Muscarinic acetylcholine receptor M1

Overview
NameMuscarinic acetylcholine receptor M1
Smed IDSMED30023001
Length (bp)1609
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Muscarinic acetylcholine receptor M1 (SMED30023001) t-SNE clustered cells

Violin plots show distribution of expression levels for Muscarinic acetylcholine receptor M1 (SMED30023001) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Muscarinic acetylcholine receptor M1 (SMED30023001) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Muscarinic acetylcholine receptor M1 (SMED30023001) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023001

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30023001SMESG000033502.1 SmedASXL_010466SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30023001SMESG000033502.1 dd_Smed_v6_28214_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Human
Match: CHRM2 (cholinergic receptor muscarinic 2 [Source:HGNC Symbol;Acc:HGNC:1951])

HSP 1 Score: 166.007 bits (419), Expect = 7.884e-45
Identity = 143/454 (31.50%), Postives = 223/454 (49.12%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKRKGMNTLLAMAGQTMSRIGVGVSWGNADDLDEIANPTVNFRI----NEGYDSSNKEYKNDIVIHPTSPYKLNAPPNLVKNLQYIDEHSSDSEEIYVYKSIYYNDYNSKLEPGISEILPLXXXXXXXXXXXXXPTNNTKSMNFXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTRFTFIHRKDTDVRSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFR 1538
            TI GNILV+++  + + ++T +NYF+ SLA  DL+IG+ SMNL+T+Y +IG WPL  ++CDLWL+LDY     S   +L I+ DR+  V  P TY + RT     +M+  +W++   ++   IL W +    R     ECY +F SN        I  F++ +I+M VLY  I R +K  +   DK++       +A Q                 D ++   V  RI    N    SS+   +++ + +  +P +     N V+  +   E S+DS  +    S   +D  ++ E  +S  L  +K +NS     +  T   KS +    +         S  +   + ++   +  + T    K     SR   +K  RTI  IL AF+  W PY+V+VLI  FC  C+ + ++ + YWLCYINS INP CYAL N+  K TF  LL   ++
Sbjct:   37 TIIGNILVMVSIKVNRHLQTVNNYFLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQFFSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKS-RIKKDKKE------PVANQ-----------------DPVSPSLVQGRIVKPNNNNMPSSDDGLEHNKIQNGKAP-RDPVTENCVQGEE--KESSNDSTSVSAVASNMRDDEITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKS-DSCTPTNTTVEVVGSSGQNGDEKQNIVARKIVKMTKQPAKKKPPPSRE--KKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNTVWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYK 460          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Human
Match: CHRM2 (cholinergic receptor muscarinic 2 [Source:HGNC Symbol;Acc:HGNC:1951])

HSP 1 Score: 166.007 bits (419), Expect = 7.884e-45
Identity = 143/454 (31.50%), Postives = 223/454 (49.12%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKRKGMNTLLAMAGQTMSRIGVGVSWGNADDLDEIANPTVNFRI----NEGYDSSNKEYKNDIVIHPTSPYKLNAPPNLVKNLQYIDEHSSDSEEIYVYKSIYYNDYNSKLEPGISEILPLXXXXXXXXXXXXXPTNNTKSMNFXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTRFTFIHRKDTDVRSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFR 1538
            TI GNILV+++  + + ++T +NYF+ SLA  DL+IG+ SMNL+T+Y +IG WPL  ++CDLWL+LDY     S   +L I+ DR+  V  P TY + RT     +M+  +W++   ++   IL W +    R     ECY +F SN        I  F++ +I+M VLY  I R +K  +   DK++       +A Q                 D ++   V  RI    N    SS+   +++ + +  +P +     N V+  +   E S+DS  +    S   +D  ++ E  +S  L  +K +NS     +  T   KS +    +         S  +   + ++   +  + T    K     SR   +K  RTI  IL AF+  W PY+V+VLI  FC  C+ + ++ + YWLCYINS INP CYAL N+  K TF  LL   ++
Sbjct:   37 TIIGNILVMVSIKVNRHLQTVNNYFLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQFFSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKS-RIKKDKKE------PVANQ-----------------DPVSPSLVQGRIVKPNNNNMPSSDDGLEHNKIQNGKAP-RDPVTENCVQGEE--KESSNDSTSVSAVASNMRDDEITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKS-DSCTPTNTTVEVVGSSGQNGDEKQNIVARKIVKMTKQPAKKKPPPSRE--KKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNTVWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYK 460          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Human
Match: CHRM2 (cholinergic receptor muscarinic 2 [Source:HGNC Symbol;Acc:HGNC:1951])

HSP 1 Score: 166.007 bits (419), Expect = 7.884e-45
Identity = 143/454 (31.50%), Postives = 223/454 (49.12%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKRKGMNTLLAMAGQTMSRIGVGVSWGNADDLDEIANPTVNFRI----NEGYDSSNKEYKNDIVIHPTSPYKLNAPPNLVKNLQYIDEHSSDSEEIYVYKSIYYNDYNSKLEPGISEILPLXXXXXXXXXXXXXPTNNTKSMNFXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTRFTFIHRKDTDVRSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFR 1538
            TI GNILV+++  + + ++T +NYF+ SLA  DL+IG+ SMNL+T+Y +IG WPL  ++CDLWL+LDY     S   +L I+ DR+  V  P TY + RT     +M+  +W++   ++   IL W +    R     ECY +F SN        I  F++ +I+M VLY  I R +K  +   DK++       +A Q                 D ++   V  RI    N    SS+   +++ + +  +P +     N V+  +   E S+DS  +    S   +D  ++ E  +S  L  +K +NS     +  T   KS +    +         S  +   + ++   +  + T    K     SR   +K  RTI  IL AF+  W PY+V+VLI  FC  C+ + ++ + YWLCYINS INP CYAL N+  K TF  LL   ++
Sbjct:   37 TIIGNILVMVSIKVNRHLQTVNNYFLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQFFSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKS-RIKKDKKE------PVANQ-----------------DPVSPSLVQGRIVKPNNNNMPSSDDGLEHNKIQNGKAP-RDPVTENCVQGEE--KESSNDSTSVSAVASNMRDDEITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKS-DSCTPTNTTVEVVGSSGQNGDEKQNIVARKIVKMTKQPAKKKPPPSRE--KKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNTVWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYK 460          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Human
Match: CHRM2 (cholinergic receptor muscarinic 2 [Source:HGNC Symbol;Acc:HGNC:1951])

HSP 1 Score: 166.007 bits (419), Expect = 7.884e-45
Identity = 143/454 (31.50%), Postives = 223/454 (49.12%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKRKGMNTLLAMAGQTMSRIGVGVSWGNADDLDEIANPTVNFRI----NEGYDSSNKEYKNDIVIHPTSPYKLNAPPNLVKNLQYIDEHSSDSEEIYVYKSIYYNDYNSKLEPGISEILPLXXXXXXXXXXXXXPTNNTKSMNFXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTRFTFIHRKDTDVRSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFR 1538
            TI GNILV+++  + + ++T +NYF+ SLA  DL+IG+ SMNL+T+Y +IG WPL  ++CDLWL+LDY     S   +L I+ DR+  V  P TY + RT     +M+  +W++   ++   IL W +    R     ECY +F SN        I  F++ +I+M VLY  I R +K  +   DK++       +A Q                 D ++   V  RI    N    SS+   +++ + +  +P +     N V+  +   E S+DS  +    S   +D  ++ E  +S  L  +K +NS     +  T   KS +    +         S  +   + ++   +  + T    K     SR   +K  RTI  IL AF+  W PY+V+VLI  FC  C+ + ++ + YWLCYINS INP CYAL N+  K TF  LL   ++
Sbjct:   37 TIIGNILVMVSIKVNRHLQTVNNYFLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQFFSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKS-RIKKDKKE------PVANQ-----------------DPVSPSLVQGRIVKPNNNNMPSSDDGLEHNKIQNGKAP-RDPVTENCVQGEE--KESSNDSTSVSAVASNMRDDEITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKS-DSCTPTNTTVEVVGSSGQNGDEKQNIVARKIVKMTKQPAKKKPPPSRE--KKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNTVWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYK 460          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Human
Match: CHRM1 (cholinergic receptor muscarinic 1 [Source:HGNC Symbol;Acc:HGNC:1950])

HSP 1 Score: 121.709 bits (304), Expect = 3.941e-29
Identity = 75/176 (42.61%), Postives = 108/176 (61.36%), Query Frame = 3
Query:  186 ATIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYR 713
            AT+ GN+LVLI+F +   ++T +NYF++SLA  DL+IG  SMNL+T YL++G+W L  L CDLWL+LDY A   S   +L I+ DR+ SV  P +YR  RT  +  +M+ ++WLV   ++   IL W Y    R   A +CY +F S  +      +  F++ + VMC LY  IYR
Sbjct:   38 ATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYR 213          

HSP 2 Score: 95.1301 bits (235), Expect = 2.581e-20
Identity = 44/83 (53.01%), Postives = 56/83 (67.47%), Query Frame = 3
Query: 1299 RARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLL--RGDFRR 1541
            + +KA RT+S IL AF+  WTPY+++VL+  FC  CV + L+ L YWLCY+NS INP CYAL N   + TF  LL  R D RR
Sbjct:  359 KEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLLCRWDKRR 441          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Celegans
Match: gar-2 (Muscarinic acetylcholine receptor gar-2 [Source:UniProtKB/Swiss-Prot;Acc:Q09388])

HSP 1 Score: 157.532 bits (397), Expect = 1.993e-44
Identity = 97/197 (49.24%), Postives = 129/197 (65.48%), Query Frame = 3
Query:  186 ATIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGN-WPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYF-NNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKRKGMNTLL 770
             T+ GN+ VL+++ L+K+IR P+NYFI SLA +DLLIGL  + ++T + +  N W    +LCDLWLS+DY  CL S YTVL ITVDR+ SVK PATYR WRT  +V+++++  WLVPS +F   I G+  F   GR    TECY +F +N   N  + I Y+W TL VM  LY GIYR AK+L   SD++     LL
Sbjct:   18 VTVIGNLAVLLSYYLDKNIRQPTNYFIFSLAISDLLIGLEGIPVYTAFYLNNNEWIWGDVLCDLWLSIDYIVCLASIYTVLGITVDRYYSVKKPATYRNWRTPGRVVLIIIFIWLVPSILFSVSIFGYGTFTGTGRILKETECYVQFMTNPYLNMGMYISYYWTTLFVMLYLYWGIYRAAKKLALKSDQKTKRLALL 214          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Celegans
Match: gar-2 (Muscarinic acetylcholine receptor gar-2 [Source:UniProtKB/Swiss-Prot;Acc:Q09388])

HSP 1 Score: 161.384 bits (407), Expect = 1.014e-42
Identity = 106/234 (45.30%), Postives = 143/234 (61.11%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGN-WPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYF-NNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKRKGMNTLLAMAGQTMSRIGVGVSWGNA-----DDLDEIANPTVNFR 869
            T+ GN+ VL+++ L+K+IR P+NYFI SLA +DLLIGL  + ++T + +  N W    +LCDLWLS+DY  CL S YTVL ITVDR+ SVK PATYR WRT  +V+++++  WLVPS +F   I G+  F   GR    TECY +F +N   N  + I Y+W TL VM  LY GIYR AK+L   SD++     LL      M R  V V   +A     D  ++ +N +  FR
Sbjct:   19 TVIGNLAVLLSYYLDKNIRQPTNYFIFSLAISDLLIGLEGIPVYTAFYLNNNEWIWGDVLCDLWLSIDYIVCLASIYTVLGITVDRYYSVKKPATYRNWRTPGRVVLIIIFIWLVPSILFSVSIFGYGTFTGTGRILKETECYVQFMTNPYLNMGMYISYYWTTLFVMLYLYWGIYRAAKKLALKSDQKTKRLALLT----EMRRPEVSVRTSDAGNSSSDSPNDTSNSSKCFR 248          

HSP 2 Score: 122.094 bits (305), Expect = 3.309e-29
Identity = 54/94 (57.45%), Postives = 69/94 (73.40%), Query Frame = 3
Query: 1272 KDTDVRSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVN----DHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFRR 1541
            K+   RS NRARKALRTI+ ILG+F+  WTP++VL  I GFC +C      + LY +SY+LCY+NSP+NPFCYA+AN Q K T  R+ +GDFRR
Sbjct:  520 KEYKSRSENRARKALRTITFILGSFIILWTPFYVLATIYGFCETCKASPSFNTLYTISYYLCYMNSPLNPFCYAMANQQFKKTLTRIFKGDFRR 613          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Celegans
Match: gar-2 (Muscarinic acetylcholine receptor gar-2 [Source:UniProtKB/Swiss-Prot;Acc:Q09388])

HSP 1 Score: 161.384 bits (407), Expect = 1.224e-42
Identity = 106/234 (45.30%), Postives = 143/234 (61.11%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGN-WPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYF-NNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKRKGMNTLLAMAGQTMSRIGVGVSWGNA-----DDLDEIANPTVNFR 869
            T+ GN+ VL+++ L+K+IR P+NYFI SLA +DLLIGL  + ++T + +  N W    +LCDLWLS+DY  CL S YTVL ITVDR+ SVK PATYR WRT  +V+++++  WLVPS +F   I G+  F   GR    TECY +F +N   N  + I Y+W TL VM  LY GIYR AK+L   SD++     LL      M R  V V   +A     D  ++ +N +  FR
Sbjct:   19 TVIGNLAVLLSYYLDKNIRQPTNYFIFSLAISDLLIGLEGIPVYTAFYLNNNEWIWGDVLCDLWLSIDYIVCLASIYTVLGITVDRYYSVKKPATYRNWRTPGRVVLIIIFIWLVPSILFSVSIFGYGTFTGTGRILKETECYVQFMTNPYLNMGMYISYYWTTLFVMLYLYWGIYRAAKKLALKSDQKTKRLALLT----EMRRPEVSVRTSDAGNSSSDSPNDTSNSSKCFR 248          

HSP 2 Score: 124.79 bits (312), Expect = 4.843e-30
Identity = 55/98 (56.12%), Postives = 71/98 (72.45%), Query Frame = 3
Query: 1260 FIHRKDTDVRSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVN----DHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFRR 1541
            F  +K+   RS NRARKALRTI+ ILG+F+  WTP++VL  I GFC +C      + LY +SY+LCY+NSP+NPFCYA+AN Q K T  R+ +GDFRR
Sbjct:  529 FQRKKEYKSRSENRARKALRTITFILGSFIILWTPFYVLATIYGFCETCKASPSFNTLYTISYYLCYMNSPLNPFCYAMANQQFKKTLTRIFKGDFRR 626          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Celegans
Match: gar-2 (Muscarinic acetylcholine receptor gar-2 [Source:UniProtKB/Swiss-Prot;Acc:Q09388])

HSP 1 Score: 160.999 bits (406), Expect = 2.571e-42
Identity = 106/234 (45.30%), Postives = 143/234 (61.11%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGN-WPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYF-NNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKRKGMNTLLAMAGQTMSRIGVGVSWGNA-----DDLDEIANPTVNFR 869
            T+ GN+ VL+++ L+K+IR P+NYFI SLA +DLLIGL  + ++T + +  N W    +LCDLWLS+DY  CL S YTVL ITVDR+ SVK PATYR WRT  +V+++++  WLVPS +F   I G+  F   GR    TECY +F +N   N  + I Y+W TL VM  LY GIYR AK+L   SD++     LL      M R  V V   +A     D  ++ +N +  FR
Sbjct:   19 TVIGNLAVLLSYYLDKNIRQPTNYFIFSLAISDLLIGLEGIPVYTAFYLNNNEWIWGDVLCDLWLSIDYIVCLASIYTVLGITVDRYYSVKKPATYRNWRTPGRVVLIIIFIWLVPSILFSVSIFGYGTFTGTGRILKETECYVQFMTNPYLNMGMYISYYWTTLFVMLYLYWGIYRAAKKLALKSDQKTKRLALLT----EMRRPEVSVRTSDAGNSSSDSPNDTSNSSKCFR 248          

HSP 2 Score: 121.324 bits (303), Expect = 6.586e-29
Identity = 56/102 (54.90%), Postives = 71/102 (69.61%), Query Frame = 3
Query: 1260 FIHRK----DTDVRSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVN----DHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFRR 1541
            F  RK    +   RS NRARKALRTI+ ILG+F+  WTP++VL  I GFC +C      + LY +SY+LCY+NSP+NPFCYA+AN Q K T  R+ +GDFRR
Sbjct:  565 FFQRKKVTREYKSRSENRARKALRTITFILGSFIILWTPFYVLATIYGFCETCKASPSFNTLYTISYYLCYMNSPLNPFCYAMANQQFKKTLTRIFKGDFRR 666          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Celegans
Match: gar-1 (Probable muscarinic acetylcholine receptor gar-1 [Source:UniProtKB/Swiss-Prot;Acc:Q18007])

