp)986
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of HSP27 (SMED30023008) t-SNE clustered cells

Violin plots show distribution of expression levels for HSP27 (SMED30023008) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of HSP27 (SMED30023008) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for HSP27 (SMED30023008) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023008

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30023008SMESG000068156.1 SMESG000076470.1 SMESG000053533.1 SMESG000026676.1 SMESG000015751.1 Contig256GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30023008SMESG000030472.1 Contig256GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30023008SMESG000030472.1 dd_Smed_v4_2189_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30023008SMESG000030472.1 dd_Smed_v4_2189_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30023008SMESG000030472.1 dd_Smed_v4_2189_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023008SMESG000030472.1 dd_Smed_v4_2189_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30023008SMESG000030472.1 dd_Smed_v4_2189_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of HSP27 vs. UniProt/SwissProt
Match: sp|P12812|P40_SCHMA (Major egg antigen OS=Schistosoma mansoni OX=6183 PE=2 SV=1)

HSP 1 Score: 50.447 bits (119), Expect = 8.791e-6
Identity = 49/225 (21.78%), Postives = 99/225 (44.00%), Query Frame = 3
Query:  246 YERNEQGDVEYTYEIDVSDFSAEEIKIKQHDHTLTIDANXXXXXXXXXXXXXXXXXXXXXYHKTILLPQNADLTKKLETIYNDGILIIKIPVI--PNPYSSIPGSAHVRSYPSQSPRDKII-VPEALIRNGKHVYSET------------LKMDPDFTKDDIKINVNGQIVVVNAT--QKRVDPHGCVST-RNYNSEHKFPTNVDLEHIQADWCGGELLISAPYK 866
            YE  E G V +    D   F+ ++I +   ++ +T+ A    ++   + S          + + + LP++ D ++    + +DG+L+++ PV    N   ++  S  V   P    + K +   +AL+  G H  S              + +DP +  +D+ +NV+   VVV+    +++ D HG  S+   ++  +  P  VD   + A   G  L++ AP +
Sbjct:  131 YEVGEDGKVHFKVRFDAQGFAPQDINVTSSENRVTVHAKKETTTDGRKCSRE--------FCRMVQLPKSIDDSQLKCRMTDDGVLMLEAPVKVDQNQSLTLNESGQVAVRPKSDNQIKAVPASQALVAKGVHGLSYVDDGSGGKRLHVEVAVDPVYKPEDLFVNVDSNRVVVSGRHHKQKSDQHGRSSSFAEFSQSYAIPETVDPLSVSAQVVGNTLVLEAPLE 347          
BLAST of HSP27 vs. TrEMBL
Match: A0A2U8U4E6 (HSP27 OS=Dugesia japonica OX=6161 GN=hsp27 PE=2 SV=1)

