ELMO domain containing 3

Overview
NameELMO domain containing 3
Smed IDSMED30022997
Length (bp)1075
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ELMO domain containing 3 (SMED30022997) t-SNE clustered cells

Violin plots show distribution of expression levels for ELMO domain containing 3 (SMED30022997) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ELMO domain containing 3 (SMED30022997) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ELMO domain containing 3 (SMED30022997) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022997

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30022997 SmedASXL_012816SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30022997 dd_Smed_v4_13608_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30022997 dd_Smed_v4_13608_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30022997 dd_Smed_v6_13608_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30022997 dd_Smed_v4_13608_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ELMO domain containing 3 vs. Ensembl Human
Match: ELMOD3 (ELMO domain containing 3 [Source:HGNC Symbol;Acc:HGNC:26158])

HSP 1 Score: 101.293 bits (251), Expect = 2.170e-23
Identity = 62/198 (31.31%), Postives = 107/198 (54.04%), Query Frame = 3
Query:  330 NQKLKIQLIKLDYLAYLNHDNQIVNYMAIIKDIYCSLTNTNFPCPDSGNHWQDIGFQGFHPSSDLRSFALLSLLAIHQFSTGTLSKPICQKIFILSHHEIQNFPFCTLCMNIIKLLYLEIKSQKLNSYLIANQTCDIILEFFNLFNALLYKFYMIWRNEGKTIIDSQSVLDDL-LKVLKNPNKLIAFYQKSIEIEIVR 920
            +Q+L+ +   +  +A    D+Q   +  +++ IY  LT + F C   GNHW+D+GFQG +P++DLR    L+LL +      + + P+ Q+IF LS H IQ FPFC + +NI  +    ++ + L+     N+   +I    + + A       +WR + KTI DS  VL +L +   K+P +L+    K++E+ + R
Sbjct:  146 HQRLREERDLVLTIAQCGLDSQDPVHGRVLQTIYKKLTGSKFDCALHGNHWEDLGFQGANPATDLRGAGFLALLHLLYLVMDSKTLPMAQEIFRLSRHHIQQFPFCLMSVNITHIAIQALREECLSRE--CNRQQKVIPVVNSFYAATFLHLAHVWRTQRKTISDSGFVLKELEVLAKKSPRRLL----KTLELYLAR 337          
BLAST of ELMO domain containing 3 vs. Ensembl Human
Match: ELMOD3 (ELMO domain containing 3 [Source:HGNC Symbol;Acc:HGNC:26158])

HSP 1 Score: 101.293 bits (251), Expect = 2.170e-23
Identity = 62/198 (31.31%), Postives = 107/198 (54.04%), Query Frame = 3
Query:  330 NQKLKIQLIKLDYLAYLNHDNQIVNYMAIIKDIYCSLTNTNFPCPDSGNHWQDIGFQGFHPSSDLRSFALLSLLAIHQFSTGTLSKPICQKIFILSHHEIQNFPFCTLCMNIIKLLYLEIKSQKLNSYLIANQTCDIILEFFNLFNALLYKFYMIWRNEGKTIIDSQSVLDDL-LKVLKNPNKLIAFYQKSIEIEIVR 920
            +Q+L+ +   +  +A    D+Q   +  +++ IY  LT + F C   GNHW+D+GFQG +P++DLR    L+LL +      + + P+ Q+IF LS H IQ FPFC + +NI  +    ++ + L+     N+   +I    + + A       +WR + KTI DS  VL +L +   K+P +L+    K++E+ + R
Sbjct:  146 HQRLREERDLVLTIAQCGLDSQDPVHGRVLQTIYKKLTGSKFDCALHGNHWEDLGFQGANPATDLRGAGFLALLHLLYLVMDSKTLPMAQEIFRLSRHHIQQFPFCLMSVNITHIAIQALREECLSRE--CNRQQKVIPVVNSFYAATFLHLAHVWRTQRKTISDSGFVLKELEVLAKKSPRRLL----KTLELYLAR 337          
BLAST of ELMO domain containing 3 vs. Ensembl Human
Match: ELMOD3 (ELMO domain containing 3 [Source:HGNC Symbol;Acc:HGNC:26158])

HSP 1 Score: 101.293 bits (251), Expect = 2.170e-23
Identity = 62/198 (31.31%), Postives = 107/198 (54.04%), Query Frame = 3
Query:  330 NQKLKIQLIKLDYLAYLNHDNQIVNYMAIIKDIYCSLTNTNFPCPDSGNHWQDIGFQGFHPSSDLRSFALLSLLAIHQFSTGTLSKPICQKIFILSHHEIQNFPFCTLCMNIIKLLYLEIKSQKLNSYLIANQTCDIILEFFNLFNALLYKFYMIWRNEGKTIIDSQSVLDDL-LKVLKNPNKLIAFYQKSIEIEIVR 920
            +Q+L+ +   +  +A    D+Q   +  +++ IY  LT + F C   GNHW+D+GFQG +P++DLR    L+LL +      + + P+ Q+IF LS H IQ FPFC + +NI  +    ++ + L+     N+   +I    + + A       +WR + KTI DS  VL +L +   K+P +L+    K++E+ + R
Sbjct:  146 HQRLREERDLVLTIAQCGLDSQDPVHGRVLQTIYKKLTGSKFDCALHGNHWEDLGFQGANPATDLRGAGFLALLHLLYLVMDSKTLPMAQEIFRLSRHHIQQFPFCLMSVNITHIAIQALREECLSRE--CNRQQKVIPVVNSFYAATFLHLAHVWRTQRKTISDSGFVLKELEVLAKKSPRRLL----KTLELYLAR 337          
BLAST of ELMO domain containing 3 vs. Ensembl Human
Match: ELMOD3 (ELMO domain containing 3 [Source:HGNC Symbol;Acc:HGNC:26158])

HSP 1 Score: 101.293 bits (251), Expect = 2.170e-23
Identity = 62/198 (31.31%), Postives = 107/198 (54.04%), Query Frame = 3
Query:  330 NQKLKIQLIKLDYLAYLNHDNQIVNYMAIIKDIYCSLTNTNFPCPDSGNHWQDIGFQGFHPSSDLRSFALLSLLAIHQFSTGTLSKPICQKIFILSHHEIQNFPFCTLCMNIIKLLYLEIKSQKLNSYLIANQTCDIILEFFNLFNALLYKFYMIWRNEGKTIIDSQSVLDDL-LKVLKNPNKLIAFYQKSIEIEIVR 920
            +Q+L+ +   +  +A    D+Q   +  +++ IY  LT + F C   GNHW+D+GFQG +P++DLR    L+LL +      + + P+ Q+IF LS H IQ FPFC + +NI  +    ++ + L+     N+   +I    + + A       +WR + KTI DS  VL +L +   K+P +L+    K++E+ + R
Sbjct:  146 HQRLREERDLVLTIAQCGLDSQDPVHGRVLQTIYKKLTGSKFDCALHGNHWEDLGFQGANPATDLRGAGFLALLHLLYLVMDSKTLPMAQEIFRLSRHHIQQFPFCLMSVNITHIAIQALREECLSRE--CNRQQKVIPVVNSFYAATFLHLAHVWRTQRKTISDSGFVLKELEVLAKKSPRRLL----KTLELYLAR 337          
BLAST of ELMO domain containing 3 vs. Ensembl Human
Match: ELMOD3 (ELMO domain containing 3 [Source:HGNC Symbol;Acc:HGNC:26158])