HSP 1 Score: 132.88 bits (333), Expect = 9.084e-33
Identity = 79/211 (37.44%), Postives = 126/211 (59.72%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSI-RTPSNYFIISLASTDLLIGLISMNLFTIYLIIGN-WPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYF-NNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKRKGMNTLLAMAGQTMSRIGVGV 812
            TI GN +V++A+ +E++I +  SN +I+SLA +DL+IG+     FT+Y++ G+ WPL  + C  WL LDYT CL S  TVL IT DR+ SV   A Y  W++  K  +++++SWL+P+ IF   I GW             EC A F SN   N  + + Y+W TL+ M +LY GI++ AK L+  +  ++  +  L ++ +  +++GV +
Sbjct:   38 TIIGNAMVVMAYRIERNISKQVSNRYIVSLAISDLIIGIEGFPFFTVYVLNGDRWPLGWVACQTWLFLDYTLCLVSILTVLLITADRYLSVCHTAKYLKWQSPTKTQLLIVMSWLLPAIIFGIMIYGWQAMTGQSTSMSGAECSAPFLSNPYVNMGMYVAYYWTTLVAMLILYKGIHQAAKNLEKKAKAKERRHIALILSQRLGTQVGVSL 248          

HSP 2 Score: 102.449 bits (254), Expect = 8.833e-23
Identity = 43/100 (43.00%), Postives = 62/100 (62.00%), Query Frame = 3
Query: 1245 FTRFTFIHRKDTDVRSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFCN-SCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFRR 1541
            F      +R     ++  RA KA RTI+ I+G F   W+PY+++  + GFC   C+   LY LSY++CY+NS  NPF YALAN Q ++ FMR+ RG+F +
Sbjct:  521 FAPIAVFNRGRKQTKAEKRAHKAFRTITFIVGFFAILWSPYYIMATVYGFCKGECIPSFLYTLSYYMCYLNSSGNPFAYALANRQFRSAFMRMFRGNFNK 620          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Fly
Match: mAChR-B (gene:FBgn0037546 transcript:FBtr0344726)

HSP 1 Score: 212.231 bits (539), Expect = 5.059e-60
Identity = 112/214 (52.34%), Postives = 155/214 (72.43%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSD-KRKGMNTLLAMAGQTMSRI-----GVGV 812
            T+GGNILVL+AF+++++IR PSNYFI SLA+TD+LIG +SM  +TIY++ G W L  +LCDLWLS+DYT CL SQYTVL IT+DR+CSVKI A YR WRT+ +VI MV I+W++P+ +FF  I GW +F   R     +C  +F  + +FNT L I Y+W TLIV+ VLYAGIY+ A  +Q  S+ K++ M +++A++   MS +     G+GV
Sbjct:  147 TVGGNILVLLAFIVDRNIRQPSNYFIASLAATDMLIGTVSMPFYTIYVLKGYWDLGPMLCDLWLSVDYTVCLVSQYTVLLITIDRYCSVKIAAKYRSWRTRTRVIYMVTITWIIPALLFFISIFGWEHFTGKRDLLPGQCAVQFLKDPIFNTALIIGYYWTTLIVLFVLYAGIYKTAYDMQKRSEAKQRKMQSMVALSAGAMSGMAGHAAGIGV 360          

HSP 2 Score: 135.576 bits (340), Expect = 2.555e-33
Identity = 58/85 (68.24%), Postives = 67/85 (78.82%), Query Frame = 3
Query: 1287 RSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNS--CVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDF 1535
            +S NRARKA RTIS ILG FV CWTPYHVL L++GFC    C+N+HLY  SY+LCY NSP+NPFCYALAN Q K TF R+L+GD 
Sbjct:  668 KSENRARKAFRTISFILGCFVACWTPYHVLALVEGFCRHPPCINEHLYMFSYFLCYANSPMNPFCYALANQQFKKTFTRILKGDL 752          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Fly
Match: mAChR-B (gene:FBgn0037546 transcript:FBtr0081789)

HSP 1 Score: 213.001 bits (541), Expect = 2.174e-59
Identity = 112/214 (52.34%), Postives = 155/214 (72.43%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSD-KRKGMNTLLAMAGQTMSRI-----GVGV 812
            T+GGNILVL+AF+++++IR PSNYFI SLA+TD+LIG +SM  +TIY++ G W L  +LCDLWLS+DYT CL SQYTVL IT+DR+CSVKI A YR WRT+ +VI MV I+W++P+ +FF  I GW +F   R     +C  +F  + +FNT L I Y+W TLIV+ VLYAGIY+ A  +Q  S+ K++ M +++A++   MS +     G+GV
Sbjct:  147 TVGGNILVLLAFIVDRNIRQPSNYFIASLAATDMLIGTVSMPFYTIYVLKGYWDLGPMLCDLWLSVDYTVCLVSQYTVLLITIDRYCSVKIAAKYRSWRTRTRVIYMVTITWIIPALLFFISIFGWEHFTGKRDLLPGQCAVQFLKDPIFNTALIIGYYWTTLIVLFVLYAGIYKTAYDMQKRSEAKQRKMQSMVALSAGAMSGMAGHAAGIGV 360          

HSP 2 Score: 135.961 bits (341), Expect = 2.169e-33
Identity = 58/85 (68.24%), Postives = 67/85 (78.82%), Query Frame = 3
Query: 1287 RSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNS--CVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDF 1535
            +S NRARKA RTIS ILG FV CWTPYHVL L++GFC    C+N+HLY  SY+LCY NSP+NPFCYALAN Q K TF R+L+GD 
Sbjct:  932 KSENRARKAFRTISFILGCFVACWTPYHVLALVEGFCRHPPCINEHLYMFSYFLCYANSPMNPFCYALANQQFKKTFTRILKGDL 1016          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Fly
Match: mAChR-A (gene:FBgn0000037 transcript:FBtr0072367)

HSP 1 Score: 119.013 bits (297), Expect = 6.632e-28
Identity = 75/184 (40.76%), Postives = 105/184 (57.07%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNT---VFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQ 731
            T+ GN++V+I+F ++K ++T SNYF+ SLA  D  IG ISM LF +  I+G WPL  ++CD WL+LDY A   S   +L I+ DR+ SV  P TYR  RT N+  +M+  +W +   ++   I  WPY    R     ECY +F        F T L   YF +T  +MC LY  I+R  K+ Q
Sbjct:  118 TVAGNVMVMISFKIDKQLQTISNYFLFSLAIADFAIGAISMPLFAVTTILGYWPLGPIVCDTWLALDYLASNASVLNLLIISFDRYFSVTRPLTYRAKRTTNRAAVMIGAAWGISLLLWPPWIYSWPYIEGKRTVPKDECYIQFIETNQYITFGTALAAFYFPVT--IMCFLYWRIWRETKKRQ 299          

HSP 2 Score: 80.8777 bits (198), Expect = 1.235e-15
Identity = 37/81 (45.68%), Postives = 55/81 (67.90%), Query Frame = 3
Query: 1287 RSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGF--CNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLL 1523
            + + +  KA +T+S IL +F+  WTPY++LVLIK    C+ C+   L++  Y LCYINS INP CYAL N+  + T++R+L
Sbjct:  690 QEKRQESKAAKTLSAILLSFIITWTPYNILVLIKPLTTCSDCIPTELWDFFYALCYINSTINPMCYALCNATFRRTYVRIL 770          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Fly
Match: mAChR-A (gene:FBgn0000037 transcript:FBtr0072368)

HSP 1 Score: 118.627 bits (296), Expect = 8.270e-28
Identity = 75/184 (40.76%), Postives = 105/184 (57.07%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNT---VFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQ 731
            T+ GN++V+I+F ++K ++T SNYF+ SLA  D  IG ISM LF +  I+G WPL  ++CD WL+LDY A   S   +L I+ DR+ SV  P TYR  RT N+  +M+  +W +   ++   I  WPY    R     ECY +F        F T L   YF +T  +MC LY  I+R  K+ Q
Sbjct:  118 TVAGNVMVMISFKIDKQLQTISNYFLFSLAIADFAIGAISMPLFAVTTILGYWPLGPIVCDTWLALDYLASNASVLNLLIISFDRYFSVTRPLTYRAKRTTNRAAVMIGAAWGISLLLWPPWIYSWPYIEGKRTVPKDECYIQFIETNQYITFGTALAAFYFPVT--IMCFLYWRIWRETKKRQ 299          

HSP 2 Score: 80.8777 bits (198), Expect = 1.241e-15
Identity = 37/81 (45.68%), Postives = 55/81 (67.90%), Query Frame = 3
Query: 1287 RSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGF--CNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLL 1523
            + + +  KA +T+S IL +F+  WTPY++LVLIK    C+ C+   L++  Y LCYINS INP CYAL N+  + T++R+L
Sbjct:  707 QEKRQESKAAKTLSAILLSFIITWTPYNILVLIKPLTTCSDCIPTELWDFFYALCYINSTINPMCYALCNATFRRTYVRIL 787          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Fly
Match: 5-HT7 (gene:FBgn0004573 transcript:FBtr0334508)

HSP 1 Score: 80.4925 bits (197), Expect = 1.285e-15
Identity = 64/201 (31.84%), Postives = 103/201 (51.24%), Query Frame = 3
Query:  186 ATIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFT--CILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKRKGMNTLLAMAG 782
             T+ GN+LV IA  + + +R P NY ++SLA +DL + L+ M +  +Y ++  W    LLCD+W+S D   C  S   +  I+VDR+ ++  P  Y + RT  ++++ V I WL  + I      ILG  + +   Q   T C      N  +    T+  F+I L VM  +Y  I+R A+R+    +KR   +   A+ G
Sbjct:  175 GTVVGNVLVCIAVCMVRKLRRPCNYLLVSLALSDLCVALLVMPMALLYEVLEKWNFGPLLCDIWVSFDVLCCTASILNLCAISVDRYLAITKPLEYGVKRTPRRMMLCVGIVWLAAACISLPPLLILGNEHEDEEGQPICTVC-----QNFAYQIYATLGSFYIPLSVMLFVYYQIFRAARRI-VLEEKRAQTHLQQALNG 369          

HSP 2 Score: 56.6102 bits (135), Expect = 3.637e-8
Identity = 28/75 (37.33%), Postives = 40/75 (53.33%), Query Frame = 3
Query: 1299 RARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLL 1523
            + +KA  T+ +I+ AF  CW P+ +L LI+ F    V   L +L  WL Y NS +NP  YA  N   +  F  +L
Sbjct:  448 KEKKASTTLGIIMSAFTVCWLPFFILALIRPFETMHVPASLSSLFLWLGYANSLLNPIIYATLNRDFRKPFQEIL 522          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Zebrafish
Match: chrm5b (cholinergic receptor, muscarinic 5b [Source:ZFIN;Acc:ZDB-GENE-041001-169])

HSP 1 Score: 172.555 bits (436), Expect = 3.756e-47
Identity = 138/475 (29.05%), Postives = 233/475 (49.05%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKRKGMNTLLAMAGQTM------------SRIGVGVSWGNAD---------DLDEIANPTVNFRINEGYDSSNKEYKNDIVIHPTSPYKLNAPPNLVKNLQYIDEHSSD--SEEIYVYKSIYYNDYNSKLEPGISEILPLXXXXXXXXXXXXXPTNNTKSMNFXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTRFTFIHRKDTDVRSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFRRN 1544
            TI GN+LV+++F +   ++T +NY+++SLA  DL+IG+ SMNL+T Y+++G W L    CDLWL+LDY A   S   +L I+ DR+ S+  P TYR  RT  +  IM+ ++WL+   ++   IL W YF   R+    +C  +F S  +      I  F++ + +M +LY  IY+  ++   +  + +G  +L +  G  +             R G   SW +++           D++   +        Y SS  + ++     P   +K   PP + KN Q +    S   S+     ++      + K +P IS+I  L                N++S       +  Q     +SSS   +    ++Q T+     ++   ++ +  A    +T+S IL AF+  WTPY+++VLI  FC++C+   L+ L YWLCY+NS +NP CYAL N   + TF  L+   +++N
Sbjct:   41 TIVGNVLVMLSFKVNSQLKTVNNYYLLSLAFADLIIGVFSMNLYTCYILMGYWSLGNTACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGMAWLISFILWAPPILCWQYFVGERKVPLDQCQIQFFSEPIITFGTAIAAFYVPVSIMTILYCKIYKETEKRTKNLAELQGYPSLDSQDGPKVRKPILRCFSFKNKRDGTQASWSSSNQSYVTRTTLQSDDLWTKSEQVTTLNSYTSSEDDDRSVSESTPRESFKNQEPP-VSKNGQLVCYEDSKYLSDLAKCSQTNNKKCLSYKFKPIISDITVL--------------QGNSESERANPDQSSDQQAPSSTSSSTKPEDPNLKIQMTK----RKRMVLIKEKKAA----QTLSAILLAFLLTWTPYNIMVLISTFCSNCIPTSLWQLGYWLCYVNSTVNPMCYALCNKTFQKTFWMLILCKWKKN 492          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Zebrafish
Match: chrm5b (cholinergic receptor, muscarinic 5b [Source:ZFIN;Acc:ZDB-GENE-041001-169])

HSP 1 Score: 161.384 bits (407), Expect = 2.112e-43
Identity = 132/467 (28.27%), Postives = 226/467 (48.39%), Query Frame = 3
Query:  213 LIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKRKGMNTLLAMAGQTM------------SRIGVGVSWGNAD---------DLDEIANPTVNFRINEGYDSSNKEYKNDIVIHPTSPYKLNAPPNLVKNLQYIDEHSSD--SEEIYVYKSIYYNDYNSKLEPGISEILPLXXXXXXXXXXXXXPTNNTKSMNFXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTRFTFIHRKDTDVRSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFRRN 1544
            +++F +   ++T +NY+++SLA  DL+IG+ SMNL+T Y+++G W L    CDLWL+LDY A   S   +L I+ DR+ S+  P TYR  RT  +  IM+ ++WL+   ++   IL W YF   R+    +C  +F S  +      I  F++ + +M +LY  IY+  ++   +  + +G  +L +  G  +             R G   SW +++           D++   +        Y SS  + ++     P   +K   PP + KN Q +    S   S+     ++      + K +P IS+I  L                N++S       +  Q     +SSS   +    ++Q T+     ++   ++ +  A    +T+S IL AF+  WTPY+++VLI  FC++C+   L+ L YWLCY+NS +NP CYAL N   + TF  L+   +++N
Sbjct:    1 MLSFKVNSQLKTVNNYYLLSLAFADLIIGVFSMNLYTCYILMGYWSLGNTACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGMAWLISFILWAPPILCWQYFVGERKVPLDQCQIQFFSEPIITFGTAIAAFYVPVSIMTILYCKIYKETEKRTKNLAELQGYPSLDSQDGPKVRKPILRCFSFKNKRDGTQASWSSSNQSYVTRTTLQSDDLWTKSEQVTTLNSYTSSEDDDRSVSESTPRESFKNQEPP-VSKNGQLVCYEDSKYLSDLAKCSQTNNKKCLSYKFKPIISDITVL--------------QGNSESERANPDQSSDQQAPSSTSSSTKPEDPNLKIQMTK----RKRMVLIKEKKAA----QTLSAILLAFLLTWTPYNIMVLISTFCSNCIPTSLWQLGYWLCYVNSTVNPMCYALCNKTFQKTFWMLILCKWKKN 444          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Zebrafish
Match: CR812847.1 (pep chromosome:GRCz11:CHR_ALT_CTG14_1_19:24256795:24262094:1 gene:ENSDARG00000112321.1 transcript:ENSDART00000181335.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR812847.1)

HSP 1 Score: 117.472 bits (293), Expect = 2.859e-28
Identity = 85/254 (33.46%), Postives = 134/254 (52.76%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKR-------LQASSDKRKGMNTLLAMAGQTM--SRIGVGV---SWGNADDLDEIANPTVNFRINEGYDSSNKEYKND 914
            TI GN+LV+I+F +   +RT SNYF++SLA  D+++G ISMNL+T Y+++  W L  L CD+WL++DY A   S   +L I++DR+ SV  P TYR  RT  + +IM+ ++W +   I+   IL W Y    R     EC  +F S  V      I  F++ + VM  LY  +YR  ++       L AS   R G  + +    +T+   R   G+    W    + ++I+N          Y ++NK + ++
Sbjct:   33 TITGNVLVMISFRVNPLLRTVSNYFLLSLAVADVILGSISMNLYTTYILLNGWTLGNLACDVWLAVDYVASNASVMNLLAISIDRYLSVMRPLTYRAKRTPKRAMIMISLAWTISFVIWAPAILFWQYIVGERTVQENECSIQFLSEPVITFGTAIAAFYLPVSVMVALYWRVYRETEKRSQKLAGLMASQGGRTGNASQVGFTVKTLLPGRCVKGIWTACWKKQREREDISN---------SYSAANKPHDSE 277          