HSP 1 Score: 343.969 bits (881), Expect = 7.998e-116
Identity = 185/240 (77.08%), Postives = 211/240 (87.92%), Query Frame = 3
Query:  147 MDKTKPPPLSLKIPSETEFIRCSTPSQRLSSPRYERNEQGDVEYTYEIDVSDFSAEEIKIKQHDHTLTIDANXXXXXXXXXXXXXXXXXXXXXYHKTILLPQNADLTKKLETIYNDGILIIKIPVIPNPYSSIPGSAHVRSYPSQSPRDKIIVPEALIRNGKHVYSETLKMDPDFTKDDIKINVNGQIVVVNATQKRVDPHGCVSTRNYNSEHKFPTNVDLEHIQADWCGGELLISAPYK 866
            M+ T   PLS+KIP+E E++RCSTP+QRL SPR ERN+QGD EYT EIDV DF AEEIK+KQ+DHTL IDA+CS++SKTCEESSSCSRSEKKEYHKTILLP   DL+KK+ETIY DG LIIKIP +  P+SSIPGSA +RSY SQSPR+K  VPEAL+RNGK+VYSE LK+DPDFTKDDIKIN NGQ+++VNATQKR+DP+GCVSTRNYNSEHKFP NVDLE IQADWC GELLISAPYK
Sbjct:    1 MNNTHRSPLSIKIPNEAEYVRCSTPNQRLGSPRLERNDQGDEEYTVEIDVRDFRAEEIKVKQNDHTLIIDASCSKTSKTCEESSSCSRSEKKEYHKTILLPPYVDLSKKMETIYTDGKLIIKIPALHQPHSSIPGSAQIRSYLSQSPREKHSVPEALMRNGKNVYSEKLKLDPDFTKDDIKINTNGQLIIVNATQKRIDPNGCVSTRNYNSEHKFPANVDLEQIQADWCDGELLISAPYK 240          
BLAST of HSP27 vs. TrEMBL
Match: A0A4S2LJ37 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006815 PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.154e-9
Identity = 59/240 (24.58%), Postives = 102/240 (42.50%), Query Frame = 3
Query:  207 RCSTPSQRLSSPRYERNEQGDVEYTYEIDVSDFSAEEIKIKQHDHTLTIDANXXXXXXXXXXXXXXXXXXXXXYHKTILLPQNADLTKKLETIYNDGILIIKIPVIPNPYSSI-----------PGSAHVRSYPSQSPRDKIIVPEALI--------RNGKHVYSETLKMDPDFTKDDIKINVNGQIVVVNATQKRVDPHGCVST---RNYNSEHKFPTNVDLEHIQADWCGGELLISAP 860
            R S+ S       Y+  E G V +    D+  +  ++IK+   D+ +T+ A     +     S          Y +TI LP++ D  +    +  DG+L+++ PV    Y+SI           P S        +S     I P  ++        ++G       + +DPDFT DD+ + ++   VVV+  +K VD  G  S+   + ++  +  P  VD   + A   GG+LL+ AP
Sbjct:  176 RTSSGSLDFLKDAYQLGEDGRVHFKVRFDLQGYGPDDIKVSTSDNGVTVHAKKVVQTDRALSSRE--------YSRTIYLPKSVDKNQLECHLTEDGVLMLEAPVKTADYNSITFDRDRQLSIKPHSETEVGQKRKSEDALAIQPTGVLGPTVLKDDKSGGQKLHVEIPIDPDFTADDLCVRMDANRVVVSGQKKTVDKTGNSSSTFIKEFSRSYDVPQTVDTFSVNAQLQGGKLLVEAP 407          
BLAST of HSP27 vs. TrEMBL
Match: A0A419PWF5 (Major egg antigen OS=Clonorchis sinensis OX=79923 GN=CSKR_13512s PE=3 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.492e-9
Identity = 60/241 (24.90%), Postives = 104/241 (43.15%), Query Frame = 3
Query:  207 RCSTPSQRLSSPRYERNEQGDVEYTYEIDVSDFSAEEIKIKQHDHTLTIDANXXXXXXXXXXXXXXXXXXXXXYHKTILLPQNADLTKKLET-IYNDGILIIKIPVIPNPYSSI-----------PGSAHVRSYPSQSPRDKIIVPEALI--------RNGKHVYSETLKMDPDFTKDDIKINVNGQIVVVNATQKRVDPHGCVST---RNYNSEHKFPTNVDLEHIQADWCGGELLISAP 860
            R S+ S       Y+  E G V +    D+  +  ++IK+   D+ +T+ A     +     S          Y +TI LP++ D  K+LE  +  DG+L+++ PV    Y SI           P S        +S     I P  ++        ++G       + +DP+F+ DD+ + ++   VVV+  +K VD  G  S+   + ++  +  P  VD   + A   GG+LL+ AP
Sbjct:   57 RISSDSLDFLKDAYQLGEDGRVHFKVRFDLQGYGPDDIKVSTSDNGVTVHAKKVVQTDRALSSRE--------YSRTIYLPKSVD-KKQLECHLTEDGVLMLEAPVKAADYKSITFDRDRQVSIKPHSETEVGQKRKSEDALAIQPTGILGPTVLKDDKSGGEKLHVEIPVDPEFSADDLCVRMDANRVVVSGKKKTVDKTGNSSSTFVKEFSRSYDVPQTVDTFSVNAQLQGGKLLVEAP 288          
BLAST of HSP27 vs. TrEMBL
Match: A0A074Z3T6 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_11239 PE=3 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 8.436e-9
Identity = 57/240 (23.75%), Postives = 101/240 (42.08%), Query Frame = 3
Query:  207 RCSTPSQRLSSPRYERNEQGDVEYTYEIDVSDFSAEEIKIKQHDHTLTIDANXXXXXXXXXXXXXXXXXXXXXYHKTILLPQNADLTKKLETIYNDGILIIKIPVIPNPYSSI-----------PGSAHVRSYPSQSPRDKIIVPEALI--------RNGKHVYSETLKMDPDFTKDDIKINVNGQIVVVNATQKRVDPHGCVST---RNYNSEHKFPTNVDLEHIQADWCGGELLISAP 860
            R S+ S       Y+  E G V +    D+  +  ++IK+   D+ +T+ A     +     S          Y +TI +P++ D  +    +  DG+L+++ PV    Y SI           P S        +S     I P  ++        ++G       + +DP+FT DD+ + ++   VVV+  +K VD  G  S+   + ++  +  P  VD   + A   GG+LL+ AP
Sbjct:  141 RTSSSSLDFLKDAYQLGEDGRVHFKVRFDLQGYGPDDIKVSTSDNGVTVHAKKVVQTDRALSSRE--------YSRTIYIPKSVDKNQLECHLTEDGVLMLEAPVKTADYKSITFDRDRQLSIKPHSETEVGQKRKSEDALAIQPTGVLGPTVLKDDKSGGEKLHVEIPVDPEFTADDLCVRMDANRVVVSGKKKTVDKTGNSSSTFIKEFSRSYDVPQTVDTFSVNAQLQGGKLLVEAP 372          
BLAST of HSP27 vs. TrEMBL
Match: A0A3R7CF96 (Major egg antigen OS=Clonorchis sinensis OX=79923 GN=CSKR_13516s PE=3 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 3.485e-8
Identity = 49/228 (21.49%), Postives = 102/228 (44.74%), Query Frame = 3
Query:  246 YERNEQGDVEYTYEIDVSDFSAEEIKIKQHDHTLTIDANXXXXXXXXXXXXXXXXXXXXXYHKTILLPQNADLTKKLETIYNDGILIIKIPVIPNPYSSI-----------PGSAHVRSYPSQSPRDKIIVPEALI---------RNGKHVYSETLKMDPDFTKDDIKINVNGQIVVVNATQKRVDPHG---CVSTRNYNSEHKFPTNVDLEHIQADWCGGELLISAP 860
            Y+ +E G V +    D+  +  +++++   D+ +++ A     +     +          Y +T+ LP++ D       +  DG+L ++ PV    Y SI           P +      P +S     I P  ++           G++++ E + +DP+F+ DD+ + V+G+ +V++  ++ VD  G    V  + ++  +  P  VD   + A+  GG+LL+ AP
Sbjct:   70 YQLDEDGRVHFKLRFDLQGYGPDDVQVSTSDNCVSVHAKKVVQTDQGSSTRE--------YSRTLYLPESIDRDHLECHLTQDGVLTVEAPVKTTDYKSITFDRNRQLGIKPRAESEVGQPEKSGNALAIQPTGVLGPTVVKDEKSGGENLHVE-IPVDPEFSADDLCVRVDGKRIVLSGRKEVVDETGNSKSVLVKEFSRSYDVPETVDAFSVNAELRGGKLLVEAP 288          
BLAST of HSP27 vs. Planmine SMEST
Match: SMESG000030472.1 (SMESG000030472.1)