HSP 1 Score: 101.293 bits (251), Expect = 2.753e-23
Identity = 63/196 (32.14%), Postives = 105/196 (53.57%), Query Frame = 3
Query:  330 NQKLKIQLIKLDYLAYLNHDNQIVNYMAIIKDIYCSLTNTNFPCPDSGNHWQDIGFQGFHPSSDLRSFALLSLLAIHQFSTGTLSKPICQKIFILSHHEIQNFPFCTLCMNIIKLLYLEIKSQKLNSYLIANQTCDIILEFFNLFNALLYKFYMIWRNEGKTIIDSQSVLDDLLKVLKNPNKLIAFYQKSIEIEIV 917
            +Q+L+ +   +  +A    D+Q   +  +++ IY  LT + F C   GNHW+D+GFQG +P++DLR    L+LL +      + + P+ Q+IF LS H IQ FPFC + +NI  +    ++ + L+     N+   +I    + + A       +WR + KTI DS  VL  +L +L  P +L A   +S E ++V
Sbjct:  146 HQRLREERDLVLTIAQCGLDSQDPVHGRVLQTIYKKLTGSKFDCALHGNHWEDLGFQGANPATDLRGAGFLALLHLLYLVMDSKTLPMAQEIFRLSRHHIQQFPFCLMSVNITHIAIQALREECLSRE--CNRQQKVIPVVNSFYAATFLHLAHVWRTQRKTISDSGFVLKGVLFLLGRP-RLNAQCPRSREPKVV 338          
BLAST of ELMO domain containing 3 vs. Ensembl Celegans
Match: C56G7.3 (ELMO domain-containing protein C56G7.3 [Source:UniProtKB/Swiss-Prot;Acc:Q09292])

HSP 1 Score: 64.3142 bits (155), Expect = 1.639e-11
Identity = 37/138 (26.81%), Postives = 73/138 (52.90%), Query Frame = 3
Query:  471 GNHWQDIGFQGFHPSSDLRSFALLSLLAIHQFSTGTLSKPICQKIFILSHHEIQNFPFCTLCMNIIKLLYLEIKSQKLNSYLIANQTCDIILEFFNLFNALLYKFYMIWRNEGKTIIDSQSVLDDLLKVL-KNPNKLI 881
            G HW  +GFQ   P +D R   +L LL +H F T  +   + + I +L+  E  +FP   + +NI  +L  ++K   L+++   N+   +   F  L  + + +F  I++++  T+ ++Q++  ++ + L K+P  LI
Sbjct:  137 GAHWVTVGFQSATPHTDFRGCGVLGLLQMHTF-TQRVPANLLRAIVLLATTEPNDFPLAVVSINITSILLTQLKKGALDNF--GNEIEGLYPFFSALHASAMCRFCSIYKSQKCTLANTQTIFSEITRQLEKSPLSLI 271          
BLAST of ELMO domain containing 3 vs. Ensembl Celegans
Match: C56G7.3 (ELMO domain-containing protein C56G7.3 [Source:UniProtKB/Swiss-Prot;Acc:Q09292])

HSP 1 Score: 64.3142 bits (155), Expect = 2.116e-11
Identity = 37/138 (26.81%), Postives = 73/138 (52.90%), Query Frame = 3
Query:  471 GNHWQDIGFQGFHPSSDLRSFALLSLLAIHQFSTGTLSKPICQKIFILSHHEIQNFPFCTLCMNIIKLLYLEIKSQKLNSYLIANQTCDIILEFFNLFNALLYKFYMIWRNEGKTIIDSQSVLDDLLKVL-KNPNKLI 881
            G HW  +GFQ   P +D R   +L LL +H F T  +   + + I +L+  E  +FP   + +NI  +L  ++K   L+++   N+   +   F  L  + + +F  I++++  T+ ++Q++  ++ + L K+P  LI
Sbjct:  173 GAHWVTVGFQSATPHTDFRGCGVLGLLQMHTF-TQRVPANLLRAIVLLATTEPNDFPLAVVSINITSILLTQLKKGALDNF--GNEIEGLYPFFSALHASAMCRFCSIYKSQKCTLANTQTIFSEITRQLEKSPLSLI 307          
BLAST of ELMO domain containing 3 vs. Ensembl Zebrafish
Match: elmod3 (ELMO/CED-12 domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-091204-471])

HSP 1 Score: 92.4337 bits (228), Expect = 7.054e-21
Identity = 47/151 (31.13%), Postives = 78/151 (51.66%), Query Frame = 3
Query:  387 DNQIVNYMAIIKDIYCSLTNTNFPCPDSGNHWQDIGFQGFHPSSDLRSFALLSLLAIHQFSTGTLSKPICQKIFILSHHEIQNFPFCTLCMNIIKLLYLEIKSQKLNSYLIANQTCDIILEFFNLFNALLYKFYMIWRNEGKTIIDSQSVL 839
            DN    +M +++ IY  LT T    P  G HW+++GFQG  P++DLR    L L+    F       P+ + IF LS H +QNFPF  + +N+ ++    ++ + L+     N+   ++    + + A     Y +W+++ KTI DS  VL
Sbjct:  140 DNGQSVHMRVLQTIYRKLTCTRADSPRYGPHWENVGFQGSDPATDLRGTGFLGLMHTLYFVMDPEILPLARDIFKLSQHHVQNFPFSVMSINMTRIALHALREEVLSKE--CNRRQQVVAVLNDFYVATFLHLYQLWKSQRKTISDSGHVL 288          
BLAST of ELMO domain containing 3 vs. Ensembl Zebrafish
Match: elmod3 (ELMO/CED-12 domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-091204-471])

HSP 1 Score: 92.4337 bits (228), Expect = 8.522e-21
Identity = 47/151 (31.13%), Postives = 78/151 (51.66%), Query Frame = 3
Query:  387 DNQIVNYMAIIKDIYCSLTNTNFPCPDSGNHWQDIGFQGFHPSSDLRSFALLSLLAIHQFSTGTLSKPICQKIFILSHHEIQNFPFCTLCMNIIKLLYLEIKSQKLNSYLIANQTCDIILEFFNLFNALLYKFYMIWRNEGKTIIDSQSVL 839
            DN    +M +++ IY  LT T    P  G HW+++GFQG  P++DLR    L L+    F       P+ + IF LS H +QNFPF  + +N+ ++    ++ + L+     N+   ++    + + A     Y +W+++ KTI DS  VL
Sbjct:  178 DNGQSVHMRVLQTIYRKLTCTRADSPRYGPHWENVGFQGSDPATDLRGTGFLGLMHTLYFVMDPEILPLARDIFKLSQHHVQNFPFSVMSINMTRIALHALREEVLSKE--CNRRQQVVAVLNDFYVATFLHLYQLWKSQRKTISDSGHVL 326          
BLAST of ELMO domain containing 3 vs. Ensembl Xenopus
Match: mospd1 (motile sperm domain containing 1 [Source:Xenbase;Acc:XB-GENE-877098])