HSP 2 Score: 95.5153 bits (236), Expect = 1.048e-20
Identity = 39/75 (52.00%), Postives = 54/75 (72.00%), Query Frame = 3
Query: 1299 RARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLL 1523
            + +KA RT+S IL AF+  WTPY+++VL+  FC++CV + L+ L YWLCY+NS +NP CYAL N   + TF  LL
Sbjct:  311 KEKKAARTLSAILLAFIVTWTPYNIMVLVSTFCDNCVPERLWKLGYWLCYVNSTVNPLCYALCNKHFRVTFRALL 385          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Zebrafish
Match: chrm1a (cholinergic receptor, muscarinic 1a [Source:ZFIN;Acc:ZDB-GENE-090410-9])

HSP 1 Score: 116.316 bits (290), Expect = 8.359e-28
Identity = 85/254 (33.46%), Postives = 134/254 (52.76%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKR-------LQASSDKRKGMNTLLAMAGQTM--SRIGVGV---SWGNADDLDEIANPTVNFRINEGYDSSNKEYKND 914
            TI GN+LV+I+F +   +RT SNYF++SLA  D+++G ISMNL+T Y+++  W L  L CD+WL++DY A   S   +L I++DR+ SV  P TYR  RT  + +IM+ ++W +   I+   IL W Y    R     EC  +F S  V      I  F++ + VM  LY  +YR  ++       L AS   R G  + +    +T+   R   G+    W    + ++I+N       N    ++NK + ++
Sbjct:   36 TITGNVLVMISFRVNPLLRTVSNYFLLSLAVADVILGSISMNLYTTYILLNGWTLGNLACDVWLAVDYVASNASVMNLLAISIDRYLSVMRPLTYRAKRTPKRAMIMISLAWTISFVIWAPAILFWQYIVGERTVQENECSIQFLSEPVITFGTAIAAFYLPVSVMVALYWRVYRETEKRSQKLAGLMASQGGRTGNASQVGFTVKTLLPGRCVKGIWTACWKKQREREDISNSYATN--NHPQSAANKPHDSE 287          

HSP 2 Score: 95.1301 bits (235), Expect = 1.318e-20
Identity = 39/75 (52.00%), Postives = 54/75 (72.00%), Query Frame = 3
Query: 1299 RARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLL 1523
            + +KA RT+S IL AF+  WTPY+++VL+  FC++CV + L+ L YWLCY+NS +NP CYAL N   + TF  LL
Sbjct:  321 KEKKAARTLSAILLAFIVTWTPYNIMVLVSTFCDNCVPERLWKLGYWLCYVNSTVNPLCYALCNKHFRVTFRALL 395          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Zebrafish
Match: chrm2a (cholinergic receptor, muscarinic 2a [Source:ZFIN;Acc:ZDB-GENE-030314-1])

HSP 1 Score: 117.472 bits (293), Expect = 8.744e-28
Identity = 76/200 (38.00%), Postives = 119/200 (59.50%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAK-RLQASSDKRKGMNTLLAMAGQ 785
            T+ GNILV+++  + +S++T +NYF+ SLA  DL+IGL SMNL+T+Y++IG WPL  ++CDLWL+LDY     S   +L I+ DR+  V  P +Y + RT     +M+  +W++   ++   IL W +   GR     ECY +F SN        I  F++ +I+M VLY  + R +K R++  + K  G N  +A + Q
Sbjct:   45 TVIGNILVMLSIKVNRSLQTVNNYFLFSLACADLIIGLCSMNLYTVYIVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLSYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGGRTVPEKECYIQFFSNAAVTFGTAIAAFYLPVIIMMVLYWQVSRASKSRVKKDNRKPSGGNLDVASSNQ 244          

HSP 2 Score: 94.3597 bits (233), Expect = 4.623e-20
Identity = 43/81 (53.09%), Postives = 56/81 (69.14%), Query Frame = 3
Query: 1296 NRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFR 1538
            +R +K  RTI  IL AFV  WTPY+V+VLI  FC+SC+ + ++ + YWLCYINS INP CYAL N   K TF +LL   ++
Sbjct:  409 SREKKVTRTIMAILVAFVATWTPYNVMVLINTFCSSCIPNTVWTIGYWLCYINSTINPACYALCNITFKKTFKQLLLCQYK 489          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Xenopus
Match: ENSXETT00000048394.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:59937956:59939943:1 gene:ENSXETG00000020181.1 transcript:ENSXETT00000048394.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 120.553 bits (301), Expect = 2.156e-28
Identity = 78/213 (36.62%), Postives = 122/213 (57.28%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKRKGMNTLLAMAGQTMSRIGVGVSWGNA 827
            T+ GNILV++AF + K ++T +NYF++SLA  DL+IG+ISMNLFT Y+I+ +W +  L CDLWL +DY A   S   +L I+ DR+ S+  P TYR  RT  +  IM+ ++W++   ++   IL W YF   R   + EC+ +F +  +      I  F++ + +M +LY  IY+        ++KR      L  +G  +   G+    GNA
Sbjct:   63 TVIGNILVILAFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMDHWIMGSLACDLWLMIDYVASNASVMNLLVISFDRYFSITRPLTYRTKRTTKRAGIMIGLAWIISFILWAPAILFWQYFVGKRTVPSDECFIQFFTEPIITFGTAIAAFYLPVSIMTILYWRIYK-------ETEKRTKELAGLQASGGKLEVPGLSHRTGNA 268          

HSP 2 Score: 91.2781 bits (225), Expect = 6.610e-19
Identity = 45/94 (47.87%), Postives = 57/94 (60.64%), Query Frame = 3
Query: 1251 RFTFIHRKDTDVRSRN---RARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLL 1523
            RF    R     R R    + +KA +T+S IL AF+  W PY+++VL+  FC SC+    +NL YWLCYINS INP CYAL N   +TTF  LL
Sbjct:  437 RFAAKTRNQITKRKRMSLIKEKKAAQTLSAILLAFIITWAPYNIMVLVNTFCESCIPRIYWNLGYWLCYINSTINPICYALCNKTFRTTFKILL 530          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Xenopus
Match: CHRM1 (cholinergic receptor, muscarinic 1 [Source:NCBI gene;Acc:100490434])

HSP 1 Score: 115.546 bits (288), Expect = 7.355e-27
Identity = 68/175 (38.86%), Postives = 107/175 (61.14%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYR 713
            T+ GN+LVL+AF +   ++T +NYF++SLA  D++IG +SMNL+T Y+++G W L  + CDLWL+LDY A   S   +L I+ DR+ S+  P TYR  RT  +  IM+ ++W +   ++   I+ W Y    R   AT+CY +F S  +      I  F++ + +M +LY  +YR
Sbjct:   61 TVIGNVLVLLAFKVNSDLKTVNNYFLLSLACADIIIGALSMNLYTTYIVMGRWALGPVSCDLWLALDYVASNASVMNLLIISFDRYFSITRPLTYRAKRTPRRAAIMIGMAWFISFVLWAPAIIFWQYIVGERTVEATDCYIQFFSQPIITFGTAIAAFYLPVTIMIILYWRVYR 235          

HSP 2 Score: 91.6633 bits (226), Expect = 5.458e-19
Identity = 44/96 (45.83%), Postives = 58/96 (60.42%), Query Frame = 3
Query: 1266 HRKDTDVRSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLL--RGDFRRNW 1547
            H       S  + +KA +T+S IL AF+  WTPY+++VL+  FC  CV   L+ L YWLCY+NS +NP CYAL N   + TF  LL  R D +R W
Sbjct:  412 HHGKRKSNSLIKEKKAAKTLSAILLAFILTWTPYNIMVLVSTFCPDCVPKKLWELGYWLCYVNSTVNPMCYALCNRSFRRTFKMLLLCRWD-KRKW 506          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Xenopus
Match: slitrk3 (SLIT and NTRK like family member 3 [Source:Xenbase;Acc:XB-GENE-964617])

HSP 1 Score: 115.546 bits (288), Expect = 8.458e-27
Identity = 71/193 (36.79%), Postives = 113/193 (58.55%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKRKGMNTL 767
            TI GNILV+++F +   ++T +NY+++SLA  DL+IG+ SMNL+T Y++IG+W L  L CDLWL+LDY A   S   +L I+ DR+ S+  P TYR  RT  +  +M+ ++W +   ++   IL W YF  GR     EC  +F    +      I  F++ + VM +LY  IY+  ++      + +G  ++
Sbjct:   39 TIVGNILVMVSFKVNSQLKTVNNYYLLSLACADLIIGIFSMNLYTSYILIGHWSLGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGLMIGLAWFISFILWAPAILCWQYFVGGRTVPPEECQIQFLYEPIITFGTAIAAFYLPVSVMTILYCRIYKETEKRTKDLAELQGSESV 231          

HSP 2 Score: 93.2041 bits (230), Expect = 1.810e-19
Identity = 39/82 (47.56%), Postives = 56/82 (68.29%), Query Frame = 3
Query: 1299 RARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFRRN 1544
            + RKA +T+S IL AF+  WTPY+++VL+  FC+ C+   L++L YWLCY+NS +NP CYAL N   + TF  LL   +R+ 
Sbjct:  424 KERKAAQTLSAILLAFIITWTPYNIMVLVSTFCSDCIPSSLWHLGYWLCYVNSTVNPICYALCNKTFRKTFKMLLLCRWRKK 505          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Xenopus
Match: CHRM2 (cholinergic receptor, muscarinic 2 [Source:NCBI gene;Acc:100485603])

HSP 1 Score: 111.309 bits (277), Expect = 1.385e-25
Identity = 72/191 (37.70%), Postives = 108/191 (56.54%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKRKGMN 761
            TI GNILV+++  + + ++T +NYF+ SLA  DL+IG+ SMNL+T+Y +IG WP+  ++CDLWL+LDY     S   +L I+ DR+  V  P TY + RT     +M+  +W++   ++   IL W +   GR     ECY +F SN        I  F++ +I+M VLY  I R +K       K    N
Sbjct:   40 TIIGNILVMVSIKVNRHLQTVNNYFLFSLACADLIIGVFSMNLYTLYTVIGYWPIGPVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTYPVRRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGGRTVPEGECYIQFFSNAAVTFGTAIAAFYLPVIIMTVLYWQISRASKSRIKKGKKEAAPN 230          

HSP 2 Score: 91.2781 bits (225), Expect = 4.603e-19
Identity = 42/81 (51.85%), Postives = 54/81 (66.67%), Query Frame = 3
Query: 1296 NRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFR 1538
            +R +K  RTI  IL AF+  WTPY+V+VLI  FC  CV + ++ + YWLCYINS INP CYAL N+  K TF  LL   ++
Sbjct:  384 SREKKVTRTILAILLAFIITWTPYNVMVLINTFCAVCVPNTVWTIGYWLCYINSTINPACYALCNTTFKKTFKHLLMCQYK 464          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Xenopus
Match: cfb (complement factor B [Source:Xenbase;Acc:XB-GENE-479361])

HSP 1 Score: 94.7449 bits (234), Expect = 9.967e-21
Identity = 44/98 (44.90%), Postives = 60/98 (61.22%), Query Frame = 3
Query: 1251 RFTFIHRKDTDVRSRNRAR--KALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFR 1538
            +F  I R     + +  AR  K  RTI  IL AF+  WTPY+V+VLI  FC +C+ + ++ + YWLCY+NS INP CYAL N+  K TF  LL   ++
Sbjct:  226 KFASIARNQVRKKRQMAAREKKVTRTIFAILLAFIITWTPYNVMVLINTFCQTCIPETVWYIGYWLCYVNSTINPACYALCNATFKKTFKHLLMCQYK 323          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Mouse
Match: Chrm1 (cholinergic receptor, muscarinic 1, CNS [Source:MGI Symbol;Acc:MGI:88396])

HSP 1 Score: 121.709 bits (304), Expect = 2.874e-29
Identity = 75/176 (42.61%), Postives = 108/176 (61.36%), Query Frame = 3
Query:  186 ATIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYR 713
            AT+ GN+LVLI+F +   ++T +NYF++SLA  DL+IG  SMNL+T YL++G+W L  L CDLWL+LDY A   S   +L I+ DR+ SV  P +YR  RT  +  +M+ ++WLV   ++   IL W Y    R   A +CY +F S  +      +  F++ + VMC LY  IYR
Sbjct:   38 ATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYR 213          

HSP 2 Score: 94.7449 bits (234), Expect = 2.957e-20
Identity = 43/83 (51.81%), Postives = 56/83 (67.47%), Query Frame = 3
Query: 1299 RARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLL--RGDFRR 1541
            + +KA RT+S IL AF+  WTPY+++VL+  FC  CV + L+ L YWLCY+NS +NP CYAL N   + TF  LL  R D RR
Sbjct:  359 KEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTVNPMCYALCNKAFRDTFRLLLLCRWDKRR 441          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Mouse
Match: Chrm1 (cholinergic receptor, muscarinic 1, CNS [Source:MGI Symbol;Acc:MGI:88396])

HSP 1 Score: 121.709 bits (304), Expect = 2.874e-29
Identity = 75/176 (42.61%), Postives = 108/176 (61.36%), Query Frame = 3
Query:  186 ATIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYR 713
            AT+ GN+LVLI+F +   ++T +NYF++SLA  DL+IG  SMNL+T YL++G+W L  L CDLWL+LDY A   S   +L I+ DR+ SV  P +YR  RT  +  +M+ ++WLV   ++   IL W Y    R   A +CY +F S  +      +  F++ + VMC LY  IYR
Sbjct:   38 ATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYR 213          

HSP 2 Score: 94.7449 bits (234), Expect = 2.957e-20
Identity = 43/83 (51.81%), Postives = 56/83 (67.47%), Query Frame = 3
Query: 1299 RARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLL--RGDFRR 1541
            + +KA RT+S IL AF+  WTPY+++VL+  FC  CV + L+ L YWLCY+NS +NP CYAL N   + TF  LL  R D RR
Sbjct:  359 KEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTVNPMCYALCNKAFRDTFRLLLLCRWDKRR 441          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Mouse
Match: Chrm3 (cholinergic receptor, muscarinic 3, cardiac [Source:MGI Symbol;Acc:MGI:88398])

HSP 1 Score: 120.553 bits (301), Expect = 1.880e-28
Identity = 78/198 (39.39%), Postives = 116/198 (58.59%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKR-------LQASSDKRKGMN 761
            TI GNILV++AF + K ++T +NYF++SLA  DL+IG+ISMNLFT Y+I+  W L  L CDLWLS+DY A   S   +L I+ DR+ S+  P TYR  RT  +  +M+ ++W++   ++   IL W YF   R     EC+ +F S         I  F++ + +M +LY  IY+  ++       LQAS  + +  N
Sbjct:   81 TIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAEAEN 278          

HSP 2 Score: 96.2857 bits (238), Expect = 1.418e-20
Identity = 45/94 (47.87%), Postives = 59/94 (62.77%), Query Frame = 3
Query: 1251 RFTFIHRKDTDVRSRN---RARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLL 1523
            RF    R     R R    + +KA +T+S IL AF+  WTPY+++VL+  FC+SC+    +NL YWLCYINS +NP CYAL N   +TTF  LL
Sbjct:  465 RFALKTRSQITKRKRMSLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNPVCYALCNKTFRTTFKMLL 558          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Mouse
Match: Chrm3 (cholinergic receptor, muscarinic 3, cardiac [Source:MGI Symbol;Acc:MGI:88398])

HSP 1 Score: 120.553 bits (301), Expect = 1.880e-28
Identity = 78/198 (39.39%), Postives = 116/198 (58.59%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKR-------LQASSDKRKGMN 761
            TI GNILV++AF + K ++T +NYF++SLA  DL+IG+ISMNLFT Y+I+  W L  L CDLWLS+DY A   S   +L I+ DR+ S+  P TYR  RT  +  +M+ ++W++   ++   IL W YF   R     EC+ +F S         I  F++ + +M +LY  IY+  ++       LQAS  + +  N
Sbjct:   81 TIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAEAEN 278          

HSP 2 Score: 96.2857 bits (238), Expect = 1.418e-20
Identity = 45/94 (47.87%), Postives = 59/94 (62.77%), Query Frame = 3
Query: 1251 RFTFIHRKDTDVRSRN---RARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLL 1523
            RF    R     R R    + +KA +T+S IL AF+  WTPY+++VL+  FC+SC+    +NL YWLCYINS +NP CYAL N   +TTF  LL
Sbjct:  465 RFALKTRSQITKRKRMSLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNPVCYALCNKTFRTTFKMLL 558          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Mouse
Match: Chrm5 (cholinergic receptor, muscarinic 5 [Source:MGI Symbol;Acc:MGI:109248])