HSP 1 Score: 443.351 bits (1139), Expect = 1.193e-158
Identity = 239/240 (99.58%), Postives = 239/240 (99.58%), Query Frame = 3
Query:  147 MDKTKPPPLSLKIPSETEFIRCSTPSQRLSSPRYERNEQGDVEYTYEIDVSDFSAEEIKIKQHDHTLTIDANXXXXXXXXXXXXXXXXXXXXXYHKTILLPQNADLTKKLETIYNDGILIIKIPVIPNPYSSIPGSAHVRSYPSQSPRDKIIVPEALIRNGKHVYSETLKMDPDFTKDDIKINVNGQIVVVNATQKRVDPHGCVSTRNYNSEHKFPTNVDLEHIQADWCGGELLISAPYK 866
            MDKTKPPPLSLKIPSETEFIRCSTPSQRLSSPRYERNEQGDVEYTYEIDVSDFSAEEIKIKQHDHTLTIDANCSRSSKTCEESSSCSRSEKKEYHKTILLPQNADLTKKLETIYNDGILIIKIPVIPNPYSSIPGSAHVRSYPSQSPRDKIIVPEALIRNGKHVYSETLKMDPDFTKDDIKINVNGQ VVVNATQKRVDPHGCVSTRNYNSEHKFPTNVDLEHIQADWCGGELLISAPYK
Sbjct:    1 MDKTKPPPLSLKIPSETEFIRCSTPSQRLSSPRYERNEQGDVEYTYEIDVSDFSAEEIKIKQHDHTLTIDANCSRSSKTCEESSSCSRSEKKEYHKTILLPQNADLTKKLETIYNDGILIIKIPVIPNPYSSIPGSAHVRSYPSQSPRDKIIVPEALIRNGKHVYSETLKMDPDFTKDDIKINVNGQTVVVNATQKRVDPHGCVSTRNYNSEHKFPTNVDLEHIQADWCGGELLISAPYK 240          
BLAST of HSP27 vs. Planmine SMEST
Match: SMESG000009940.1 (SMESG000009940.1)