HSP 1 Score: 107.457 bits (267), Expect = 1.181e-25
Identity = 55/160 (34.38%), Postives = 87/160 (54.37%), Query Frame = 3
Query:  405 YMAIIKDIYCSLTNTNFPCPDSGNHWQDIGFQGFHPSSDLRSFALLSLLAIHQFSTGTLSKPICQKIFILSHHEIQNFPFCTLCMNIIKLLYLEIKSQKLNSYLIANQTCDIILEFFNLFNALLYKFYMIWRNEGKTIIDSQSVLDDLLKVLK-NPNKLI 881
            ++ +++ IY  LT   F CP  G+HW+ +GFQG  PS+DLR+  LL L+     +    + P+   IF LS H  QNFPFC + +NI ++    ++ ++++      Q    +L  F  + A  Y  Y IW+ + KTI DS  VL ++    K NP +L+
Sbjct:  163 HIRVLQTIYKRLTGARFDCPLYGSHWEQLGFQGLDPSTDLRAAGLLGLMHPLYMAMEPKTLPLAHDIFRLSQHHTQNFPFCIMSINITRICLQALREERVSKECNRRQQVFAVLNDF--YVATFYHLYHIWKTQNKTISDSGFVLKEVESFAKRNPKELL 320          
BLAST of ELMO domain containing 3 vs. Ensembl Mouse
Match: Elmod3 (ELMO/CED-12 domain containing 3 [Source:MGI Symbol;Acc:MGI:2445168])

HSP 1 Score: 101.293 bits (251), Expect = 1.461e-23
Identity = 70/242 (28.93%), Postives = 118/242 (48.76%), Query Frame = 3
Query:  162 DEVNHFSTVK-NDIKHLIYPTCKYVNQIFLEYCEINEELFVXXXXXXXXXXXXXXXENQKLKIQLIKLDYLAYLNHDNQIVNYMAIIKDIYCSLTNTNFPCPDSGNHWQDIGFQGFHPSSDLRSFALLSLLAIHQFSTGTLSKPICQKIFILSHHEIQNFPFCTLCMNIIKLLYLEIKSQKLNSYLIANQTCDIILEFFNLFNALLYKFYMIWRNEGKTIIDSQSVLDDLLKVL-KNPNKLI 881
            + + HF +V  +  K  I PT +      L +C     LF                 +Q L+ +   +  +A    D+Q   +  +++ IY  LT + F C   G+HW+D+GFQG +P++DLR    L+LL +      + +  + Q+IF LSHH IQ FPFC + +NI ++    ++ + L+     N+   +I    + + A       +WR + KTI+DS  VL DL  +  K+P +L+
Sbjct:  106 EALEHFQSVDLSSFKKRIQPTIQRTGLAALRHC-----LFGPPKL------------HQGLREERDLVLTIAQCGLDSQNPTHGRVLQTIYKKLTGSKFDCALHGDHWEDLGFQGANPATDLRGAGFLALLHLLYLVMDSKTFLMAQEIFRLSHHHIQQFPFCLMSVNITRIAIQALREECLSRE--CNRRQKVIPVVNSFYAATFLHLARVWRTQQKTILDSGFVLKDLEALAKKSPKRLL 328          
BLAST of ELMO domain containing 3 vs. Ensembl Mouse
Match: Elmod3 (ELMO/CED-12 domain containing 3 [Source:MGI Symbol;Acc:MGI:2445168])

HSP 1 Score: 101.293 bits (251), Expect = 1.461e-23
Identity = 70/242 (28.93%), Postives = 118/242 (48.76%), Query Frame = 3
Query:  162 DEVNHFSTVK-NDIKHLIYPTCKYVNQIFLEYCEINEELFVXXXXXXXXXXXXXXXENQKLKIQLIKLDYLAYLNHDNQIVNYMAIIKDIYCSLTNTNFPCPDSGNHWQDIGFQGFHPSSDLRSFALLSLLAIHQFSTGTLSKPICQKIFILSHHEIQNFPFCTLCMNIIKLLYLEIKSQKLNSYLIANQTCDIILEFFNLFNALLYKFYMIWRNEGKTIIDSQSVLDDLLKVL-KNPNKLI 881
            + + HF +V  +  K  I PT +      L +C     LF                 +Q L+ +   +  +A    D+Q   +  +++ IY  LT + F C   G+HW+D+GFQG +P++DLR    L+LL +      + +  + Q+IF LSHH IQ FPFC + +NI ++    ++ + L+     N+   +I    + + A       +WR + KTI+DS  VL DL  +  K+P +L+
Sbjct:  106 EALEHFQSVDLSSFKKRIQPTIQRTGLAALRHC-----LFGPPKL------------HQGLREERDLVLTIAQCGLDSQNPTHGRVLQTIYKKLTGSKFDCALHGDHWEDLGFQGANPATDLRGAGFLALLHLLYLVMDSKTFLMAQEIFRLSHHHIQQFPFCLMSVNITRIAIQALREECLSRE--CNRRQKVIPVVNSFYAATFLHLARVWRTQQKTILDSGFVLKDLEALAKKSPKRLL 328          
BLAST of ELMO domain containing 3 vs. Ensembl Mouse
Match: Elmod3 (ELMO/CED-12 domain containing 3 [Source:MGI Symbol;Acc:MGI:2445168])

HSP 1 Score: 94.7449 bits (234), Expect = 1.638e-21
Identity = 63/227 (27.75%), Postives = 107/227 (47.14%), Query Frame = 3
Query:  162 DEVNHFSTVK-NDIKHLIYPTCKYVNQIFLEYCEINEELFVXXXXXXXXXXXXXXXENQKLKIQLIKLDYLAYLNHDNQIVNYMAIIKDIYCSLTNTNFPCPDSGNHWQDIGFQGFHPSSDLRSFALLSLLAIHQFSTGTLSKPICQKIFILSHHEIQNFPFCTLCMNIIKLLYLEIKSQKLNSYLIANQTCDIILEFFNLFNALLYKFYMIWRNEGKTIIDSQSVL 839
            + + HF +V  +  K  I PT +      L +C                        +Q L+ +   +  +A    D+Q   +  +++ IY  LT + F C   G+HW+D+GFQG +P++DLR    L+LL +      + +  + Q+IF LSHH IQ FPFC + +NI ++    ++ + L+     N+   +I    + + A       +WR + KTI+DS  VL
Sbjct:  106 EALEHFQSVDLSSFKKRIQPTIQRTGLAALRHCLFGPPKL-----------------HQGLREERDLVLTIAQCGLDSQNPTHGRVLQTIYKKLTGSKFDCALHGDHWEDLGFQGANPATDLRGAGFLALLHLLYLVMDSKTFLMAQEIFRLSHHHIQQFPFCLMSVNITRIAIQALREECLSRE--CNRRQKVIPVVNSFYAATFLHLARVWRTQQKTILDSGFVL 313          
BLAST of ELMO domain containing 3 vs. Ensembl Mouse
Match: Elmod3 (ELMO/CED-12 domain containing 3 [Source:MGI Symbol;Acc:MGI:2445168])