HSP 1 Score: 115.546 bits (288), Expect = 6.242e-27
Identity = 76/186 (40.86%), Postives = 109/186 (58.60%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYR-VAKRLQASSD 743
            TI GN+LV+I+F +   ++T +NY+++SLA  DL+IG+ SMNL+T Y+++G W L  L CDLWL+LDY A   S   +L I+ DR+ S+  P TYR  RT  +  IM+ ++WLV   ++   IL W Y    R     EC  +F S         I  F+I + VM +LY  IYR   KR +  +D
Sbjct:   44 TIVGNVLVMISFKVNSQLKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWVLGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLVSFILWAPAILCWQYLVGKRTVPPDECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLAD 229          

HSP 2 Score: 90.8929 bits (224), Expect = 7.157e-19
Identity = 40/82 (48.78%), Postives = 56/82 (68.29%), Query Frame = 3
Query: 1299 RARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFRRN 1544
            + RKA +T+S IL AF+  WTPY+++VL+  FC+ CV   L++L YWLCY+NS INP CYAL N   + TF  LL   +++ 
Sbjct:  436 KERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLGYWLCYVNSTINPICYALCNRTFRKTFKLLLLCRWKKK 517          
BLAST of Muscarinic acetylcholine receptor M1 vs. UniProt/SwissProt
Match: sp|P30372|ACM2_CHICK (Muscarinic acetylcholine receptor M2 OS=Gallus gallus OX=9031 GN=CHRM2 PE=3 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 6.984e-46
Identity = 135/450 (30.00%), Postives = 211/450 (46.89%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKRKGMNTLLAMAGQTMSRIGVGVSWGNADDLDEIANPTVNFRINEGYDSSNKEYKNDIVIHPTSPYKLNAPPNLVKNLQYIDEHSSDSEEIYVYKSIYYNDYNSKLEPGISEILPLXXXXXXXXXXXXXPTNNTKSMNFXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTRFTFIHRKDTDVRSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFR 1538
            TI GNILV+++  + + ++T +NYF+ SLA  DL+IG+ SMNL+T+Y +IG WPL  ++CDLWL+LDY     S   +L I+ DR+  V  P TY + RT     +M+  +W++   ++   IL W +   GR     +CY +F SN        I  F++ +I+M VLY  I R +K       K    N           +I       N +++   ++   + ++  G  +     +N +          +   ++V +    DE + D+ +I   +  +    NSKL         +     S       PTN T  +                 ++   + +    +  + T    K     SR +  K  RTI  IL AF+  WTPY+V+VLI  FC SC+   ++ + YWLCYINS INP CYAL N+  K TF  LL   ++
Sbjct:   40 TIIGNILVMVSIKVNRHLQTVNNYFLFSLACADLIIGIFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGGRTVPDKDCYIQFFSNPAVTFGTAIAAFYLPVIIMTVLYWQISRASKSRIKKGKKEAAQNQDPVSPSLVQGKI----VKPNNNNIPTSSDGLEHNKVQNGKTTGESVMENCVQGEEKDSSNDSTSVSVVPSNTKEDEAAKDASQISASQD-HLKVENSKLT-------CIRIVTKSQKGDCCAPTNTTVEI---------------VGTNGDEKQNSVARKIVKMTKQPAKKKPPPSREK--KVTRTILAILLAFIITWTPYNVMVLINSFCASCIPGTVWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYK 460          
BLAST of Muscarinic acetylcholine receptor M1 vs. UniProt/SwissProt
Match: sp|Q9N2A7|ACM2_PANTR (Muscarinic acetylcholine receptor M2 (Fragment) OS=Pan troglodytes OX=9598 GN=CHRM2 PE=3 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 2.183e-44
Identity = 143/454 (31.50%), Postives = 223/454 (49.12%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKRKGMNTLLAMAGQTMSRIGVGVSWGNADDLDEIANPTVNFRI----NEGYDSSNKEYKNDIVIHPTSPYKLNAPPNLVKNLQYIDEHSSDSEEIYVYKSIYYNDYNSKLEPGISEILPLXXXXXXXXXXXXXPTNNTKSMNFXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTRFTFIHRKDTDVRSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFR 1538
            TI GNILV+++  + + ++T +NYF+ SLA  DL+IG+ SMNL+T+Y +IG WPL  ++CDLWL+LDY     S   +L I+ DR+  V  P TY + RT     +M+  +W++   ++   IL W +    R     ECY +F SN        I  F++ +I+M VLY  I R +K  +   DK++       +A Q                 D ++   V  RI    N    SS+   +++ + +  +P +     N V+  +   E S+DS  +    S   +D  ++ E  +S  L  +K +NS     +  T   KS +    +         S  +   + ++   +  + T    K     SR   +K  RTI  IL AF+  W PY+V+VLI  FC  C+ + ++ + YWLCYINS INP CYAL N+  K TF  LL   ++
Sbjct:   11 TIIGNILVMVSIKVNRHLQTVNNYFLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQFFSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKS-RIKKDKKE------PVANQ-----------------DPVSPSLVQGRIVKPNNNNMPSSDDGLEHNKIQNGKAP-RDPVTENCVQGEE--KESSNDSTSVSAVASNMRDDEITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKS-DSCTPTNTTVEVVGSSGQNGDEKQNIVARKIVKMTKQPAKKKPPPSRE--KKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNTVWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYK 434          
BLAST of Muscarinic acetylcholine receptor M1 vs. UniProt/SwissProt
Match: sp|P08172|ACM2_HUMAN (Muscarinic acetylcholine receptor M2 OS=Homo sapiens OX=9606 GN=CHRM2 PE=1 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 3.786e-44
Identity = 143/454 (31.50%), Postives = 223/454 (49.12%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKRKGMNTLLAMAGQTMSRIGVGVSWGNADDLDEIANPTVNFRI----NEGYDSSNKEYKNDIVIHPTSPYKLNAPPNLVKNLQYIDEHSSDSEEIYVYKSIYYNDYNSKLEPGISEILPLXXXXXXXXXXXXXPTNNTKSMNFXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTRFTFIHRKDTDVRSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFR 1538
            TI GNILV+++  + + ++T +NYF+ SLA  DL+IG+ SMNL+T+Y +IG WPL  ++CDLWL+LDY     S   +L I+ DR+  V  P TY + RT     +M+  +W++   ++   IL W +    R     ECY +F SN        I  F++ +I+M VLY  I R +K  +   DK++       +A Q                 D ++   V  RI    N    SS+   +++ + +  +P +     N V+  +   E S+DS  +    S   +D  ++ E  +S  L  +K +NS     +  T   KS +    +         S  +   + ++   +  + T    K     SR   +K  RTI  IL AF+  W PY+V+VLI  FC  C+ + ++ + YWLCYINS INP CYAL N+  K TF  LL   ++
Sbjct:   37 TIIGNILVMVSIKVNRHLQTVNNYFLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQFFSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKS-RIKKDKKE------PVANQ-----------------DPVSPSLVQGRIVKPNNNNMPSSDDGLEHNKIQNGKAP-RDPVTENCVQGEE--KESSNDSTSVSAVASNMRDDEITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKS-DSCTPTNTTVEVVGSSGQNGDEKQNIVARKIVKMTKQPAKKKPPPSRE--KKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNTVWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYK 460          
BLAST of Muscarinic acetylcholine receptor M1 vs. UniProt/SwissProt
Match: sp|P06199|ACM2_PIG (Muscarinic acetylcholine receptor M2 OS=Sus scrofa OX=9823 GN=CHRM2 PE=1 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 1.740e-43
Identity = 142/454 (31.28%), Postives = 223/454 (49.12%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKRKGMNTLLAMAGQTMSRIGVGVSWGNADDLDEIANPTVNFRI----NEGYDSSNKEYKNDIVIHPTSPYKLNAPPNLVKNLQYIDEHSSDSEEIYVYKSIYYNDYNSKLEPGISEILPLXXXXXXXXXXXXXPTNNTKSMNFXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTRFTFIHRKDTDVRSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFR 1538
            TI GNILV+++  + + ++T +NYF+ SLA  DL+IG+ SMNL+T+Y +IG WPL  ++CDLWL+LDY     S   +L I+ DR+  V  P TY + RT     +M+  +W++   ++   IL W +    R     ECY +F SN        I  F++ +I+M VLY  I R +K  +   DK++       +A Q                 + ++   V  RI    N     S++  +++ + +  +P +     N V+  +   E S+DS  +    S   +D  ++ E  +S  L  +K +NS     K  T   KS +    +         S  +   + ++   +  + T    K     SR +  K  RTI  IL AF+  W PY+V+VLI  FC  C+ + ++ + YWLCYINS INP CYAL N+  K TF  LL   ++
Sbjct:   37 TIIGNILVMVSIKVNRHLQTVNNYFLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQFFSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKS-RIKKDKKE------PVANQ-----------------EPVSPSLVQGRIVKPNNNNMPGSDEALEHNKIQNGKAP-RDAVTENCVQGEE--KESSNDSTSVSAVASNMRDDEITQDENTVSTSLGHSKDENSKQTCIKIVTKTQKS-DSCTPANTTVELVGSSGQNGDEKQNIVARKIVKMTKQPAKKKPPPSREK--KVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNTVWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYK 460          
BLAST of Muscarinic acetylcholine receptor M1 vs. UniProt/SwissProt
Match: sp|Q09388|ACM2_CAEEL (Muscarinic acetylcholine receptor gar-2 OS=Caenorhabditis elegans OX=6239 GN=gar-2 PE=2 SV=3)

HSP 1 Score: 161.384 bits (407), Expect = 1.558e-41
Identity = 106/234 (45.30%), Postives = 143/234 (61.11%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGN-WPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYF-NNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKRKGMNTLLAMAGQTMSRIGVGVSWGNA-----DDLDEIANPTVNFR 869
            T+ GN+ VL+++ L+K+IR P+NYFI SLA +DLLIGL  + ++T + +  N W    +LCDLWLS+DY  CL S YTVL ITVDR+ SVK PATYR WRT  +V+++++  WLVPS +F   I G+  F   GR    TECY +F +N   N  + I Y+W TL VM  LY GIYR AK+L   SD++     LL      M R  V V   +A     D  ++ +N +  FR
Sbjct:   19 TVIGNLAVLLSYYLDKNIRQPTNYFIFSLAISDLLIGLEGIPVYTAFYLNNNEWIWGDVLCDLWLSIDYIVCLASIYTVLGITVDRYYSVKKPATYRNWRTPGRVVLIIIFIWLVPSILFSVSIFGYGTFTGTGRILKETECYVQFMTNPYLNMGMYISYYWTTLFVMLYLYWGIYRAAKKLALKSDQKTKRLALLT----EMRRPEVSVRTSDAGNSSSDSPNDTSNSSKCFR 248          

HSP 2 Score: 124.79 bits (312), Expect = 6.160e-29
Identity = 55/98 (56.12%), Postives = 71/98 (72.45%), Query Frame = 3
Query: 1260 FIHRKDTDVRSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVN----DHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFRR 1541
            F  +K+   RS NRARKALRTI+ ILG+F+  WTP++VL  I GFC +C      + LY +SY+LCY+NSP+NPFCYA+AN Q K T  R+ +GDFRR
Sbjct:  529 FQRKKEYKSRSENRARKALRTITFILGSFIILWTPFYVLATIYGFCETCKASPSFNTLYTISYYLCYMNSPLNPFCYAMANQQFKKTLTRIFKGDFRR 626          
BLAST of Muscarinic acetylcholine receptor M1 vs. TrEMBL
Match: A0A193KUM6 (GCR043 OS=Schmidtea mediterranea OX=79327 GN=gcr043 PE=2 SV=1)

HSP 1 Score: 826.624 bits (2134), Expect = 0.000e+0
Identity = 477/489 (97.55%), Postives = 482/489 (98.57%), Query Frame = 3
Query:   81 MEFLNGTLNAQSPRNDXXXXXXXXXXXXXXXXXXXATIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKRKGMNTLLAMAGQTMSRIGVGVSWGNADDLDEIANPTVNFRINEGYDSSNKEYKNDIVIHPTSPYKLNAPPNLVKNLQYIDEHSSDSEEIYVYKSIYYNDYNSKLEPGISEILPLXXXXXXXXXXXXXPTNNTKSMNFXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTRFTFIHRKDTDVRSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFRRNW 1547
            MEFLNGTLNAQSPRNDSLSIPIIFLIVVSSSVASLATIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPLSQLLCDLWLSLDYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFW+TLIVMCVLYAGIYRVAKRLQASSDKRKGMNTLLAMAGQTMSRIGVGVSWGNADDLDEIANPTVNFRINEGYDSSNKEYKNDIVIHPTSPYKLNAPPNLVKNLQYIDEHSSDSEEIY+YKSIYYNDYNSKLEPGISEILPL     +N  ++KKPTNNTKSMNFQIKSAKQQSKKYQSSSSNSNQTSLQRLQFTRFTFIHRKDTDVRSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFRRNW
Sbjct:    1 MEFLNGTLNAQSPRNDSLSIPIIFLIVVSSSVASLATIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPLSQLLCDLWLSLDYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWVTLIVMCVLYAGIYRVAKRLQASSDKRKGMNTLLAMAGQTMSRIGVGVSWGNADDLDEIANPTVNFRINEGYDSSNKEYKNDIVIHPTSPYKLNAPPNLVKNLQYIDEHSSDSEEIYIYKSIYYNDYNSKLEPGISEILPL-NKSKNNNYKQKKPTNNTKSMNFQIKSAKQQSKKYQSSSSNSNQTSLQRLQFTRFTFIHRKDTDVRSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFRRNW 488          
BLAST of Muscarinic acetylcholine receptor M1 vs. TrEMBL
Match: A0A193KUH8 (GCR062 OS=Schmidtea mediterranea OX=79327 GN=gcr062 PE=2 SV=1)

HSP 1 Score: 400.979 bits (1029), Expect = 2.024e-131
Identity = 241/469 (51.39%), Postives = 304/469 (64.82%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKR-KGMNTLLAMAGQTMSRIGVGVSWGNADDLDEIANPTVNFRINEGY----DSSNKEYKNDI---VIHPTSPYKLNAPPNLVKNLQYIDE-----HSSDSEEIYVYKSIYYNDYNSKLEPGISEILPLXXXXXXXXXXXXXPTNNTKSMNFXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTRFTFIHRKDTDV-RSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNS----CVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFRR 1541
            TI GNILV+ AF LEK +R   NYFI+SLA+TDLLIGL SMNLFT+YL++G WPL Q LCDLWLS+DYTACLTSQ TVL ITVDR+CSVKIP  YR WRT +KVIIMV I+WLVPS +FFT ILGWP F   R+R   EC+A+FTS  VFNT+LT+ YFW+ L +M  LY GIY VA  LQ  SD+R K M TL+AMAGQTMSRIGVGV+W N +  +     + N+   E +     +++K   ND+   +   TS  KL + P+  K ++++D      H  D EE     S    +  +       +  P   +  ++ +    P N + S  F                S+S    L++  + +F    +++  + RS NRARKA RTISLILGAF+ CWTPYHVLV+IKGFC +    CVNDHLYN+SYWLCY+NSPINPFCYALAN Q K TF+RL++GD  R
Sbjct:   43 TIAGNILVITAFALEKKLRVIGNYFIVSLAATDLLIGLFSMNLFTVYLLLGCWPLGQFLCDLWLSVDYTACLTSQCTVLSITVDRYCSVKIPNIYRSWRTGSKVIIMVAIAWLVPSILFFTAILGWPLF-TIRKRLIHECFADFTSQPVFNTLLTVGYFWVPLFIMLFLYYGIYNVACNLQKKSDERHKKMTTLMAMAGQTMSRIGVGVNWNNNESENHPRKDSGNYLQTEKHPTCSSNAHKALPNDLDFKMKSNTSETKLYSSPDSGKCIEFMDNEEIKLHQLDREENQAESSSQNTESQTHEGNKFPDKSP--TTYITDSESGAGPVNQSISAAF----------------SSSLMGVLKKPYYNKFVKRSKRNKTISRSENRARKAFRTISLILGAFLACWTPYHVLVMIKGFCYNRSEICVNDHLYNISYWLCYMNSPINPFCYALANIQFKRTFIRLMKGDLHR 492          
BLAST of Muscarinic acetylcholine receptor M1 vs. TrEMBL
Match: A0A193KUK5 (GCR013 OS=Schmidtea mediterranea OX=79327 GN=gcr013 PE=2 SV=1)