HSP 1 Score: 102.834 bits (255), Expect = 4.600e-25
Identity = 81/275 (29.45%), Postives = 129/275 (46.91%), Query Frame = 3
Query:  192 ETEFIRCSTPS---QRLSSPRYERNEQGDVEYTYEIDVSDFSAEEIKIKQHDHTLTIDANXXXXXXXXXXXXXXXXXXXXXYHKTILLPQNADLTKKLETIYND-GILIIKIPVIPNPYSSI-PGSAHVRSYPSQSPRD---KIIVPE-----------------------------------------ALIRNGKHVYSETLKMDPDFTKDDIKINVNGQIVVVNATQKRVDPHGCVSTRNYNSEHKFPTNVDLEHIQADWC-GGELLISAPYK 866
            E E     TPS   +R   PRYE++  GDV+Y + +DV  FS  +I+I Q  + L I+A  S+S        +   SE KE+ K I LP N D+ K++ ++Y + G+L I+IP++P  YS++ P      +   QSP+     I+ P+                                          LI +    Y E + +DP F  +D+ I   G  V+++A  +   P+G  + + +N EH  P+NVD ++++A     G +LI APYK
Sbjct:    6 EFEKFSSLTPSYSFERSIQPRYEKSTNGDVDYIFTVDVDGFSPSDIRIDQRGNMLAIEAKQSKSGSKKGVHGNTEESEYKEFKKEISLPSNIDMKKEMRSVYTENGLLEIRIPILPQTYSNLYPPIRRPITIQRQSPQQTTFNILTPQISSPVYSSSFSTSGMGHRTLNGSLSPFDCSSSSLRSSMRSPVLITDKSKNYVEEIVIDPIFRPEDLNIKTKGYRVIISAKHEESGPNGYTNMKEFNDEHDLPSNVDPDNLKATLIDNGVVLIEAPYK 280          
BLAST of HSP27 vs. Planmine SMEST
Match: SMESG000030480.1 (SMESG000030480.1)

HSP 1 Score: 100.138 bits (248), Expect = 1.333e-24
Identity = 71/226 (31.42%), Postives = 123/226 (54.42%), Query Frame = 3
Query:  186 PSETEFIRCSTPSQRLSSPRYERNEQGDVEYTYEIDVSDFSAEEIKIKQHDHTLTIDANXXXXXXXXXXXXXXXXXXXXXYHKTILLPQNADLTKKLETIYN-DGILIIKIPVIPNPYSSIPGSAHVRSYPSQSPRDKI-IVPEALIRNGKHVYSETLKMDPDFTKDDIKINVNGQIVVVNATQKRVDPHGCVSTRNYNSEHKFPTNVDLEHIQADWCGGELLISA 857
            P+ET+  R  +   R+   RYERNE  +VE+ + ID+ DF+ EEI I Q  + + I  +      +  +S          +++ + LP+NAD+ K LE  +N DG LIIKI ++P  +SS   S +V      +P+ K    P  LI + K  + E + +D +F   DIK+NV+G I+ + A  +  + +G +  + Y+ E + P +++ + ++AD+  G L ++A
Sbjct:    7 PNETD-SRMPSSVDRMRIIRYERNENSEVEFKFIIDLGDFTPEEIGINQTGYQVAISGSRVVLPGSLRKSKE--------FYEVVSLPKNADMGKDLEAQFNPDGNLIIKIQIVPRLFSS---STYV------TPKQKFDRCP--LIEDEKTFFVEQVIVDQEFRDADIKVNVDGNIINIFAAIETKNDNGDIIVKEYHEECRLPPHINPDDLRADYMNGVLTLNA 212          
The following BLAST results are available for this feature:
BLAST of HSP27 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HSP27 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HSP27 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HSP27 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HSP27 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HSP27 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HSP27 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|P12812|P40_SCHMA8.791e-621.78Major egg antigen OS=Schistosoma mansoni OX=6183 P... [more]
back to top
BLAST of HSP27 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2U8U4E67.998e-11677.08HSP27 OS=Dugesia japonica OX=6161 GN=hsp27 PE=2 SV... [more]
A0A4S2LJ371.154e-924.58Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A419PWF51.492e-924.90Major egg antigen OS=Clonorchis sinensis OX=79923 ... [more]
A0A074Z3T68.436e-923.75Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A3R7CF963.485e-821.49Major egg antigen OS=Clonorchis sinensis OX=79923 ... [more]
back to top
BLAST of HSP27 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HSP27 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HSP27 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HSP27 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HSP27 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HSP27 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000030472.11.193e-15899.58SMESG000030472.1[more]
SMESG000009940.14.600e-2529.45SMESG000009940.1[more]
SMESG000030480.11.333e-2431.42SMESG000030480.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023008 ID=SMED30023008|Name=HSP27|organism=Schmidtea mediterranea sexual|type=transcript|length=986bp
ATTTGACTATCATCTCATTGAACAGAATGTATACACGTATATATGCATAC
GTATTTAGCATATACTTAGTATGCATAGCATTAGCATATCACCGATATCA
CAATAATCATTTCTAATTTTTTCAAATTCGCTCCGCTACAAACTTAATGG
ATAAAACAAAGCCTCCCCCGCTTTCATTGAAAATACCGAGTGAAACAGAA
TTTATCAGATGCAGCACCCCCAGTCAAAGGCTCAGTTCTCCTCGCTATGA
ACGAAACGAACAGGGAGACGTCGAATACACTTACGAGATCGATGTCAGTG
ATTTCAGCGCAGAAGAAATCAAAATCAAACAACACGATCACACTTTGACC
ATCGATGCCAACTGTTCTAGGTCTAGCAAAACCTGTGAAGAAAGTTCTTC
GTGCAGTCGATCAGAAAAGAAAGAATATCACAAAACAATTTTACTCCCTC
AAAATGCAGATCTAACGAAAAAGCTCGAAACGATTTACAACGATGGAATA
CTCATTATAAAGATCCCAGTTATCCCGAATCCATATTCATCAATTCCTGG
TAGTGCACACGTTCGCAGTTATCCCTCACAATCACCTAGGGATAAAATCA
TTGTTCCCGAAGCGTTGATTCGTAACGGTAAACATGTCTATTCGGAAACT
TTAAAAATGGACCCGGATTTCACGAAAGACGACATCAAAATCAATGTCAA
CGGTCAAATTGTAGTAGTAAATGCTACTCAGAAACGTGTGGATCCACATG
GTTGCGTCAGTACTAGAAATTACAACAGTGAACACAAGTTTCCAACCAAC
GTCGACCTAGAACATATTCAGGCTGATTGGTGTGGGGGAGAACTTTTGAT
TTCTGCGCCCTATAAGTTTTAGGATAGCTTCAAAATATTCTTCCGATTTT
TCTGTTAGTATGTTTAAGTTTAATAATATTTTTGAATTATGTTTACATTT
ACATTGAGATGAGATGCTTATTAATATACTTTTCAG
back to top