HSP 1 Score: 67.781 bits (164), Expect = 8.975e-13
Identity = 48/161 (29.81%), Postives = 77/161 (47.83%), Query Frame = 3
Query:  162 DEVNHFSTVK-NDIKHLIYPTCKYVNQIFLEYCEINEELFVXXXXXXXXXXXXXXXENQKLKIQLIKLDYLAYLNHDNQIVNYMAIIKDIYCSLTNTNFPCPDSGNHWQDIGFQGFHPSSDLRSFALLSLLAIHQFSTGTLSKPICQKIFILSHHEIQNFP 641
            + + HF +V  +  K  I PT +      L +C     LF                 +Q L+ +   +  +A    D+Q   +  +++ IY  LT + F C   G+HW+D+GFQG +P++DLR    L+LL +      + +  + Q+IF LSHH IQ FP
Sbjct:   70 EALEHFQSVDLSSFKKRIQPTIQRTGLAALRHC-----LFGPPKL------------HQGLREERDLVLTIAQCGLDSQNPTHGRVLQTIYKKLTGSKFDCALHGDHWEDLGFQGANPATDLRGAGFLALLHLLYLVMDSKTFLMAQEIFRLSHHHIQQFP 213          
BLAST of ELMO domain containing 3 vs. UniProt/SwissProt
Match: sp|Q91YP6|ELMD3_MOUSE (ELMO domain-containing protein 3 OS=Mus musculus OX=10090 GN=Elmod3 PE=1 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 1.022e-22
Identity = 70/242 (28.93%), Postives = 118/242 (48.76%), Query Frame = 3
Query:  162 DEVNHFSTVK-NDIKHLIYPTCKYVNQIFLEYCEINEELFVXXXXXXXXXXXXXXXENQKLKIQLIKLDYLAYLNHDNQIVNYMAIIKDIYCSLTNTNFPCPDSGNHWQDIGFQGFHPSSDLRSFALLSLLAIHQFSTGTLSKPICQKIFILSHHEIQNFPFCTLCMNIIKLLYLEIKSQKLNSYLIANQTCDIILEFFNLFNALLYKFYMIWRNEGKTIIDSQSVLDDLLKVL-KNPNKLI 881
            + + HF +V  +  K  I PT +      L +C     LF                 +Q L+ +   +  +A    D+Q   +  +++ IY  LT + F C   G+HW+D+GFQG +P++DLR    L+LL +      + +  + Q+IF LSHH IQ FPFC + +NI ++    ++ + L+     N+   +I    + + A       +WR + KTI+DS  VL DL  +  K+P +L+
Sbjct:  106 EALEHFQSVDLSSFKKRIQPTIQRTGLAALRHC-----LFGPPKL------------HQGLREERDLVLTIAQCGLDSQNPTHGRVLQTIYKKLTGSKFDCALHGDHWEDLGFQGANPATDLRGAGFLALLHLLYLVMDSKTFLMAQEIFRLSHHHIQQFPFCLMSVNITRIAIQALREECLSRE--CNRRQKVIPVVNSFYAATFLHLARVWRTQQKTILDSGFVLKDLEALAKKSPKRLL 328          
BLAST of ELMO domain containing 3 vs. UniProt/SwissProt
Match: sp|Q96FG2|ELMD3_HUMAN (ELMO domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ELMOD3 PE=1 SV=2)

HSP 1 Score: 101.293 bits (251), Expect = 1.042e-22
Identity = 62/198 (31.31%), Postives = 107/198 (54.04%), Query Frame = 3
Query:  330 NQKLKIQLIKLDYLAYLNHDNQIVNYMAIIKDIYCSLTNTNFPCPDSGNHWQDIGFQGFHPSSDLRSFALLSLLAIHQFSTGTLSKPICQKIFILSHHEIQNFPFCTLCMNIIKLLYLEIKSQKLNSYLIANQTCDIILEFFNLFNALLYKFYMIWRNEGKTIIDSQSVLDDL-LKVLKNPNKLIAFYQKSIEIEIVR 920
            +Q+L+ +   +  +A    D+Q   +  +++ IY  LT + F C   GNHW+D+GFQG +P++DLR    L+LL +      + + P+ Q+IF LS H IQ FPFC + +NI  +    ++ + L+     N+   +I    + + A       +WR + KTI DS  VL +L +   K+P +L+    K++E+ + R
Sbjct:  146 HQRLREERDLVLTIAQCGLDSQDPVHGRVLQTIYKKLTGSKFDCALHGNHWEDLGFQGANPATDLRGAGFLALLHLLYLVMDSKTLPMAQEIFRLSRHHIQQFPFCLMSVNITHIAIQALREECLSRE--CNRQQKVIPVVNSFYAATFLHLAHVWRTQRKTISDSGFVLKELEVLAKKSPRRLL----KTLELYLAR 337          
BLAST of ELMO domain containing 3 vs. UniProt/SwissProt
Match: sp|Q58DT5|ELMD3_BOVIN (ELMO domain-containing protein 3 OS=Bos taurus OX=9913 GN=ELMOD3 PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 1.184e-20
Identity = 55/172 (31.98%), Postives = 93/172 (54.07%), Query Frame = 3
Query:  369 LAYLNHDNQIVNYMAIIKDIYCSLTNTNFPCPDSGNHWQDIGFQGFHPSSDLRSFALLSLLAIHQFSTGTLSKPICQKIFILSHHEIQNFPFCTLCMNIIKLLYLEIKSQKLNSYLIANQTCDIILEFFNLFNALLYKFYMIWRNEGKTIIDSQSVLDDL-LKVLKNPNKLI 881
            +A    D+Q   +  +++ IY  LT + F C   G+HW+D+GFQG +P++DLR    L+LL +      + +  + ++I  LS H IQ FPFC + +NI ++    ++ + L+     N+   +I    + + A   +   IWR + KTI DS  VL DL +   K+P +L+
Sbjct:  159 IAQCGLDSQDPMHGRVLQTIYKKLTGSKFDCALHGDHWEDLGFQGTNPATDLRGAGFLALLHLLYLVMDSKTLLMAREILRLSRHHIQQFPFCLMSVNITRIAIQALREECLSRE--CNRQQKVIPVVNSFYAATFLRLAHIWRTQHKTISDSGFVLKDLEMSAKKSPRRLL 328          
BLAST of ELMO domain containing 3 vs. UniProt/SwissProt
Match: sp|Q5XIQ2|ELMD3_RAT (ELMO domain-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Elmod3 PE=1 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 7.279e-20
Identity = 63/230 (27.39%), Postives = 107/230 (46.52%), Query Frame = 3
Query:  162 DEVNHFSTVK-NDIKHLIYPTCKYVNQIFLEYCEINEELFVXXXXXXXXXXXXXXXENQKLKIQLIKLDYLAYLNHDNQIVNYMAIIKDIYCSLTNTNFPCPDSGNHWQDIGFQGFHPSSDLRSFALLSLLAIHQFSTGTLSKPICQKIFILSHHEIQNFPFCTLCMNIIKLLYLEIKSQKLNSYLIANQTCDIILEFFNLFNALLYKFYMIWRNEGKTIIDSQSVLDDL 848
            + + HF TV  +  K  I PT +      L +C                        +Q L+ +   +  +A    D+Q   +  +++ IY  LT + F C   G+HW+D+GFQG +P++DLR    L+LL +      + +  + Q+I  LSHH IQ FPFC + +NI ++    ++ + L+     N+   +I    + + A       +WR +  TI+DS  VL +L
Sbjct:  106 EALEHFQTVDLSSFKKRIQPTIQRTGLAALRHCLFGPPKL-----------------HQGLQEERDLVLTIAQCGLDSQNPTHGRVLQTIYKKLTGSKFDCALHGDHWEDLGFQGANPATDLRGTGFLALLHLLYLVMDSKTLLMAQEILRLSHHHIQQFPFCLMSVNITRIAIQALREECLSRE--CNRRRKVIPVVNSFYAATFLHLARMWRTQHNTILDSGFVLKEL 316          
BLAST of ELMO domain containing 3 vs. UniProt/SwissProt
Match: sp|Q09292|ELMD3_CAEEL (ELMO domain-containing protein C56G7.3 OS=Caenorhabditis elegans OX=6239 GN=C56G7.3 PE=4 SV=2)