HSP 1 Score: 372.474 bits (955), Expect = 5.282e-120
Identity = 231/502 (46.02%), Postives = 310/502 (61.75%), Query Frame = 3
Query:  186 ATIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSD-KRKGMNTLLAMAGQTMSRIGVGVSWGNADDLDEIANPTVNFRINEGY-------------DSSNKEYK-----------NDIVIHPTSPY---------KLNAPP--------NLVKNLQYIDEHSS-DSEEIYVY--KSIYYNDYNSKLEPGISEILPLXXXXXXXXXXXXXPTNNTKSMNFXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTRFTFIHRKDTDVRSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFCN----SCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFRRN 1544
             T+ GN L++ AF++EK IR PSNYFI SLA TD+LIGL SMNLF+IY+++G WPL  +LC++WLS DYT CLTSQYTVL ITVDR+CSVKIPA YR+WRT+ KV ++++++W++P+ +F T I+ W   +      + +C+AEFT   +FNTV TI YFWITLI+MCVLY GIYRVA+RL  +SD KRK + +L+A AGQTMS+IGVG+S  N D   +  N   +   NE               DSS   Y            N ++I+   P           L   P        NL +++QYIDE SS DS+  Y +   + Y N YN          LP      S    K    NN +              KY+S  +  ++++L+ ++F +      K  D+R+ ++A+K+L+TIS ILGAF+ CWTPYHVL+LIKGFC+    SC+ND LYN SYWLCYINSPINPFCYAL+NSQ K T ++L++GDF R+
Sbjct:   33 GTVFGNGLIITAFIMEKKIRIPSNYFIASLAITDILIGLFSMNLFSIYVVLGYWPLGYILCNIWLSFDYTVCLTSQYTVLLITVDRYCSVKIPAKYRIWRTEKKVYLLIVLAWIIPACLFITIIIIWNCRSQSPSVDSQQCFAEFTLYPIFNTVFTIAYFWITLIIMCVLYIGIYRVARRLHQNSDTKRKRLTSLMATAGQTMSKIGVGLSLANLDVNVQFKNFLKDNPFNETTTERNLLNDNCLYPDSSRNNYSISSRVSPSEETNSLMINNIFPKSHSETLFTDSLRFSPKSNKDKCLNLFEDIQYIDEDSSGDSKTNYEFNISNFYTNRYN----------LPSINISQSEVHGKFHLENNRE-------------IKYKSWDNTVSKSALKAMRFLKSVHNMSKRIDIRNHSKAKKSLKTISFILGAFIICWTPYHVLILIKGFCDNPPKSCINDVLYNASYWLCYINSPINPFCYALSNSQFKKTLLKLIKGDFSRS 511          
BLAST of Muscarinic acetylcholine receptor M1 vs. TrEMBL
Match: A0A193KU58 (GCR010 OS=Schmidtea mediterranea OX=79327 GN=gcr010 PE=2 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 3.884e-81
Identity = 149/245 (60.82%), Postives = 186/245 (75.92%), Query Frame = 3
Query:  186 ATIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSD-KRKGMNTLLAMAGQTMSRIGVGVSWGNADDLDEIAN---PTVNFRINE---GYDSSNK 899
            AT+ GN+LV+ +F +E+++R P+NYFI SLA TDLLIG+ SMN +TIYL++  WPL ++ CDLWLSLDYTACLTSQYTV FITVDRFCSV IPA YR WRT NKV+IMV  +W++PSSIFFTCILGWP+F   R     EC+A F ++  FNT+LTI YFW+TLIVMC LY GIY VA  LQ  SD KR+ M +L++MAGQTMSRIGVG++  N ++ DEI +   PT N  ++E   G D+  K
Sbjct:   46 ATVAGNLLVITSFFVERALRNPTNYFIASLAVTDLLIGIFSMNFYTIYLLLNYWPLGEMFCDLWLSLDYTACLTSQYTVFFITVDRFCSVHIPAKYRNWRTDNKVLIMVAATWIIPSSIFFTCILGWPFFTGKRGCPQNECWAGFQTDVFFNTILTIGYFWLTLIVMCSLYGGIYHVALNLQRKSDAKRRKMTSLVSMAGQTMSRIGVGMT--NDENEDEIFDHRKPTNNMVLDEMTPGEDNPKK 288          

HSP 2 Score: 143.665 bits (361), Expect = 1.070e-32
Identity = 63/85 (74.12%), Postives = 72/85 (84.71%), Query Frame = 3
Query: 1287 RSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFRR 1541
            R+ NRARKALRTI+LILGAFV CWTP+H+LVL+KG+    VN H +NLSYWLCY NSPINPFCYALAN+Q K  F+RLLRGDF R
Sbjct:  619 RTENRARKALRTITLILGAFVICWTPFHILVLLKGYYPDLVNVHFFNLSYWLCYANSPINPFCYALANAQFKKAFLRLLRGDFHR 703          
BLAST of Muscarinic acetylcholine receptor M1 vs. TrEMBL
Match: A0A193KUP4 (GCR071 OS=Schmidtea mediterranea OX=79327 GN=gcr071 PE=2 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 1.330e-72
Identity = 132/219 (60.27%), Postives = 169/219 (77.17%), Query Frame = 3
Query:  186 ATIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNN-GRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSD-KRKGMNTLLAMAGQTMSRIG-VGVSWGNADD 833
            +TI GN+LV+++F  E+++RT +NYFI SLA TDLLIG+ SMN +T+YL++  WPL +L CDLWLSLDYTACLTSQYTV FITVDRFCSVKIPA YR WRT++KV +MV I+W+VP ++FFT I+GWPYFNN GR R   +CYAEF    +FNT+LTI YFWITL+VM +LYAGIY+VA  LQA SD K+K ++ L+  + + M+     G+   NA  
Sbjct:   36 STIMGNLLVIVSFFFERALRTSTNYFIASLAVTDLLIGVFSMNFYTVYLLLSYWPLGELFCDLWLSLDYTACLTSQYTVFFITVDRFCSVKIPAKYRNWRTESKVRLMVAITWIVPFAVFFTTIMGWPYFNNQGRIREPDQCYAEFAKEPIFNTILTIAYFWITLMVMVILYAGIYKVALNLQAKSDHKKKRISELIPSSSKRMTETSESGIRTSNASQ 254          

HSP 2 Score: 143.28 bits (360), Expect = 1.117e-33
Identity = 67/99 (67.68%), Postives = 79/99 (79.80%), Query Frame = 3
Query: 1272 KDTDVRSR--NRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNS------CVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFRRN 1544
            K T  R R  +RARKALRTI+ ILGAFV  WTP+H++VLIKGFC+S      CVN HLYNL+YWLCY+NSPINPFCYALAN Q K TF+R+L+ DFRR+
Sbjct:  337 KSTKRRERTVSRARKALRTITFILGAFVLSWTPFHIIVLIKGFCDSTKDKHTCVNSHLYNLTYWLCYLNSPINPFCYALANVQFKRTFLRILKFDFRRS 435          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Cavefish
Match: chrm2a (cholinergic receptor muscarinic 2 [Source:NCBI gene;Acc:103039136])

HSP 1 Score: 120.168 bits (300), Expect = 8.869e-29
Identity = 79/203 (38.92%), Postives = 119/203 (58.62%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAK-RLQASSDKRKGMNTLLAMAGQTMS 794
            T+ GNILV+++  + +S++T +NYF+ SLA  DL+IGL SMNL+T+Y++IG WPL  ++CDLWL+LDY     S   +L I+ DR+  V  P +Y + RT     +M+  +W++   ++   IL W +   GR     ECY +F SN        I  F++ +I+M VLY  I R +K R++  + K  G N   A   QT S
Sbjct:   47 TVIGNILVMLSIKVNRSLQTVNNYFLFSLACADLIIGLCSMNLYTVYIVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLSYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGGRTVPEQECYIQFFSNAAVTFGTAIAAFYLPVIIMMVLYWQISRASKSRVKKDNRKPSGANVGPASPSQTRS 249          

HSP 2 Score: 95.1301 bits (235), Expect = 2.200e-20
Identity = 43/81 (53.09%), Postives = 56/81 (69.14%), Query Frame = 3
Query: 1296 NRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFR 1538
            +R +K  RTI  IL AFV  WTPY+V+VLI  FC+SC+ + ++ + YWLCYINS INP CYAL N+  K TF  LL   ++
Sbjct:  409 SREKKVTRTIMAILVAFVATWTPYNVMVLINTFCSSCIPNTVWTIGYWLCYINSTINPACYALCNATFKKTFKHLLLCQYK 489          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Cavefish
Match: chrm3b (cholinergic receptor, muscarinic 3b [Source:ZFIN;Acc:ZDB-GENE-090410-5])

HSP 1 Score: 117.857 bits (294), Expect = 2.538e-28
Identity = 81/227 (35.68%), Postives = 124/227 (54.63%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKRKGMNTLLAMAGQTMSRIGVGVSWGNADDLDEIANPTVNFR 869
            TI GNILVL++F + K ++T +NY+++SLA  DL+IG++SMNL+T YLI+G W L    CDLWL++DY A   S   +L I+ DR+ SV  P TYR  RT  + + M+ ++W +   ++   IL W +F   R     ECY +F S  +      I  F++ + +M VLY  IY+       + ++ K +  L     Q     G   + GN ++   +  PT   R
Sbjct:   40 TIIGNILVLVSFKVNKQLKTVNNYYLLSLAFADLIIGVLSMNLYTTYLIMGKWALGNWACDLWLAIDYVASNASVMNLLVISFDRYFSVTRPLTYRAKRTTKRAMTMIGLAWSISFVLWAPAILFWQFFVGERTVLPGECYIQFLSEPIITFCTAIAAFYLPVTIMTVLYWRIYK------ETENRSKDLAGLKGSGNQ-----GKQGNQGNQEEATAMMPPTGTSR 255          

HSP 2 Score: 90.8929 bits (224), Expect = 3.208e-19
Identity = 40/93 (43.01%), Postives = 57/93 (61.29%), Query Frame = 3
Query: 1260 FIHRKDTDVRSRNR-----ARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLL 1523
            F  +  T    R +      +KA +T+S IL AF+  WTPY+++VL+  FC+ C+   L+ L YWLCY+NS +NP CYAL N   +TTF  +L
Sbjct:  297 FASKAKTQANKRKKMSLVKEKKAAQTLSAILFAFIITWTPYNIMVLVNTFCDDCIPATLWALGYWLCYVNSTVNPMCYALCNKTFRTTFKMIL 389          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Cavefish
Match: chrm5a (muscarinic acetylcholine receptor M5 [Source:NCBI gene;Acc:103025843])

HSP 1 Score: 115.931 bits (289), Expect = 3.304e-27
Identity = 75/191 (39.27%), Postives = 113/191 (59.16%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKRKGMN 761
            TI GN+LV+++F +   ++T +NY+++SLA  DL+IG+ SMNL+T Y+++G W L  L CDLWL+LDY A   S   +L I+ DR+ S+  P TYR  RT  +  IM+ ++WLV   ++   IL W YF   R     +C  +F S  V      I  F+I + VM +LY  IY+  +R      + +G+N
Sbjct:   42 TIIGNVLVMVSFKVNSQLKTVNNYYLLSLAFADLIIGVFSMNLYTSYILMGYWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPRRAGIMIGLAWLVSFVLWAPPILCWQYFVGKRTVPERQCQIQFFSEPVITFGTAIAAFYIPVSVMTILYCRIYKETERRTKDLAELQGVN 232          

HSP 2 Score: 92.0485 bits (227), Expect = 2.536e-19
Identity = 39/82 (47.56%), Postives = 56/82 (68.29%), Query Frame = 3
Query: 1299 RARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFRRN 1544
            + RKA +T+S IL AF+  WTPY+++VLI  FC+ C+   L++L YWLCY+NS +NP CYAL N   + TF  LL   +++ 
Sbjct:  421 KERKAAQTLSAILLAFILTWTPYNIMVLISTFCSDCIPLSLWHLGYWLCYVNSTVNPMCYALCNKNFQKTFRMLLLCQWKKK 502          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Cavefish
Match: chrm2b (muscarinic acetylcholine receptor M2-like [Source:NCBI gene;Acc:103021745])

HSP 1 Score: 113.235 bits (282), Expect = 1.317e-26
Identity = 71/188 (37.77%), Postives = 112/188 (59.57%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKRK 752
            TI GN+LV+++  + K+++  +NYF+ SLA  DL+IGL SMNL+T+Y++ G WPL  ++CDLWL+LDY A   S   +L I+ DR+  V  P TY + RT     +M+ ++W++   ++   IL W +F   R     ECY +F SN V      I  F++ +++M VLY  I + ++      + RK
Sbjct:   38 TIIGNVLVMVSIKVNKNLQMVNNYFLFSLACADLIIGLFSMNLYTVYIVTGYWPLGPVVCDLWLALDYVASNASVMNLLIISFDRYFCVTKPLTYPVKRTTKMAGVMIAVAWILSFILWAPAILFWQFFVGERTVEKRECYIQFFSNPVVTFGTAIAAFYLPVVIMSVLYWQISKASRSRIKRRESRK 225          

HSP 2 Score: 99.3673 bits (246), Expect = 7.490e-22
Identity = 46/91 (50.55%), Postives = 60/91 (65.93%), Query Frame = 3
Query: 1266 HRKDTDVRSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFR 1538
            H+K  + R  +R RK  RTI  IL AFV  WTPY+V+VLI  FC SC+ + ++ + YWLCYINS +NP CYAL N   K TF +LL   ++
Sbjct:  364 HKKKRN-RCSSRERKVTRTIMAILVAFVATWTPYNVMVLISTFCRSCIPNSMWAMGYWLCYINSTVNPACYALCNVTFKNTFKQLLMCKYK 453          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Cavefish
Match: chrm2b (muscarinic acetylcholine receptor M2-like [Source:NCBI gene;Acc:103021745])

HSP 1 Score: 113.235 bits (282), Expect = 1.317e-26
Identity = 71/188 (37.77%), Postives = 112/188 (59.57%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKRK 752
            TI GN+LV+++  + K+++  +NYF+ SLA  DL+IGL SMNL+T+Y++ G WPL  ++CDLWL+LDY A   S   +L I+ DR+  V  P TY + RT     +M+ ++W++   ++   IL W +F   R     ECY +F SN V      I  F++ +++M VLY  I + ++      + RK
Sbjct:   38 TIIGNVLVMVSIKVNKNLQMVNNYFLFSLACADLIIGLFSMNLYTVYIVTGYWPLGPVVCDLWLALDYVASNASVMNLLIISFDRYFCVTKPLTYPVKRTTKMAGVMIAVAWILSFILWAPAILFWQFFVGERTVEKRECYIQFFSNPVVTFGTAIAAFYLPVVIMSVLYWQISKASRSRIKRRESRK 225          

HSP 2 Score: 99.3673 bits (246), Expect = 7.490e-22
Identity = 46/91 (50.55%), Postives = 60/91 (65.93%), Query Frame = 3
Query: 1266 HRKDTDVRSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFR 1538
            H+K  + R  +R RK  RTI  IL AFV  WTPY+V+VLI  FC SC+ + ++ + YWLCYINS +NP CYAL N   K TF +LL   ++
Sbjct:  364 HKKKRN-RCSSRERKVTRTIMAILVAFVATWTPYNVMVLISTFCRSCIPNSMWAMGYWLCYINSTVNPACYALCNVTFKNTFKQLLMCKYK 453          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Sea Lamprey
Match: chrm5b (cholinergic receptor, muscarinic 5b [Source:ZFIN;Acc:ZDB-GENE-041001-169])

HSP 1 Score: 117.472 bits (293), Expect = 1.731e-28
Identity = 72/195 (36.92%), Postives = 113/195 (57.95%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKR-------LQASSDKRK 752
            T+ GN LV+++F + + ++T SNYF++SLA+ DL++GL SMNL+T Y++ G W +  ++CDLWL+LDY A   S   +L I+ DR+ S+  P  Y+  RTK +  IM+ ++W V   ++   IL W +    R     +CY +F S  +      I  F++ + +M VLY  IYR  +R       LQ S  K +
Sbjct:   44 TVVGNTLVMLSFRVSRQLKTVSNYFLLSLAAADLIVGLFSMNLYTAYILTGRWAMGAVMCDLWLTLDYVASNASVMNLLAISFDRYFSITRPLKYKAKRTKRRASIMIGLAWAVSLVLWAPAILFWQHMVGKRTVPQDQCYIQFLSEPIITFGTAIAAFYLPITIMMVLYWRIYRETRRRSRQFATLQGSESKSR 238          

HSP 2 Score: 88.1965 bits (217), Expect = 7.246e-19
Identity = 37/75 (49.33%), Postives = 51/75 (68.00%), Query Frame = 3
Query: 1299 RARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLL 1523
            R  KA+R +  IL AF+  WTPY+++VL+  FC+ CV   L++L YWLCY+NS +NP CYAL N   + TF  +L
Sbjct:  442 RDNKAVRILCAILLAFIVTWTPYNIMVLVSTFCDDCVPKKLWHLGYWLCYVNSTVNPMCYALCNMHFRKTFKTIL 516          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Sea Lamprey
Match: CHRM3 (cholinergic receptor muscarinic 3 [Source:HGNC Symbol;Acc:HGNC:1952])