protein sequence of SMED30023008-orf-1

>SMED30023008-orf-1 ID=SMED30023008-orf-1|Name=SMED30023008-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=242bp
MDKTKPPPLSLKIPSETEFIRCSTPSQRLSSPRYERNEQGDVEYTYEIDV
SDFSAEEIKIKQHDHTLTIDANCSRSSKTCEESSSCSRSEKKEYHKTILL
PQNADLTKKLETIYNDGILIIKIPVIPNPYSSIPGSAHVRSYPSQSPRDK
IIVPEALIRNGKHVYSETLKMDPDFTKDDIKINVNGQIVVVNATQKRVDP
HGCVSTRNYNSEHKFPTNVDLEHIQADWCGGELLISAPYKF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR002068A-crystallin/Hsp20_dom
IPR008978HSP20-like_chaperone
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002068Alpha crystallin/Hsp20 domainPFAMPF00011HSP20coord: 40..128
e-value: 1.0E-11
score: 44.9
coord: 162..238
e-value: 4.9E-9
score: 36.3
IPR002068Alpha crystallin/Hsp20 domainPROSITEPS01031SHSPcoord: 25..142
score: 13.437
IPR008978HSP20-like chaperoneGENE3DG3DSA:2.60.40.790coord: 9..126
e-value: 6.1E-15
score: 57.8
coord: 145..240
e-value: 2.5E-10
score: 42.8
IPR008978HSP20-like chaperoneSUPERFAMILYSSF49764HSP20-like chaperonescoord: 173..239
IPR008978HSP20-like chaperoneSUPERFAMILYSSF49764HSP20-like chaperonescoord: 29..127
NoneNo IPR availablePANTHERPTHR45640FAMILY NOT NAMEDcoord: 33..142
NoneNo IPR availablePANTHERPTHR45640:SF8RE23625Pcoord: 33..142
NoneNo IPR availableCDDcd06464ACD_sHsps-likecoord: 168..238
e-value: 9.66871E-9
score: 49.0897
NoneNo IPR availableCDDcd06464ACD_sHsps-likecoord: 39..124
e-value: 5.88645E-11
score: 55.2529