HSP 1 Score: 64.3142 bits (155), Expect = 2.691e-10
Identity = 37/138 (26.81%), Postives = 73/138 (52.90%), Query Frame = 3
Query:  471 GNHWQDIGFQGFHPSSDLRSFALLSLLAIHQFSTGTLSKPICQKIFILSHHEIQNFPFCTLCMNIIKLLYLEIKSQKLNSYLIANQTCDIILEFFNLFNALLYKFYMIWRNEGKTIIDSQSVLDDLLKVL-KNPNKLI 881
            G HW  +GFQ   P +D R   +L LL +H F T  +   + + I +L+  E  +FP   + +NI  +L  ++K   L+++   N+   +   F  L  + + +F  I++++  T+ ++Q++  ++ + L K+P  LI
Sbjct:  173 GAHWVTVGFQSATPHTDFRGCGVLGLLQMHTF-TQRVPANLLRAIVLLATTEPNDFPLAVVSINITSILLTQLKKGALDNF--GNEIEGLYPFFSALHASAMCRFCSIYKSQKCTLANTQTIFSEITRQLEKSPLSLI 307          
BLAST of ELMO domain containing 3 vs. TrEMBL
Match: A0A2I0LIY4 (ELMO/CED-12 domain containing 3 OS=Columba livia OX=8932 GN=ELMOD3 PE=4 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 8.835e-29
Identity = 56/169 (33.14%), Postives = 94/169 (55.62%), Query Frame = 3
Query:  408 MAIIKDIYCSLTNTNFPCPDSGNHWQDIGFQGFHPSSDLRSFALLSLLAIHQFSTGTLSKPICQKIFILSHHEIQNFPFCTLCMNIIKLLYLEIKSQKLNSYLIANQTCDIILEFFNLFNALLYKFYMIWRNEGKTIIDSQSVLDDL-LKVLKNPNKLIAFYQKSIEIE 911
            M I++ IY  LT +   CP  G HW+++GFQG  P +DLR   +L L+ +  F   T + P+   IF LS HE QNFPFC + +NI +++   ++  +L+   + N+  ++I    +L+ A   + Y +W+ + KTI DS  +L +L L   + P +L+   Q  + + 
Sbjct:    1 MRILQTIYTQLTRSRLSCPRYGPHWEELGFQGADPGTDLRGTGMLGLMQMLFFLLDTQTLPLAHDIFKLSQHETQNFPFCIMSINITRMVVQALREDRLSR--VCNRRREVIAVINDLYAAAFLQLYRVWKRQHKTIADSAPLLRELELSTKRKPKQLLRALQTYVSLR 167          
BLAST of ELMO domain containing 3 vs. TrEMBL
Match: A0A452H407 (ELMO domain containing 3 OS=Gopherus agassizii OX=38772 GN=ELMOD3 PE=4 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 4.190e-28
Identity = 62/176 (35.23%), Postives = 99/176 (56.25%), Query Frame = 3
Query:  369 LAYLNHDNQIVNYMAIIKDIYCSLTNTNFPCPDSGNHWQDIGFQGFHPSSDLRSFALLSLLAIHQFSTGTLSKPICQKIFILSHHEIQNFPFCTLCMNIIKLLYLEIKSQKLNSYLIANQTCDIILEFFNLFNALLYKFYMIWRNEGKTIIDSQSVLDDLLK-VLKNPNKLIAFYQ 893
            +A    DN    +M I++ IY  LT + F CP  G HW+++GFQG  P +DLR   LL L+ I  F   + + P+ + +F LSHHE QNFPFC + +NI +++   ++ + L+     N+   +I    +L+ A   + Y+IW+ + KTI DS  VL +L     K P +L+ + +
Sbjct:  147 IAQCGLDNNEKVHMRILQTIYRKLTGSRFDCPRYGAHWEELGFQGMDPGTDLRGTGLLGLMQILYFVMDSRTLPLARDVFKLSHHESQNFPFCVMSINITRIVIQALREEHLSRE--CNRRQQVIAVLNDLYVATSLRLYVIWKTQQKTISDSGFVLKELEAFAKKKPKQLLRYLE 320          
BLAST of ELMO domain containing 3 vs. TrEMBL
Match: H9G493 (ELMO domain containing 3 OS=Anolis carolinensis OX=28377 GN=ELMOD3 PE=4 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 1.080e-27
Identity = 63/172 (36.63%), Postives = 100/172 (58.14%), Query Frame = 3
Query:  369 LAYLNHDNQIVNYMAIIKDIYCSLTNTNFPCPDSGNHWQDIGFQGFHPSSDLRSFALLSLLAIHQFSTGTLSKPICQKIFILSHHEIQNFPFCTLCMNIIKLLYLEIKSQKLNSYLIANQTCDIILEFFNLFNALLYKFYMIWRNEGKTIIDSQSVLDDL-LKVLKNPNKLI 881
            +A    DN    +M I++ IY  LT + F C   G+HW+++GFQG  P +DLR   LL L+ I  F   +   PI ++IF LSHHE QNFPFC + +NI +++   ++ ++L+     N+   +I    +L+ A+  + + IW+ + KTI DS  VL DL +   +NP +L+
Sbjct:  157 IAQCGLDNNEKVHMRILQTIYKKLTGSRFDCARYGSHWENLGFQGLDPGTDLRGTGLLGLMQILYFVMDSRILPIAREIFRLSHHETQNFPFCVMSVNITRIVIQVLREERLSRE--CNRRQQVIAVLNDLYVAVFLRLFNIWKTQQKTICDSGFVLKDLEMFAKRNPKQLL 326          
BLAST of ELMO domain containing 3 vs. TrEMBL
Match: K7FQA6 (ELMO domain containing 3 OS=Pelodiscus sinensis OX=13735 GN=ELMOD3 PE=4 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 1.309e-27
Identity = 60/172 (34.88%), Postives = 98/172 (56.98%), Query Frame = 3
Query:  369 LAYLNHDNQIVNYMAIIKDIYCSLTNTNFPCPDSGNHWQDIGFQGFHPSSDLRSFALLSLLAIHQFSTGTLSKPICQKIFILSHHEIQNFPFCTLCMNIIKLLYLEIKSQKLNSYLIANQTCDIILEFFNLFNALLYKFYMIWRNEGKTIIDSQSVLDDLLKVLKN-PNKLI 881
            +A    DN    +M I++ IY  LT + F CP  G HW+++GFQG  P +DLR   LL L+ I  F   + + P+ + IF LS HE+QNFPFC + +N+ +++   ++ ++L+     N+   +I    +L+ A   + +++WR + KTI DS  VL +L    K  P +L+
Sbjct:  153 IAQGGLDNNERVHMRILQTIYKKLTGSRFDCPRYGAHWEELGFQGLDPGTDLRGTGLLGLMQILYFVMDSRTLPLARDIFKLSQHELQNFPFCVMSVNLTRIVIQALREERLSRE--CNRRQQVIAVLNDLYVATFLRLFVVWRTQQKTISDSGFVLKELEAFAKRKPKQLL 322          
BLAST of ELMO domain containing 3 vs. TrEMBL
Match: A0A2D4M734 (ELMO domain-containing protein OS=Micrurus spixii OX=129469 PE=4 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 1.314e-27
Identity = 61/172 (35.47%), Postives = 99/172 (57.56%), Query Frame = 3
Query:  369 LAYLNHDNQIVNYMAIIKDIYCSLTNTNFPCPDSGNHWQDIGFQGFHPSSDLRSFALLSLLAIHQFSTGTLSKPICQKIFILSHHEIQNFPFCTLCMNIIKLLYLEIKSQKLNSYLIANQTCDIILEFFNLFNALLYKFYMIWRNEGKTIIDSQSVLDDLLK-VLKNPNKLI 881
            +A    DN    +M I++ +Y  LT + F C   G HW+D+GFQG  PS+DLR   LL L+    F   +   P+ ++IF LSHHE+QNFPFC + +NI +++   ++ ++L+     N+   +I    +L+ A+  + + IW+ + KTI DS  +L +L     KNP +L+
Sbjct:  146 IAQCGLDNNEKVHMRILQTVYKKLTGSQFDCARYGAHWEDLGFQGMDPSTDLRGAGLLGLMQTLYFVMDSRILPVAREIFKLSHHEVQNFPFCVMSINITRIVIQVLREERLSRE--CNRRQQVIAVLNDLYVAVFLRLFNIWKTQQKTISDSGFILKELEAFAKKNPKQLL 315          
BLAST of ELMO domain containing 3 vs. Ensembl Cavefish
Match: elmod3 (ELMO domain containing 3 [Source:NCBI gene;Acc:103042994])