HSP 1 Score: 115.546 bits (288), Expect = 9.359e-28
Identity = 72/182 (39.56%), Postives = 110/182 (60.44%), Query Frame = 3
Query:  186 ATIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQ 731
            ATI GN+LVL++F + K + T +NY+++SLA  DL+IG+ SMNLFT Y+I+G+W L  L CDLWL+LDY A   S   +L I+ DRF S+  P TYR  RT ++  +++ ++W+V   ++   IL W Y    R     EC  +F S  +      I  F++ + +M  +Y   +R+ K +Q
Sbjct:   73 ATIVGNVLVLVSFKVNKQLHTVNNYYLLSLAVADLIIGIFSMNLFTCYMIMGHWALGSLACDLWLALDYVASNASVMNLLVISFDRFFSITRPLTYRAKRTPHRAALLIGLAWVVSFVLWAPAILFWQYIVGERTVPPDECRIQFLSEPIITFCTAIAAFYLPVTIMATIY---WRIFKEIQ 251          

HSP 2 Score: 90.5077 bits (223), Expect = 1.591e-19
Identity = 46/96 (47.92%), Postives = 61/96 (63.54%), Query Frame = 3
Query: 1251 RFTFIHRKDTDVRSRNR-----ARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLL 1523
            RFT    K  +V +R R      +KA RT+S IL AF+  WTPY+++VL+  FC  CV   L+N+ YWLCY+NS +NP CYAL N   + TF +LL
Sbjct:  446 RFTSAALK-VNVTARKRMSLIKEKKAARTLSAILLAFIITWTPYNIMVLMSTFCPECVPPVLWNIGYWLCYVNSTVNPVCYALCNRIFRKTFRQLL 540          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Sea Lamprey
Match: CHRM3 (cholinergic receptor muscarinic 3 [Source:HGNC Symbol;Acc:HGNC:1952])

HSP 1 Score: 113.235 bits (282), Expect = 5.336e-27
Identity = 69/174 (39.66%), Postives = 105/174 (60.34%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIY 710
            TI GNILV++AF + + ++T +NYF++SLA  DL+IG++SMNL+T Y+I+  W L Q  CDLWL +DY A   S   +L I+ DR+ S+  P  Y+  RT  +V +M+ ++W+V   ++   IL W Y +  R     EC+ +F S         I  F++ + +M VLY  IY
Sbjct:   26 TIVGNILVMVAFKVNRQLKTVNNYFLLSLAVADLIIGVVSMNLYTTYIIMSRWALGQAACDLWLVVDYVASNASVMNLLVISFDRYLSITRPLKYKAKRTTKRVALMIGLAWVVSLVLWGPAILFWQYVDGKRTVPDNECFIQFLSVPAITFGTAIAAFYLPVTIMMVLYWRIY 199          

HSP 2 Score: 60.4622 bits (145), Expect = 4.538e-10
Identity = 24/56 (42.86%), Postives = 35/56 (62.50%), Query Frame = 3
Query: 1374 LVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFRR 1541
            L+L+  FC++C+    + L YWLCY+NS +NP CYAL N   + TF  +L   + R
Sbjct:  438 LILVSTFCDNCIPKVWWRLGYWLCYVNSTVNPMCYALCNKTFRKTFKWILLCQWER 493          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006872.1 (pep scaffold:Pmarinus_7.0:GL476537:253210:263579:1 gene:ENSPMAG00000006208.1 transcript:ENSPMAT00000006872.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.5077 bits (223), Expect = 3.232e-20
Identity = 66/185 (35.68%), Postives = 101/185 (54.59%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVII-MVLISWLVPSSIFFTCIL-GWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQAS 737
            T+ GN++V +  +LEK +RT +  FI+SLA+ DLL+  + M    IY + G W   ++ C +W+S D   C  S  T+ FI++DR+CSV  P  Y L +   K+ + M    W+  S I F  ++ GW          + EC   F +N  F  V + + F+I  +VMC +Y  IYR A RL+A+
Sbjct:   32 TLLGNLVVFVCPVLEKRLRTVTYMFIMSLATADLLVACLVMPFSIIYEVTGRWMFGRIFCKVWISFDVMFCTASIVTLCFISLDRYCSVSAPHRYTLPKEPKKICVAMTAAIWVYSSLISFLPVMRGWNEIPGLDFDSSRECV--FVTNRTFAVVASALAFYIPFLVMCTMYFFIYR-ASRLKAA 213          

HSP 2 Score: 51.6026 bits (122), Expect = 2.095e-7
Identity = 30/91 (32.97%), Postives = 44/91 (48.35%), Query Frame = 3
Query: 1266 HRKDTDVRSRNRARKALRTISLILGAFVTCWTPYHVL-VLIKGFCNSCVNDHLYNLSY----WLCYINSPINPFCYALANSQIKTTFMRLL 1523
            H K     +     KA RT+S+I+ AFV CW PY    V I  + N+  + H+  +++    WL Y NS INP  YA  N   +    ++ 
Sbjct:  225 HPKSRRPNNLQLEHKATRTMSIIISAFVLCWLPYFFFNVFIGFYSNNEDSAHVVQMAFKVITWLGYCNSAINPMLYAFLNRDFQHALRKIF 315          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Sea Lamprey
Match: chrm4a (cholinergic receptor, muscarinic 4a [Source:ZFIN;Acc:ZDB-GENE-090410-6])

HSP 1 Score: 90.1225 bits (222), Expect = 1.638e-19
Identity = 40/81 (49.38%), Postives = 55/81 (67.90%), Query Frame = 3
Query: 1284 VRSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLR 1526
             R+R R RK  RT++ +L AF+  WTPY+V+VL+  FC  CV    + L YWLCY+NS +NP CYAL   + K TF++L+R
Sbjct:  381 ARAR-RERKLTRTVAAVLLAFIVTWTPYNVMVLLAVFCTDCVPHAAWELGYWLCYVNSAVNPACYALCIREFKRTFLQLMR 460          

HSP 2 Score: 89.7373 bits (221), Expect = 1.979e-19
Identity = 83/249 (33.33%), Postives = 126/249 (50.60%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAK-RLQAS---SDKRKGMNTLLAMA-------GQTMSRIGVGVSWGNADDLDEIANPTVNFRIN-EGYDSSNK 899
            T+ GN LV+I+  + + ++T ++YFI SLA  DL+IG  SMN++ +Y+  G WPL   LCDLWLS+DY A   S   +L I+ DRF  V  P TY   RT     I++  +WL+   ++   I+ W +    R      CY +F SN        I  F++ + VMC+LY  I R ++ R+Q       + +G   L+A A       G   SR   G +    D   E A P+    ++  G+D + +
Sbjct:   48 TVLGNALVIISICVNRRLQTVNSYFIFSLACADLIIGAFSMNVYAVYVWRGAWPLGAALCDLWLSIDYVASNASVMNLLIISCDRFLCVSRPHTYPARRTARAAAIVIAAAWLLSLLLWAPAIVLWQFVEGVRTVPQDACYIQFFSNPAATLGTAIAAFYLPVAVMCILYLYILRASRCRVQPGERPQQRPQGPVRLMASAKVLFQWPGDGRSR-SAGSAASERDAEGERAAPSARLELHAAGHDGAAQ 295          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Nematostella
Match: EDO43835 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXF3])

HSP 1 Score: 67.3958 bits (163), Expect = 3.715e-12
Identity = 65/249 (26.10%), Postives = 118/249 (47.39%), Query Frame = 3
Query:  186 ATIGGNILVLIAFLLEKSIR-TPSNYFIISLASTDLLIGLISMNLFTIYLII-GNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIP-ATYRL--WRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAK-RLQASSDKRKGMNTLLAMAGQTMSRIGVGVSWGNADDLDEIANPTVNFRINEGYDSSNKEYKND 914
            ATI GN+LV  A ++  ++R   S+YFI+SLA +DL     SM     YLI  G WP  +  C +W ++   A  TS   +L +++DR+ ++K P   +R   + TK + +I +L+ W    +     I G  ++ +   +G       F    +++ V + V F + +++MC +Y  I+R+A  + +  S  ++ M+       Q M    +     +  D +++     N R +    S  K  K +
Sbjct:    9 ATIVGNLLVCAAVVVNANLRHVVSSYFIVSLAISDLATACFSMPFDMEYLITSGLWPRGEDFCIVWTTVYMIAIPTSILNLLVLSIDRYKTLKDPWDRFRESPFITKRRAVIAILVLWGYSLAFALVPITGVKHYPSSLYQGT----CIFNMAPIYSVVGSFVNFVLPMLIMCCMYYKIFRIAHTKYRMPSRPKRDMH-------QVMQLPAMNEESKSPPDAEKVPPAVNNIRNSTKLRSRKKSAKKN 246          

HSP 2 Score: 51.9878 bits (123), Expect = 3.272e-7
Identity = 27/94 (28.72%), Postives = 50/94 (53.19%), Query Frame = 3
Query: 1260 FIHRKDTDVRSRN---RARKALRTISLILGAFVTCWTPYHVLVLIKGF----CNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRL 1520
            F   +D  +R +    +  KA RTIS+I+GAF+ CW P+ +  ++       C   V  H++++   + YINS +NP  ++  N Q +  + ++
Sbjct:  267 FGSMEDLTIRRKKYFVKNAKAARTISVIVGAFLLCWGPFVLFSIVMNICWMPCAMAVPYHVHHVFLLMGYINSMVNPLLFSYQNHQFRKAYWKI 360          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Nematostella
Match: EDO33324 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSI2])

HSP 1 Score: 65.855 bits (159), Expect = 6.217e-12
Identity = 50/185 (27.03%), Postives = 86/185 (46.49%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWL------VPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKR 725
            ++ GN+LV  A    + +RT SN F+++LA++D L+  + M      LI G W   +  C       +   L S  T+ F+ V+RF  +  PA Y++  +K K  I +LI W       +P   F++   G+ +     Q G   C   F SN  +   L  ++  + L ++   Y  ++R  +R
Sbjct:   19 SLTGNLLVFSAVYRNRRLRTISNMFVVTLAASDALMASLCMPYSLGTLIHGRWIFGERFCQAQGFFAFNLGLASLNTMFFVAVNRFFCIVKPAKYQIRFSKGKTRIYLLIIWFNSFAGSIPPLFFYSG--GYDF-----QPGKAMCLYRFESNIPYTVFLEALFIGLPLNIIAFCYLSVFREVRR 196          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Nematostella
Match: EDO43118 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZL7])

HSP 1 Score: 65.855 bits (159), Expect = 7.277e-12
Identity = 54/181 (29.83%), Postives = 90/181 (49.72%), Query Frame = 3
Query:  186 ATIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGN-WPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKR 725
             TI GN LV+ +F+    IRT +N+F++SLA TDL + L SM L+  Y++ G  W  + +L  +W ++D      S   ++ I++DRF  +  P  Y  + T  +V   +   W+    +     L W Y                    +FN + +IVYFW+ L+++   Y+ ++RVA R
Sbjct:   31 GTITGNALVIASFIAYSRIRTATNFFVVSLACTDLGVALFSMPLWLAYILTGTIWAENPVLFRVWTAMDILVGTASIGNLVAISLDRFLCITKPLMYYQYITSVRVNSTIACIWVYSVLMAVASYLLWQY-------------------RIFNFISSIVYFWVPLLIIISAYSIVFRVALR 192          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Nematostella
Match: EDO49899 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF54])

HSP 1 Score: 65.0846 bits (157), Expect = 9.047e-12
Identity = 32/86 (37.21%), Postives = 47/86 (54.65%), Query Frame = 3
Query: 1287 RSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVN---DHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDF 1535
            R R    KA +TI++I+ AF+ CW PY ++      C  C +     L+ ++  L YINS +NPF YA  N+  + +F RL R  F
Sbjct:  192 RIRGHDIKAAKTIAIIVSAFLLCWMPYTLVSCASVICPPCFHRTPSELFTVTLLLAYINSALNPFLYAFHNTDFRESFRRLFRLQF 277          

HSP 2 Score: 61.2326 bits (147), Expect = 1.951e-10
Identity = 57/195 (29.23%), Postives = 100/195 (51.28%), Query Frame = 3
Query:  192 IGGNILVLIAFLLEKSIRTPS-NYFIISLASTDLLIGLISMNLFTIYLIIGN--WPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCI--LGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKRKGMN 761
            + GNILV  A L+ + +R+ + NYFI SLA +D++   I+M  F +  I+    W   + +C+++++    A   S   +L ++VDR+ ++  P  Y    T   V+  +   W+   +I FT I  L WP +      GA      F  +  ++ + ++V F +  IVMC+LY  IY+VA    A + + +G +
Sbjct:   13 LSGNILVCTAILVHERLRSSTTNYFIFSLAVSDIITASIAMP-FDVDQILKKYTWEHGEAMCNIFVTSYLVAAPLSMLNLLAVSVDRYHAITQPLQYPNIMTPKVVLTSIFSLWV--YAILFTVIAMLAWPLYEKSVFDGA----CHFNISPWYSLISSVVNFVLPTIVMCLLYFRIYKVA---HAHARRIRGHD 197          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Nematostella
Match: EDO35211 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM55])

HSP 1 Score: 65.4698 bits (158), Expect = 1.022e-11
Identity = 57/188 (30.32%), Postives = 90/188 (47.87%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVL-FITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKR 749
            TI GN LV  AF L + +RT +NYF++SLA  DLL+G +SM L+  YL+   WP               A  T+    L  I+VDRF ++ +P  Y    TK +  + ++  WL   ++  +  + +          + E  A+F+    F   +    F++ L VM   Y  I+ VA R+QA+  + 
Sbjct:   15 TIFGNSLVCAAFYLFRDLRTVTNYFVVSLAIADLLVGFVSMPLWFTYLVF-QWPPQNSEIYALWLCFDIATATASIMNLAVISVDRFYAITLPFQYSQKITKKRACLAIVFVWLYAFAVSSSRAISFAI-------PSRESRAQFSFGYTF--FVATASFFVPLPVMIYCYTRIFSVA-RVQAAKIRE 191          

HSP 2 Score: 56.225 bits (134), Expect = 1.173e-8
Identity = 28/76 (36.84%), Postives = 43/76 (56.58%), Query Frame = 3
Query: 1308 KALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVN-DHLYNLS---YWLCYINSPINPFCYALANSQIKTTFMRLL 1523
            KA +T+++++GAF+ CW PY + +L++  C  CV     Y L+    WL Y NS +NP  Y   N   +  F R+L
Sbjct:  229 KAAKTLAIVMGAFLLCWAPYIIALLLEVSCPRCVPFQDKYTLAKAVKWLVYSNSALNPIIYTALNRAFRDAFKRVL 304          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Medaka
Match: chrm5b (cholinergic receptor, muscarinic 5b [Source:ZFIN;Acc:ZDB-GENE-041001-169])

HSP 1 Score: 171.785 bits (434), Expect = 3.654e-47
Identity = 139/468 (29.70%), Postives = 220/468 (47.01%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKR-------LQASSDKRKGMNTLLAMAGQTMSRIGVGVSWGNADDLDEIANPTVNFRINEGYDSSNKEYKNDIVIHPTSPYKLN--------APPNLVKNLQYIDEHSSDSEEIYVYKSIYYNDYNSKLEPGI--SEILPLXXXXXXXXXXXXXPTNNT-KSMNFXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTRFTFIHRKDTDVRSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFR 1538
            TI GN+LV+++F +   ++T +NY+++SLA  DL+IG++SMNL+T Y+++G W L  L CDLWL++DY A   S   +L I+ DR+ S+  P TYR  RT  +  IM+ ++WL+   ++   IL W YF   R+    +C  +F +  V      I  F+  + VM +LY  IY+  ++       LQ + ++    ++  + A +T SR     SW   D +  +            Y SS +E  +     P   +K            P+L +     D++ S  ++    KSI Y     K +PG                 ++   P+++T K M+  +                            +     RK   +    +A + L   S IL AF+  WTPY+++VLI  FC  C+   L++L YWLCY+NS INP CYAL N   + TF  LL   +R
Sbjct:   36 TIIGNMLVMLSFKVNSQLKTVNNYYLLSLAFADLIIGVLSMNLYTTYILMGYWSLGNLACDLWLAVDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAAIMIGLAWLISFVLWAPPILCWQYFVGERKVPTDQCQIQFLTEPVITFGTAIAAFYFPVSVMTILYCRIYKETQKRTKDLAELQGNQNQASWSSSNQSNATRTTSR--SDDSWAKVDQITSL----------NSYTSSEEEEHHISKDTPQGSFKEQQGQSSTNGQAPDLTE-----DQYFSSPQKKSQRKSISY-----KFKPGSKGKSPASPAPHPPEQLEKNASPSSSTSKPMDTAL----------------------------KNQITKRKRMVLVKEKKAAQTL---SAILLAFILTWTPYNIMVLISTFCADCIPTSLWHLGYWLCYVNSTINPMCYALCNKTFQKTFRMLLLCQWR 450          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Medaka
Match: ENSORLT00000036897.1 (muscarinic acetylcholine receptor M1-like [Source:NCBI gene;Acc:101171981])

HSP 1 Score: 118.242 bits (295), Expect = 3.947e-28
Identity = 79/212 (37.26%), Postives = 122/212 (57.55%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKRKGMNTLLAMAGQTMSRIGVGVSWGN 824
            T+ GNILVLI+F + K+++T +NY+++SLA  DL+IG +SMNL+T Y+I+G+W L  +LCDLWL++DY A   S   +L I+ DR+ SV  P TYR  RT  + + M+ ++W +   ++   IL W Y    R     ECY +F +  V      I  F++ + VM  L+  IY+  ++        KG      +  QT+S +  GV  G+
Sbjct:   56 TVVGNILVLISFKINKTLKTVNNYYLLSLAFADLIIGTLSMNLYTTYIIMGHWALGPVLCDLWLAIDYVASNASVMNLLIISFDRYFSVTRPLTYRAKRTTKRTMAMIGLAWSISFVLWAPAILFWQYVVGERTVPPEECYIQFLTEPVTTFCTAIAAFYLPVTVMAFLFWKIYQETEKRAKDIQSLKGSCASTNL-NQTVSEMSEGVGEGS 266          

HSP 2 Score: 85.8853 bits (211), Expect = 1.956e-17
Identity = 36/69 (52.17%), Postives = 49/69 (71.01%), Query Frame = 3
Query: 1317 RTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLL 1523
            RT+S IL AF+  W PY+++VLI  FC +C+ + L+ L YWLCY+NS +NP CYAL N   +TTF  +L
Sbjct:  370 RTLSAILLAFMMTWLPYNIMVLINTFCQNCIPEALWALGYWLCYVNSTVNPMCYALCNKTFRTTFRAIL 438          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Medaka
Match: ENSORLT00000022971.2 (muscarinic acetylcholine receptor M1-like [Source:NCBI gene;Acc:101171981])

HSP 1 Score: 117.857 bits (294), Expect = 3.979e-28
Identity = 79/212 (37.26%), Postives = 122/212 (57.55%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKRKGMNTLLAMAGQTMSRIGVGVSWGN 824
            T+ GNILVLI+F + K+++T +NY+++SLA  DL+IG +SMNL+T Y+I+G+W L  +LCDLWL++DY A   S   +L I+ DR+ SV  P TYR  RT  + + M+ ++W +   ++   IL W Y    R     ECY +F +  V      I  F++ + VM  L+  IY+  ++        KG      +  QT+S +  GV  G+
Sbjct:   28 TVVGNILVLISFKINKTLKTVNNYYLLSLAFADLIIGTLSMNLYTTYIIMGHWALGPVLCDLWLAIDYVASNASVMNLLIISFDRYFSVTRPLTYRAKRTTKRTMAMIGLAWSISFVLWAPAILFWQYVVGERTVPPEECYIQFLTEPVTTFCTAIAAFYLPVTVMAFLFWKIYQETEKRAKDIQSLKGSCASTNL-NQTVSEMSEGVGEGS 238          

HSP 2 Score: 85.5001 bits (210), Expect = 1.882e-17
Identity = 36/69 (52.17%), Postives = 49/69 (71.01%), Query Frame = 3
Query: 1317 RTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLL 1523
            RT+S IL AF+  W PY+++VLI  FC +C+ + L+ L YWLCY+NS +NP CYAL N   +TTF  +L
Sbjct:  353 RTLSAILLAFMMTWLPYNIMVLINTFCQNCIPEALWALGYWLCYVNSTVNPMCYALCNKTFRTTFRAIL 421          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Medaka
Match: chrm3a (muscarinic acetylcholine receptor M3 [Source:NCBI gene;Acc:101164585])

HSP 1 Score: 119.398 bits (298), Expect = 4.653e-28
Identity = 74/191 (38.74%), Postives = 113/191 (59.16%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKRKGMN 761
            TI GNILV+++F + + ++T +NYF++SLA  DL+IG+ISMNL+T YLI+G W +    CD+WL++DY A   S   +L I+ DR+ S+  P TYR  RT  +  IM+ ++W V   ++   IL W YF   R     ECY +F S  +      +  F++ + +M VLY   +R+ K  Q  S +  G+ 
Sbjct:   91 TIIGNILVVVSFKVNRQLKTVNNYFLLSLAVADLIIGIISMNLYTSYLIMGYWAMGNWACDIWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTRRAGIMIGLAWFVSFVLWAPAILLWQYFVGERTVPPNECYIQFFSEPITTFCTAMAAFYLPVTIMSVLY---WRIYKETQNRSKELAGLQ 278          

HSP 2 Score: 95.1301 bits (235), Expect = 3.579e-20
Identity = 43/93 (46.24%), Postives = 58/93 (62.37%), Query Frame = 3
Query: 1260 FIHRKDTDVRSRNR-----ARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLL 1523
            F  R  T +  R R      +KA +T+S IL AF+  WTPY+++VLI  FC  C+ D L+ + YWLCY+NS +NP CYAL N   +TTF  +L
Sbjct:  516 FAARTRTQITKRKRMSLLKEKKAAQTLSAILLAFIITWTPYNIMVLINAFCEVCIPDTLWAVGYWLCYVNSTVNPMCYALCNKTFRTTFKMIL 608          
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Medaka
Match: chrm5a (muscarinic acetylcholine receptor M5 [Source:NCBI gene;Acc:101169892])

HSP 1 Score: 117.087 bits (292), Expect = 1.197e-27
Identity = 76/193 (39.38%), Postives = 115/193 (59.59%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKRKGMNTL 767
            TI GNILV+++F +   ++T +NY+++SLA+ DL+IG+ SMNL+T Y+++G W L  L CDLWL+LDY A   S   +L I+ DR+ S+  P TYR  RT  +  IM+ ++WLV   ++   IL W YF   R     +C  +F S  V      I  F+I + VM +LY  IY+  ++      + +G+N L
Sbjct:   42 TIVGNILVMLSFKVNSQLKTVNNYYLLSLAAADLIIGVFSMNLYTSYILMGYWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPRRAAIMIGLAWLVSLILWAPPILCWQYFVGKRTVPERQCQIQFFSEPVITFGTAIAAFYIPVSVMTILYCRIYKETEKRTKDLAELQGVNYL 234          

HSP 2 Score: 92.0485 bits (227), Expect = 2.073e-19
Identity = 39/82 (47.56%), Postives = 56/82 (68.29%), Query Frame = 3
Query: 1299 RARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFRRN 1544
            + RKA +T+S IL AF+  WTPY+++VLI  FC+ C+   L++L YWLCY+NS +NP CYAL N   + TF  LL   +++ 
Sbjct:  419 KERKAAQTLSAILLAFILTWTPYNIMVLISTFCSDCIPLSLWHLGYWLCYVNSTVNPMCYALCNKTFQKTFRMLLLCQWKKK 500          
BLAST of Muscarinic acetylcholine receptor M1 vs. Planmine SMEST
Match: SMESG000033502.1 (SMESG000033502.1)

HSP 1 Score: 829.706 bits (2142), Expect = 0.000e+0
Identity = 478/489 (97.75%), Postives = 482/489 (98.57%), Query Frame = 3
Query:   81 MEFLNGTLNAQSPRNDXXXXXXXXXXXXXXXXXXXATIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKRKGMNTLLAMAGQTMSRIGVGVSWGNADDLDEIANPTVNFRINEGYDSSNKEYKNDIVIHPTSPYKLNAPPNLVKNLQYIDEHSSDSEEIYVYKSIYYNDYNSKLEPGISEILPLXXXXXXXXXXXXXPTNNTKSMNFXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTRFTFIHRKDTDVRSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFRRNW 1547
            MEFLNGTLNAQSPRNDSLSIPIIFLIVVSSSVASLATIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPLSQLLCDLWLSLDYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKRKGMNTLLAMAGQTMSRIGVGVSWGNADDLDEIANPTVNFRINEGYDSSNKEYKNDIVIHPTSPYKLNAPPNLVKNLQYIDEHSSDSEEIYVYKSIYYNDYNSKLEPGISEILPL     ++  ++KKPTNNTKSMNFQIKSAKQQSKKYQSSSSNSNQTSLQRLQFTRFTFIHRKDTDVRSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFRRNW
Sbjct:    1 MEFLNGTLNAQSPRNDSLSIPIIFLIVVSSSVASLATIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPLSQLLCDLWLSLDYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKRKGMNTLLAMAGQTMSRIGVGVSWGNADDLDEIANPTVNFRINEGYDSSNKEYKNDIVIHPTSPYKLNAPPNLVKNLQYIDEHSSDSEEIYVYKSIYYNDYNSKLEPGISEILPL-NKSKNSNYKQKKPTNNTKSMNFQIKSAKQQSKKYQSSSSNSNQTSLQRLQFTRFTFIHRKDTDVRSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFRRNW 488          
BLAST of Muscarinic acetylcholine receptor M1 vs. Planmine SMEST
Match: SMESG000043689.1 (SMESG000043689.1)

HSP 1 Score: 399.438 bits (1025), Expect = 1.562e-132
Identity = 240/469 (51.17%), Postives = 303/469 (64.61%), Query Frame = 3
Query:  189 TIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSDKR-KGMNTLLAMAGQTMSRIGVGVSWGNADDLDEIANPTVNFRINEGY----DSSNKEYKNDI---VIHPTSPYKLNAPPNLVKNLQYIDE-----HSSDSEEIYVYKSIYYNDYNSKLEPGISEILPLXXXXXXXXXXXXXPTNNTKSMNFXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTRFTFIHRKDTDV-RSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFC----NSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFRR 1541
            TI GNILV+ AF LEK +R   NYFI+SLA+TDLLIGL SMNLFT+YL++G WPL Q LCDLWLS+DYTACLTSQ TVL ITVDR+CSVKIP  YR WRT +KVIIMV I+WLVPS +FFT ILGWP F   R+R   EC+A+FTS  VFNT+LT+ YFW+ L +M  LY GIY VA  LQ  SD+R K M TL+AMAGQTMSRIGVGV+W N +  +     + ++   E +     +++K   ND+   +   TS  KL + P+  K ++++D      H  D EE     S    +  +       +  P   +  ++ +    P N + S  F                S+S    L++  + +F    +++  + RS NRARKA RTISLILGAF+ CWTPYHVLV+IKGFC      CVNDHLYN+SYWLCY+NSPINPFCYALAN Q K TF+RL++GD  R
Sbjct:  177 TIAGNILVITAFALEKKLRVIGNYFIVSLAATDLLIGLFSMNLFTVYLLLGCWPLGQFLCDLWLSVDYTACLTSQCTVLSITVDRYCSVKIPNIYRSWRTGSKVIIMVAIAWLVPSILFFTAILGWPLF-TIRKRLIHECFADFTSQPVFNTLLTVGYFWVPLFIMLFLYYGIYNVACNLQKKSDERHKKMTTLMAMAGQTMSRIGVGVNWNNNESENHPRKDSGDYLQTEKHPTCSSNAHKALPNDLDFKMKSNTSETKLYSSPDSGKCIEFMDNEEIKLHQLDREENQAESSSQNTESQTHEGNKFPDKSP--TTYITDSESGAGPVNQSISAAF----------------SSSLMGVLKKPYYNKFVKRSKRNKTISRSENRARKAFRTISLILGAFLACWTPYHVLVMIKGFCYNRSEICVNDHLYNISYWLCYMNSPINPFCYALANIQFKRTFIRLMKGDLHR 626          
BLAST of Muscarinic acetylcholine receptor M1 vs. Planmine SMEST
Match: SMESG000027386.1 (SMESG000027386.1)

HSP 1 Score: 372.474 bits (955), Expect = 1.469e-123
Identity = 231/502 (46.02%), Postives = 310/502 (61.75%), Query Frame = 3
Query:  186 ATIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSD-KRKGMNTLLAMAGQTMSRIGVGVSWGNADDLDEIANPTVNFRINEGY-------------DSSNKEYK-----------NDIVIHPTSPY---------KLNAPP--------NLVKNLQYIDEHSS-DSEEIYVY--KSIYYNDYNSKLEPGISEILPLXXXXXXXXXXXXXPTNNTKSMNFXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTRFTFIHRKDTDVRSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFCN----SCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFRRN 1544
             T+ GN L++ AF++EK IR PSNYFI SLA TD+LIGL SMNLF+IY+++G WPL  +LC++WLS DYT CLTSQYTVL ITVDR+CSVKIPA YR+WRT+ KV ++++++W++P+ +F T I+ W   +      + +C+AEFT   +FNTV TI YFWITLI+MCVLY GIYRVA+RL  +SD KRK + +L+A AGQTMS+IGVG+S  N D   +  N   +   NE               DSS   Y            N ++I+   P           L   P        NL +++QYIDE SS DS+  Y +   + Y N YN          LP      S    K    NN +              KY+S  +  ++++L+ ++F +      K  D+R+ ++A+K+L+TIS ILGAF+ CWTPYHVL+LIKGFC+    SC+ND LYN SYWLCYINSPINPFCYAL+NSQ K T ++L++GDF R+
Sbjct:   33 GTVFGNGLIITAFIMEKKIRIPSNYFIASLAITDILIGLFSMNLFSIYVVLGYWPLGYILCNIWLSFDYTVCLTSQYTVLLITVDRYCSVKIPAKYRIWRTEKKVYLLIVLAWIIPACLFITIIIIWNCRSQSPSVDSQQCFAEFTLYPIFNTVFTIAYFWITLIIMCVLYIGIYRVARRLHQNSDTKRKRLTSLMATAGQTMSKIGVGLSLANLDVNVQFKNFLKDNPFNETTTERNLLNDNCLYPDSSRNNYSISSRVSPSEETNSLMINNIFPKSHSETLFTDSLRFSPKSNKDKCLNLFEDIQYIDEDSSGDSKTNYEFNISNFYTNRYN----------LPSINISQSEVHGKFHLENNRE-------------IKYKSWDNTVSKSALKAMRFLKSVHNMSKRIDIRNHSKAKKSLKTISFILGAFIICWTPYHVLILIKGFCDNPPKSCINDVLYNASYWLCYINSPINPFCYALSNSQFKKTLLKLIKGDFSRS 511          
BLAST of Muscarinic acetylcholine receptor M1 vs. Planmine SMEST
Match: SMESG000039095.1 (SMESG000039095.1)

HSP 1 Score: 276.559 bits (706), Expect = 1.902e-84
Identity = 149/245 (60.82%), Postives = 186/245 (75.92%), Query Frame = 3
Query:  186 ATIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSD-KRKGMNTLLAMAGQTMSRIGVGVSWGNADDLDEIAN---PTVNFRINE---GYDSSNK 899
            AT+ GN+LV+ +F +E+++R P+NYFI SLA TDLLIG+ SMN +TIYL++  WPL ++ CDLWLSLDYTACLTSQYTV FITVDRFCSV IPA YR WRT NKV+IMV  +W++PSSIFFTCILGWP+F   R     EC+A F ++  FNT+LTI YFW+TLIVMC LY GIY VA  LQ  SD KR+ M +L++MAGQTMSRIGVG++  N ++ DEI +   PT N  ++E   G D+  K
Sbjct:   46 ATVAGNLLVITSFFVERALRNPTNYFIASLAVTDLLIGIFSMNFYTIYLLLNYWPLGEMFCDLWLSLDYTACLTSQYTVFFITVDRFCSVHIPAKYRNWRTDNKVLIMVAATWIIPSSIFFTCILGWPFFTGKRGCPQNECWAGFQTDVFFNTILTIGYFWLTLIVMCSLYGGIYHVALNLQRKSDAKRRKMTSLVSMAGQTMSRIGVGMT--NDENEDEIFDHRKPTNNMVLDEMTPGDDNPKK 288          

HSP 2 Score: 143.665 bits (361), Expect = 3.147e-36
Identity = 63/85 (74.12%), Postives = 72/85 (84.71%), Query Frame = 3
Query: 1287 RSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFRR 1541
            R+ NRARKALRTI+LILGAFV CWTP+H+LVL+KG+    VN H +NLSYWLCY NSPINPFCYALAN+Q K  F+RLLRGDF R
Sbjct:  619 RTENRARKALRTITLILGAFVICWTPFHILVLLKGYYPDLVNVHFFNLSYWLCYANSPINPFCYALANAQFKKAFLRLLRGDFHR 703          
BLAST of Muscarinic acetylcholine receptor M1 vs. Planmine SMEST
Match: SMESG000066813.1 (SMESG000066813.1)