HSP 1 Score: 98.2117 bits (243), Expect = 1.903e-22
Identity = 50/166 (30.12%), Postives = 87/166 (52.41%), Query Frame = 3
Query:  387 DNQIVNYMAIIKDIYCSLTNTNFPCPDSGNHWQDIGFQGFHPSSDLRSFALLSLLAIHQFSTGTLSKPICQKIFILSHHEIQNFPFCTLCMNIIKLLYLEIKSQKLNSYLIANQTCDIILEFFNLFNALLYKFYMIWRNEGKTIIDSQSVLDDL-LKVLKNPNKLI 881
            DN    +M +++ IY  LT T   CP  G HW+++GFQG  P++DLR    L L+          + P+ + I+ LS H +QNFPF  + +N+ ++    ++ + L+     N+   ++    + + A     Y +W+ + KTI DS  VL ++ L   KNP +++
Sbjct:  187 DNSQPVHMRVLQTIYRKLTCTRADCPRYGPHWENVGFQGTDPATDLRGTGFLGLMHTLYLVMDPETLPLARDIYKLSQHPVQNFPFSVMSINMTRIALHALREEVLSKE--CNRRQQVVGVLNDFYVATFLHLYQLWKTQKKTISDSGYVLKEVELHAKKNPKQVL 350          
BLAST of ELMO domain containing 3 vs. Ensembl Cavefish
Match: elmod3 (ELMO domain containing 3 [Source:NCBI gene;Acc:103042994])

HSP 1 Score: 98.2117 bits (243), Expect = 1.903e-22
Identity = 50/166 (30.12%), Postives = 87/166 (52.41%), Query Frame = 3
Query:  387 DNQIVNYMAIIKDIYCSLTNTNFPCPDSGNHWQDIGFQGFHPSSDLRSFALLSLLAIHQFSTGTLSKPICQKIFILSHHEIQNFPFCTLCMNIIKLLYLEIKSQKLNSYLIANQTCDIILEFFNLFNALLYKFYMIWRNEGKTIIDSQSVLDDL-LKVLKNPNKLI 881
            DN    +M +++ IY  LT T   CP  G HW+++GFQG  P++DLR    L L+          + P+ + I+ LS H +QNFPF  + +N+ ++    ++ + L+     N+   ++    + + A     Y +W+ + KTI DS  VL ++ L   KNP +++
Sbjct:  187 DNSQPVHMRVLQTIYRKLTCTRADCPRYGPHWENVGFQGTDPATDLRGTGFLGLMHTLYLVMDPETLPLARDIYKLSQHPVQNFPFSVMSINMTRIALHALREEVLSKE--CNRRQQVVGVLNDFYVATFLHLYQLWKTQKKTISDSGYVLKEVELHAKKNPKQVL 350          
BLAST of ELMO domain containing 3 vs. Ensembl Nematostella
Match: EDO31128 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYV6])

HSP 1 Score: 101.679 bits (252), Expect = 9.998e-25
Identity = 56/154 (36.36%), Postives = 84/154 (54.55%), Query Frame = 3
Query:  405 YMAIIKDIYCSLTNTNFPCPDSGNHWQDIGFQGFHPSSDLRSFALLSLLAIHQFSTGTLSKPICQKIFILSHHEIQNFPFCTLCMNIIKLLYLEIKSQKLNSYLIANQTCDIILEFFNLFNALLYKFYMIWRNEGKTIIDSQSVLDDLLKVLKN 866
            +  I++ IY  LT T   CP  GNHW+ IGFQG  P++DLR   LL LL      T   +  +  +++ LS HE QNFPFC + +NI ++    ++  KLN Y   N    +I  F   + A+ +  Y +W+++ KTI DS  VL +  K  ++
Sbjct:  102 HGTILQTIYKKLTGTKLDCPRYGNHWELIGFQGLDPATDLRGCGLLGLLNALFLVTNERTHTLALEMYKLSQHEAQNFPFCVMSINITRIALQTLREGKLNKY--CNSRRQVIHTFCEFYAAIFFHIYQVWKHQHKTISDSGFVLKEAEKFARD 253          
BLAST of ELMO domain containing 3 vs. Ensembl Medaka
Match: elmod3 (ELMO domain containing 3 [Source:NCBI gene;Acc:101160417])

HSP 1 Score: 96.2857 bits (238), Expect = 8.434e-22
Identity = 53/166 (31.93%), Postives = 85/166 (51.20%), Query Frame = 3
Query:  387 DNQIVNYMAIIKDIYCSLTNTNFPCPDSGNHWQDIGFQGFHPSSDLRSFALLSLLAIHQFSTGTLSKPICQKIFILSHHEIQNFPFCTLCMNIIKLLYLEIKSQKLNSYLIANQTCDIILEFFNLFNALLYKFYMIWRNEGKTIIDSQSVLDDL-LKVLKNPNKLI 881
            DN    +M +++ IY  L  +   CP  G HW++IGFQG  P++DLR    L L+    F     + P+ + IF LS H  QNFPF  + +N+ ++    ++ + L       Q    +L  F  + A     Y +W+++ KTI DS  VL ++ L   KNP +++
Sbjct:  180 DNSQPVHMRVLQTIYKRLIGSRLDCPRFGPHWENIGFQGTDPATDLRGTGFLGLMHTLYFVMDPETLPLAKDIFRLSQHPTQNFPFSVMSINMTRIALQVLREEALTKECNRRQQVVGVLNEF--YVATYLYVYQLWKSQQKTIADSGFVLREVELFAKKNPKQIL 343          
BLAST of ELMO domain containing 3 vs. Ensembl Medaka
Match: elmod3 (ELMO domain containing 3 [Source:NCBI gene;Acc:101160417])

HSP 1 Score: 96.2857 bits (238), Expect = 8.434e-22
Identity = 53/166 (31.93%), Postives = 85/166 (51.20%), Query Frame = 3
Query:  387 DNQIVNYMAIIKDIYCSLTNTNFPCPDSGNHWQDIGFQGFHPSSDLRSFALLSLLAIHQFSTGTLSKPICQKIFILSHHEIQNFPFCTLCMNIIKLLYLEIKSQKLNSYLIANQTCDIILEFFNLFNALLYKFYMIWRNEGKTIIDSQSVLDDL-LKVLKNPNKLI 881
            DN    +M +++ IY  L  +   CP  G HW++IGFQG  P++DLR    L L+    F     + P+ + IF LS H  QNFPF  + +N+ ++    ++ + L       Q    +L  F  + A     Y +W+++ KTI DS  VL ++ L   KNP +++
Sbjct:  180 DNSQPVHMRVLQTIYKRLIGSRLDCPRFGPHWENIGFQGTDPATDLRGTGFLGLMHTLYFVMDPETLPLAKDIFRLSQHPTQNFPFSVMSINMTRIALQVLREEALTKECNRRQQVVGVLNEF--YVATYLYVYQLWKSQQKTIADSGFVLREVELFAKKNPKQIL 343          
BLAST of ELMO domain containing 3 vs. Ensembl Medaka
Match: elmod3 (ELMO domain containing 3 [Source:NCBI gene;Acc:101160417])

HSP 1 Score: 96.6709 bits (239), Expect = 1.009e-21
Identity = 53/166 (31.93%), Postives = 85/166 (51.20%), Query Frame = 3
Query:  387 DNQIVNYMAIIKDIYCSLTNTNFPCPDSGNHWQDIGFQGFHPSSDLRSFALLSLLAIHQFSTGTLSKPICQKIFILSHHEIQNFPFCTLCMNIIKLLYLEIKSQKLNSYLIANQTCDIILEFFNLFNALLYKFYMIWRNEGKTIIDSQSVLDDL-LKVLKNPNKLI 881
            DN    +M +++ IY  L  +   CP  G HW++IGFQG  P++DLR    L L+    F     + P+ + IF LS H  QNFPF  + +N+ ++    ++ + L       Q    +L  F  + A     Y +W+++ KTI DS  VL ++ L   KNP +++
Sbjct:  222 DNSQPVHMRVLQTIYKRLIGSRLDCPRFGPHWENIGFQGTDPATDLRGTGFLGLMHTLYFVMDPETLPLAKDIFRLSQHPTQNFPFSVMSINMTRIALQVLREEALTKECNRRQQVVGVLNEF--YVATYLYVYQLWKSQQKTIADSGFVLREVELFAKKNPKQIL 385          
BLAST of ELMO domain containing 3 vs. Planmine SMEST
Match: SMESG000008416.1 (SMESG000008416.1)

HSP 1 Score: 576.244 bits (1484), Expect = 0.000e+0
Identity = 301/302 (99.67%), Postives = 302/302 (100.00%), Query Frame = 3
Query:   33 MIDVYPNNSKYEKNNHFLDDDLKNSEYFSEKWENVPEVNLELPDEVNHFSTVKNDIKHLIYPTCKYVNQIFLEYCEINEELFVXXXXXXXXXXXXXXXENQKLKIQLIKLDYLAYLNHDNQIVNYMAIIKDIYCSLTNTNFPCPDSGNHWQDIGFQGFHPSSDLRSFALLSLLAIHQFSTGTLSKPICQKIFILSHHEIQNFPFCTLCMNIIKLLYLEIKSQKLNSYLIANQTCDIILEFFNLFNALLYKFYMIWRNEGKTIIDSQSVLDDLLKVLKNPNKLIAFYQKSIEIEIVRECGDIP 938
            MIDVYPNNSKYEKNNHFLDDDLKNSEYFSEKWENVPEVNLELPDEVNHFSTVKNDIKHLIYPTCKYVNQIFLEYCEINEELFVSDSTCTCFSFSSKTDENQKLKIQLIKLDYLAYLNHDN+IVNYMAIIKDIYCSLTNTNFPCPDSGNHWQDIGFQGFHPSSDLRSFALLSLLAIHQFSTGTLSKPICQKIFILSHHEIQNFPFCTLCMNIIKLLYLEIKSQKLNSYLIANQTCDIILEFFNLFNALLYKFYMIWRNEGKTIIDSQSVLDDLLKVLKNPNKLIAFYQKSIEIEIVRECGDIP
Sbjct:    1 MIDVYPNNSKYEKNNHFLDDDLKNSEYFSEKWENVPEVNLELPDEVNHFSTVKNDIKHLIYPTCKYVNQIFLEYCEINEELFVSDSTCTCFSFSSKTDENQKLKIQLIKLDYLAYLNHDNEIVNYMAIIKDIYCSLTNTNFPCPDSGNHWQDIGFQGFHPSSDLRSFALLSLLAIHQFSTGTLSKPICQKIFILSHHEIQNFPFCTLCMNIIKLLYLEIKSQKLNSYLIANQTCDIILEFFNLFNALLYKFYMIWRNEGKTIIDSQSVLDDLLKVLKNPNKLIAFYQKSIEIEIVRECGDIP 302          
BLAST of ELMO domain containing 3 vs. Planmine SMEST
Match: SMESG000058932.1 (SMESG000058932.1)