HSP 1 Score: 249.21 bits (635), Expect = 7.384e-76
Identity = 132/219 (60.27%), Postives = 169/219 (77.17%), Query Frame = 3
Query:  186 ATIGGNILVLIAFLLEKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPXXXXXXXXXXXXXYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLVPSSIFFTCILGWPYFNN-GRQRGATECYAEFTSNTVFNTVLTIVYFWITLIVMCVLYAGIYRVAKRLQASSD-KRKGMNTLLAMAGQTMSRIG-VGVSWGNADD 833
            +TI GN+LV+++F  E+++RT +NYFI SLA TDLLIG+ SMN +T+YL++  WPL +L CDLWLSLDYTACLTSQYTV FITVDRFCSVKIPA YR WRT++KV +MV I+W+VP ++FFT I+GWPYFNN GR R   +CYAEF    +FNT+LTI YFWITL+VM +LYAGIY+VA  LQA SD K+K ++ L+  + + M+     G+   NA  
Sbjct:   36 STIMGNLLVIVSFFFERALRTSTNYFIASLAVTDLLIGVFSMNFYTVYLLLSYWPLGELFCDLWLSLDYTACLTSQYTVFFITVDRFCSVKIPAKYRNWRTESKVRLMVAITWIVPFAVFFTTIMGWPYFNNQGRIREPDQCYAEFAKEPIFNTILTIAYFWITLMVMVILYAGIYKVALNLQAKSDHKKKRISELIPSSSKRMTETSESGIRTSNASQ 254          

HSP 2 Score: 144.05 bits (362), Expect = 6.165e-37
Identity = 67/99 (67.68%), Postives = 79/99 (79.80%), Query Frame = 3
Query: 1272 KDTDVRSR--NRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNS------CVNDHLYNLSYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFRRN 1544
            K T  R R  +RARKALRTI+ ILGAFV  WTP+H++VLIKGFC+S      CVN HLYNL+YWLCY+NSPINPFCYALAN Q K TF+R+L+ DFRR+
Sbjct:  428 KSTKRRERTVSRARKALRTITFILGAFVLSWTPFHIIVLIKGFCDSTKDKHTCVNSHLYNLTYWLCYLNSPINPFCYALANVQFKRTFLRILKFDFRRS 526          
The following BLAST results are available for this feature:
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHRM27.884e-4531.50cholinergic receptor muscarinic 2 [Source:HGNC Sym... [more]
CHRM27.884e-4531.50cholinergic receptor muscarinic 2 [Source:HGNC Sym... [more]
CHRM27.884e-4531.50cholinergic receptor muscarinic 2 [Source:HGNC Sym... [more]
CHRM27.884e-4531.50cholinergic receptor muscarinic 2 [Source:HGNC Sym... [more]
CHRM13.941e-2942.61cholinergic receptor muscarinic 1 [Source:HGNC Sym... [more]
back to top
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gar-21.993e-4449.24Muscarinic acetylcholine receptor gar-2 [Source:U... [more]
gar-21.014e-4245.30Muscarinic acetylcholine receptor gar-2 [Source:U... [more]
gar-21.224e-4245.30Muscarinic acetylcholine receptor gar-2 [Source:U... [more]
gar-22.571e-4245.30Muscarinic acetylcholine receptor gar-2 [Source:U... [more]
gar-19.084e-3337.44Probable muscarinic acetylcholine receptor gar-1 ... [more]
back to top
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mAChR-B5.059e-6052.34gene:FBgn0037546 transcript:FBtr0344726[more]
mAChR-B2.174e-5952.34gene:FBgn0037546 transcript:FBtr0081789[more]
mAChR-A6.632e-2840.76gene:FBgn0000037 transcript:FBtr0072367[more]
mAChR-A8.270e-2840.76gene:FBgn0000037 transcript:FBtr0072368[more]
5-HT71.285e-1531.84gene:FBgn0004573 transcript:FBtr0334508[more]
back to top
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrm5b3.756e-4729.05cholinergic receptor, muscarinic 5b [Source:ZFIN;A... [more]
chrm5b2.112e-4328.27cholinergic receptor, muscarinic 5b [Source:ZFIN;A... [more]
CR812847.12.859e-2833.46pep chromosome:GRCz11:CHR_ALT_CTG14_1_19:24256795:... [more]
chrm1a8.359e-2833.46cholinergic receptor, muscarinic 1a [Source:ZFIN;A... [more]
chrm2a8.744e-2838.00cholinergic receptor, muscarinic 2a [Source:ZFIN;A... [more]
back to top
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000048394.12.156e-2836.62pep primary_assembly:Xenopus_tropicalis_v9.1:5:599... [more]
CHRM17.355e-2738.86cholinergic receptor, muscarinic 1 [Source:NCBI ge... [more]
slitrk38.458e-2736.79SLIT and NTRK like family member 3 [Source:Xenbase... [more]
CHRM21.385e-2537.70cholinergic receptor, muscarinic 2 [Source:NCBI ge... [more]
cfb9.967e-2144.90complement factor B [Source:Xenbase;Acc:XB-GENE-47... [more]
back to top
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Chrm12.874e-2942.61cholinergic receptor, muscarinic 1, CNS [Source:MG... [more]
Chrm12.874e-2942.61cholinergic receptor, muscarinic 1, CNS [Source:MG... [more]
Chrm31.880e-2839.39cholinergic receptor, muscarinic 3, cardiac [Sourc... [more]
Chrm31.880e-2839.39cholinergic receptor, muscarinic 3, cardiac [Sourc... [more]
Chrm56.242e-2740.86cholinergic receptor, muscarinic 5 [Source:MGI Sym... [more]
back to top
BLAST of Muscarinic acetylcholine receptor M1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P30372|ACM2_CHICK6.984e-4630.00Muscarinic acetylcholine receptor M2 OS=Gallus gal... [more]
sp|Q9N2A7|ACM2_PANTR2.183e-4431.50Muscarinic acetylcholine receptor M2 (Fragment) OS... [more]
sp|P08172|ACM2_HUMAN3.786e-4431.50Muscarinic acetylcholine receptor M2 OS=Homo sapie... [more]
sp|P06199|ACM2_PIG1.740e-4331.28Muscarinic acetylcholine receptor M2 OS=Sus scrofa... [more]
sp|Q09388|ACM2_CAEEL1.558e-4145.30Muscarinic acetylcholine receptor gar-2 OS=Caenorh... [more]
back to top
BLAST of Muscarinic acetylcholine receptor M1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUM60.000e+097.55GCR043 OS=Schmidtea mediterranea OX=79327 GN=gcr04... [more]
A0A193KUH82.024e-13151.39GCR062 OS=Schmidtea mediterranea OX=79327 GN=gcr06... [more]
A0A193KUK55.282e-12046.02GCR013 OS=Schmidtea mediterranea OX=79327 GN=gcr01... [more]
A0A193KU583.884e-8160.82GCR010 OS=Schmidtea mediterranea OX=79327 GN=gcr01... [more]
A0A193KUP41.330e-7260.27GCR071 OS=Schmidtea mediterranea OX=79327 GN=gcr07... [more]
back to top
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrm2a8.869e-2938.92cholinergic receptor muscarinic 2 [Source:NCBI gen... [more]
chrm3b2.538e-2835.68cholinergic receptor, muscarinic 3b [Source:ZFIN;A... [more]
chrm5a3.304e-2739.27muscarinic acetylcholine receptor M5 [Source:NCBI ... [more]
chrm2b1.317e-2637.77muscarinic acetylcholine receptor M2-like [Source:... [more]
chrm2b1.317e-2637.77muscarinic acetylcholine receptor M2-like [Source:... [more]
back to top
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrm5b1.731e-2836.92cholinergic receptor, muscarinic 5b [Source:ZFIN;A... [more]
CHRM39.359e-2839.56cholinergic receptor muscarinic 3 [Source:HGNC Sym... [more]
CHRM35.336e-2739.66cholinergic receptor muscarinic 3 [Source:HGNC Sym... [more]
ENSPMAT00000006872.13.232e-2035.68pep scaffold:Pmarinus_7.0:GL476537:253210:263579:1... [more]
chrm4a1.638e-1949.38cholinergic receptor, muscarinic 4a [Source:ZFIN;A... [more]
back to top
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO438353.715e-1226.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333246.217e-1227.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431187.277e-1229.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498999.047e-1237.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352111.022e-1130.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Muscarinic acetylcholine receptor M1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrm5b3.654e-4729.70cholinergic receptor, muscarinic 5b [Source:ZFIN;A... [more]
ENSORLT00000036897.13.947e-2837.26muscarinic acetylcholine receptor M1-like [Source:... [more]
ENSORLT00000022971.23.979e-2837.26muscarinic acetylcholine receptor M1-like [Source:... [more]
chrm3a4.653e-2838.74muscarinic acetylcholine receptor M3 [Source:NCBI ... [more]
chrm5a1.197e-2739.38muscarinic acetylcholine receptor M5 [Source:NCBI ... [more]
back to top
BLAST of Muscarinic acetylcholine receptor M1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033502.10.000e+097.75SMESG000033502.1[more]
SMESG000043689.11.562e-13251.17SMESG000043689.1[more]
SMESG000027386.11.469e-12346.02SMESG000027386.1[more]
SMESG000039095.11.902e-8460.82SMESG000039095.1[more]
SMESG000066813.17.384e-7660.27SMESG000066813.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023001 ID=SMED30023001|Name=Muscarinic acetylcholine receptor M1|organism=Schmidtea mediterranea sexual|type=transcript|length=1609bp
AACAGCAATACGACTTCAATTTGTAGACTGAATCAAATAGAAATTTACTG
TTGAATATCCGCATAAAATGATTTCCCTAAATGGAGTTCTTGAATGGTAC
ACTAAATGCACAAAGCCCTAGAAACGATTCTTTATCTATTCCAATAATAT
TTTTAATTGTTGTTTCGTCCAGTGTGGCAAGCCTCGCTACAATAGGTGGA
AACATTTTAGTTTTAATTGCCTTTCTGTTAGAAAAAAGTATCAGAACCCC
AAGCAATTATTTCATCATTTCCTTGGCATCTACTGATCTTTTGATTGGAT
TAATTTCAATGAATTTGTTTACAATATATCTTATCATCGGAAACTGGCCT
TTAAGTCAGTTACTTTGCGATTTGTGGCTCTCTTTGGATTATACTGCTTG
CTTGACTTCCCAGTATACTGTTCTTTTTATAACAGTTGATAGATTTTGTT
CAGTGAAGATTCCTGCAACATATCGGTTGTGGAGAACTAAAAACAAAGTC
ATTATAATGGTTCTTATTAGTTGGTTAGTGCCATCCTCGATATTTTTCAC
GTGCATATTGGGCTGGCCGTATTTCAACAATGGTAGACAGAGAGGAGCAA
CAGAATGCTATGCAGAGTTCACCTCAAATACAGTTTTCAACACAGTTCTA
ACGATAGTATACTTCTGGATTACTCTTATAGTAATGTGTGTTTTATATGC
AGGTATTTATCGTGTAGCCAAAAGGTTGCAAGCATCCTCGGATAAAAGAA
AAGGAATGAATACACTATTAGCCATGGCAGGACAAACAATGTCACGCATT
GGTGTTGGAGTTAGTTGGGGTAATGCAGATGATTTAGATGAAATTGCCAA
TCCAACTGTAAACTTTCGTATAAATGAAGGTTACGATTCATCAAATAAAG
AATACAAAAATGACATTGTAATCCATCCTACTTCTCCTTACAAGCTCAAT
GCGCCTCCAAATTTAGTCAAAAATCTTCAGTACATTGACGAACATTCAAG
TGACAGTGAGGAGATATATGTCTATAAATCCATTTACTACAATGATTACA
ACAGTAAATTGGAACCGGGCATTTCAGAGATTTTACCACTAAACAAATCA
AAAAACAGTAATTACAAACAAAAAAAAAAACCAACAAACAACACAAAATC
TATGAATTTTCAAATTAAATCTGCAAAGCAACAGTCGAAGAAATATCAGT
CAAGTTCTTCAAATTCAAATCAGACCTCTTTGCAAAGGTTACAGTTTACA
AGATTCACGTTTATTCATCGCAAGGATACAGATGTCAGATCGAGAAATCG
TGCAAGGAAAGCTTTGAGAACAATAAGCTTAATTTTGGGTGCTTTTGTTA
CTTGCTGGACTCCTTATCACGTTCTGGTTTTGATAAAGGGCTTTTGTAAT
AGTTGCGTAAACGATCATCTCTACAATCTGTCATATTGGCTGTGTTATAT
AAATTCTCCCATTAATCCTTTCTGCTATGCTCTAGCAAACTCTCAAATAA
AAACGACCTTCATGAGATTGTTGAGAGGAGATTTCAGACGAAATTGGTAA
ATCAAAGATTAGGAATTGTTTTCAAATTAGATTGATGTGTAAATATTTTT
TAACAATAG
back to top

protein sequence of SMED30023001-orf-1

>SMED30023001-orf-1 ID=SMED30023001-orf-1|Name=SMED30023001-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=490bp
MEFLNGTLNAQSPRNDSLSIPIIFLIVVSSSVASLATIGGNILVLIAFLL
EKSIRTPSNYFIISLASTDLLIGLISMNLFTIYLIIGNWPLSQLLCDLWL
SLDYTACLTSQYTVLFITVDRFCSVKIPATYRLWRTKNKVIIMVLISWLV
PSSIFFTCILGWPYFNNGRQRGATECYAEFTSNTVFNTVLTIVYFWITLI
VMCVLYAGIYRVAKRLQASSDKRKGMNTLLAMAGQTMSRIGVGVSWGNAD
DLDEIANPTVNFRINEGYDSSNKEYKNDIVIHPTSPYKLNAPPNLVKNLQ
YIDEHSSDSEEIYVYKSIYYNDYNSKLEPGISEILPLNKSKNSNYKQKKK
PTNNTKSMNFQIKSAKQQSKKYQSSSSNSNQTSLQRLQFTRFTFIHRKDT
DVRSRNRARKALRTISLILGAFVTCWTPYHVLVLIKGFCNSCVNDHLYNL
SYWLCYINSPINPFCYALANSQIKTTFMRLLRGDFRRNW*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000995Musac_Ach_rcpt
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: cellular component
TermDefinition
GO:0005887integral component of plasma membrane
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0016907G-protein coupled acetylcholine receptor activity
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
GO:0007213G-protein coupled acetylcholine receptor signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000995Muscarinic acetylcholine receptor familyPRINTSPR00243MUSCARINICRcoord: 123..137
score: 44.06
coord: 25..37
score: 33.44
coord: 468..482
score: 36.23
coord: 437..455
score: 51.72
coord: 73..83
score: 66.8
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 103..125
score: 23.07
coord: 447..473
score: 28.0
coord: 187..210
score: 24.22
coord: 58..79
score: 33.02
coord: 410..434
score: 30.98
coord: 25..49
score: 25.12
IPR000276G protein-coupled receptor, rhodopsin-likeSMARTSM013817TM_GPCR_Srsx_2coord: 36..480
e-value: 1.2E-4
score: -40.8
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 40..465
e-value: 6.4E-63
score: 212.5
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 109..125
NoneNo IPR availableGENE3DG3DSA:1.20.120.10coord: 337..399
e-value: 1.5E-27
score: 98.7
NoneNo IPR availableGENE3DG3DSA:1.20.120.10coord: 218..228
e-value: 2.4E-50
score: 173.8
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 34..217
e-value: 2.4E-50
score: 173.8
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 400..479
e-value: 1.5E-27
score: 98.7
NoneNo IPR availablePANTHERPTHR24247:SF191MUSCARINIC ACETYLCHOLINE RECEPTOR, B-TYPE, ISOFORM Acoord: 25..480
NoneNo IPR availablePANTHERPTHR242475-HYDROXYTRYPTAMINE RECEPTORcoord: 25..480
NoneNo IPR availableCDDcd153027tmA_mAChR_GAR-2-likecoord: 25..476
e-value: 5.47903E-102
score: 304.358
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 17..485
NoneNo IPR availableTMHMMTMhelixcoord: 449..468
NoneNo IPR availableTMHMMTMhelixcoord: 63..85
NoneNo IPR availableTMHMMTMhelixcoord: 20..50
NoneNo IPR availableTMHMMTMhelixcoord: 188..210
NoneNo IPR availableTMHMMTMhelixcoord: 140..162
NoneNo IPR availableTMHMMTMhelixcoord: 412..434
NoneNo IPR availableTMHMMTMhelixcoord: 100..119
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 40..465
score: 37.864