HSP 1 Score: 46.9802 bits (110), Expect = 7.691e-6
Identity = 33/111 (29.73%), Postives = 49/111 (44.14%), Query Frame = 3
Query:  471 GNHWQDIGFQGFHPSSDLRSFALLSLLAIHQFSTGTLSKPICQKIFILSHHEI-QNFPFCTLCMNIIKLLYLEIKSQKLNSYLIANQTCDIILEFF-NLFNALLYKFYMIW 797
             N W +IGFQG  P +D R    L L+ +  F+   ++ P+     I +  +I Q FP     +N   LL+  +   +L  Y  +     I L  F NLF A    F+  W
Sbjct:  107 SNLWSEIGFQGKDPQTDFRGMGTLGLIQLEYFA---INSPLTAYEIISNSRDISQGFPLAIAAINFTALLFEMLCDYRLKLYFYSLPIDSINLTTFNNLFVAAFSAFHKHW 214          
The following BLAST results are available for this feature:
BLAST of ELMO domain containing 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ELMOD32.170e-2331.31ELMO domain containing 3 [Source:HGNC Symbol;Acc:H... [more]
ELMOD32.170e-2331.31ELMO domain containing 3 [Source:HGNC Symbol;Acc:H... [more]
ELMOD32.170e-2331.31ELMO domain containing 3 [Source:HGNC Symbol;Acc:H... [more]
ELMOD32.170e-2331.31ELMO domain containing 3 [Source:HGNC Symbol;Acc:H... [more]
ELMOD32.753e-2332.14ELMO domain containing 3 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of ELMO domain containing 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
C56G7.31.639e-1126.81ELMO domain-containing protein C56G7.3 [Source:Un... [more]
C56G7.32.116e-1126.81ELMO domain-containing protein C56G7.3 [Source:Un... [more]
back to top
BLAST of ELMO domain containing 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ELMO domain containing 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
elmod37.054e-2131.13ELMO/CED-12 domain containing 3 [Source:ZFIN;Acc:Z... [more]
elmod38.522e-2131.13ELMO/CED-12 domain containing 3 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of ELMO domain containing 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mospd11.181e-2534.38motile sperm domain containing 1 [Source:Xenbase;A... [more]
back to top
BLAST of ELMO domain containing 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Elmod31.461e-2328.93ELMO/CED-12 domain containing 3 [Source:MGI Symbol... [more]
Elmod31.461e-2328.93ELMO/CED-12 domain containing 3 [Source:MGI Symbol... [more]
Elmod31.638e-2127.75ELMO/CED-12 domain containing 3 [Source:MGI Symbol... [more]
Elmod38.975e-1329.81ELMO/CED-12 domain containing 3 [Source:MGI Symbol... [more]
back to top
BLAST of ELMO domain containing 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91YP6|ELMD3_MOUSE1.022e-2228.93ELMO domain-containing protein 3 OS=Mus musculus O... [more]
sp|Q96FG2|ELMD3_HUMAN1.042e-2231.31ELMO domain-containing protein 3 OS=Homo sapiens O... [more]
sp|Q58DT5|ELMD3_BOVIN1.184e-2031.98ELMO domain-containing protein 3 OS=Bos taurus OX=... [more]
sp|Q5XIQ2|ELMD3_RAT7.279e-2027.39ELMO domain-containing protein 3 OS=Rattus norvegi... [more]
sp|Q09292|ELMD3_CAEEL2.691e-1026.81ELMO domain-containing protein C56G7.3 OS=Caenorha... [more]
back to top
BLAST of ELMO domain containing 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2I0LIY48.835e-2933.14ELMO/CED-12 domain containing 3 OS=Columba livia O... [more]
A0A452H4074.190e-2835.23ELMO domain containing 3 OS=Gopherus agassizii OX=... [more]
H9G4931.080e-2736.63ELMO domain containing 3 OS=Anolis carolinensis OX... [more]
K7FQA61.309e-2734.88ELMO domain containing 3 OS=Pelodiscus sinensis OX... [more]
A0A2D4M7341.314e-2735.47ELMO domain-containing protein OS=Micrurus spixii ... [more]
back to top
BLAST of ELMO domain containing 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
elmod31.903e-2230.12ELMO domain containing 3 [Source:NCBI gene;Acc:103... [more]
elmod31.903e-2230.12ELMO domain containing 3 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of ELMO domain containing 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ELMO domain containing 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ELMO domain containing 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO311289.998e-2536.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ELMO domain containing 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
elmod38.434e-2231.93ELMO domain containing 3 [Source:NCBI gene;Acc:101... [more]
elmod38.434e-2231.93ELMO domain containing 3 [Source:NCBI gene;Acc:101... [more]
elmod31.009e-2131.93ELMO domain containing 3 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of ELMO domain containing 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000008416.10.000e+099.67SMESG000008416.1[more]
SMESG000058932.17.691e-629.73SMESG000058932.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022997 ID=SMED30022997|Name=ELMO domain containing 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1075bp
TATGTATACATTTTTGTTGATATGGAAATAGAATGATTGATGTATATCCA
AATAATTCAAAATATGAAAAAAATAATCATTTTCTTGATGATGACTTAAA
AAATAGTGAATACTTTTCTGAGAAGTGGGAAAATGTCCCTGAAGTTAATT
TAGAACTACCAGATGAAGTTAATCATTTTTCCACTGTCAAAAATGATATC
AAGCATTTAATATATCCAACTTGTAAATACGTTAATCAGATATTTTTAGA
ATATTGTGAAATAAATGAAGAATTATTTGTAAGTGATTCTACTTGTACTT
GCTTTTCTTTTTCCTCTAAGACGGATGAAAATCAAAAATTGAAAATTCAA
TTAATCAAGCTAGATTATTTGGCTTACTTAAATCATGATAATCAAATAGT
GAATTATATGGCAATTATCAAAGACATATATTGTTCATTAACTAATACTA
ATTTTCCATGTCCAGATAGTGGTAATCATTGGCAAGATATTGGATTCCAA
GGCTTTCATCCATCGAGTGACCTCAGATCATTTGCATTACTTTCGTTGCT
AGCTATTCATCAATTTTCTACTGGAACTCTATCTAAACCTATTTGTCAAA
AGATTTTTATTTTATCTCATCATGAGATACAAAATTTTCCATTTTGCACT
TTGTGTATGAATATCATTAAGTTGCTGTACCTTGAAATAAAGTCGCAGAA
ATTAAATAGTTATTTAATTGCAAATCAAACTTGTGACATTATTTTGGAGT
TTTTCAATTTATTTAATGCTTTATTGTACAAATTCTATATGATATGGCGA
AATGAAGGCAAAACAATTATTGATTCCCAATCTGTGTTGGATGACCTACT
TAAAGTATTGAAAAATCCCAATAAACTTATTGCATTTTATCAGAAAAGTA
TTGAAATTGAAATAGTTAGAGAATGTGGAGATATTCCAAATATTTCTACA
AATTTTAACTGAAGCTTGAATACTTTGAATAGCATTGTAACTTTAAATGT
ATTATTAATATCGATCATTTTCTTGTGTAGCTAATTTCATTGTAAACATT
AAAAGCTGGACAAATTAAAAAAAAA
back to top

protein sequence of SMED30022997-orf-1

>SMED30022997-orf-1 ID=SMED30022997-orf-1|Name=SMED30022997-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=310bp
MIDVYPNNSKYEKNNHFLDDDLKNSEYFSEKWENVPEVNLELPDEVNHFS
TVKNDIKHLIYPTCKYVNQIFLEYCEINEELFVSDSTCTCFSFSSKTDEN
QKLKIQLIKLDYLAYLNHDNQIVNYMAIIKDIYCSLTNTNFPCPDSGNHW
QDIGFQGFHPSSDLRSFALLSLLAIHQFSTGTLSKPICQKIFILSHHEIQ
NFPFCTLCMNIIKLLYLEIKSQKLNSYLIANQTCDIILEFFNLFNALLYK
FYMIWRNEGKTIIDSQSVLDDLLKVLKNPNKLIAFYQKSIEIEIVRECGD
IPNISTNFN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR030731ELMOD3
IPR006816ELMO_dom
Vocabulary: molecular function
TermDefinition
GO:0005096GTPase activator activity
Vocabulary: biological process
TermDefinition
GO:0043547positive regulation of GTPase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006816ELMO domainPFAMPF04727ELMO_CED12coord: 120..268
e-value: 1.2E-16
score: 61.3
IPR006816ELMO domainPROSITEPS51335ELMOcoord: 124..280
score: 16.333
NoneNo IPR availablePANTHERPTHR12771ENGULFMENT AND CELL MOTILITYcoord: 101..284
IPR030731ELMO domain-containing protein 3PANTHERPTHR12771:SF2ELMO DOMAIN-CONTAINING PROTEIN 3coord: 101..284