Myosin heavy chain

Overview
NameMyosin heavy chain
Smed IDSMED30022992
Length (bp)6157
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Myosin heavy chain (SMED30022992) t-SNE clustered cells

Violin plots show distribution of expression levels for Myosin heavy chain (SMED30022992) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Myosin heavy chain (SMED30022992) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Myosin heavy chain (SMED30022992) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022992

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 33

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30022992SMESG000062420.1 PL08009A2H09ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30022992SMESG000062420.1 PL08009A2H09ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30022992SMESG000062420.1 PL06023A2A10ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30022992SMESG000062420.1 PL06023A2A10ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30022992SMESG000062420.1 dd_Smed_v4_791_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30022992SMESG000062420.1 dd_Smed_v4_791_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30022992SMESG000062420.1 dd_Smed_v4_791_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022992SMESG000062420.1 dd_Smed_v4_791_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022992SMESG000062420.1 dd_Smed_v4_791_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30022992SMESG000062420.1 dd_Smed_v4_791_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022992SMESG000062420.1 dd_Smed_v4_791_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022992SMESG000062420.1 dd_Smed_v4_791_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30022992SMESG000062420.1 dd_Smed_v4_791_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022992SMESG000062420.1 Contig35709uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022992SMESG000062420.1 Contig35709newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022992SMESG000065350.1 SMESG000062420.1 Contig35267uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022992SMESG000065350.1 SMESG000062420.1 Contig35267newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022992SMESG000062420.1 Contig5128uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022992SMESG000062420.1 Contig5128newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022992SMESG000062420.1 Contig4506uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022992SMESG000062420.1 Contig4506newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022992SMESG000031862.1 Contig4506uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022992SMESG000031862.1 Contig4506newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022992SMESG000079805.1 Contig5128uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022992SMESG000079805.1 Contig5128newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
protonephridiaSMED30022992SMESG000062420.1 dd_Smed_v6_791_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30022992SMESG000062420.1 dd_Smed_v6_791_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022992SMESG000062420.1 dd_Smed_v6_791_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30022992SMESG000062420.1 dd_Smed_v6_791_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30022992SMESG000062420.1 dd_Smed_v6_791_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
progenitor cellSMED30022992SMESG000062420.1 dd_Smed_v6_791_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022992SMESG000062420.1 dd_Smed_v6_791_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022992SMESG000062420.1 dd_Smed_v4_791_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Myosin heavy chain vs. Ensembl Human
Match: MYH10 (myosin heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:7568])

HSP 1 Score: 1713.74 bits (4437), Expect = 0.000e+0
Identity = 957/1933 (49.51%), Postives = 1355/1933 (70.10%), Query Frame = 1
Query:   97 QYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNI-GELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPM---GILSLLDEECFFPKATTKTFVEKLIKNQSTHPKL-KATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQ-ESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLD-AESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKIDR 5868
            +YL VD++++ + A  +DW  KKLVWIP +  GF + S+ EE+GDE  V+L ENGK   +  +++QK+NPPKF K EDMA+LT LNEASVL+NLKDRY+S LIYTYSGLFCVV+NPYK LPIY+ N+IE Y+G+KRHE PPHIYA+++ AYR MLQD+E+QSILCTGESGAGKTENTKKVIQYLA VA+S K +K             D NI GELE QLLQANP+LE+FGNAKT+KNDNSSRFGKFIRINFD +G+I  ANIETYLLEK+R +RQA +ER FH+FYQLL GA + LK +L+LE  + Y+ LSNG I +P   +K  F++T+EA+ IMG S +E  S+ +V+++VL  GNI FK+ER++DQA++P+NTVAQK+ HLLG+ V E T+A+L P++K+GR+ V KAQTKEQA+F+VEA++K+TYER+FRWLV RIN+++DR  RQ  +FIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W FIDFGLDLQP I+LIE+P    G+L+LLDEEC+FPKAT KTFVEKL++ Q +H K  K    + KADF +IHYAGKVDY +D WL+KNMDPLN+NV +LL +S++ FV  +WKD + I+GL   T   E+AFG A  T+KGMFRTVGQLYKESLTKLM  L NTNPNFVRCIIPNHEK++GK+D  LV+DQL+CNGVLEGIRICRQGFPNRI+FQEF+QRY ILTPN I KGFMDG++A E M+  L++D + YRIGQSKIFF+AGVLA LEE+RD+K+T+II+ FQ+  RGYLARK    + Q L+A+K++QRNC AYLKLR+W WW++FT+VKPLL VTRQEE +  K+EEL K KE   K+  + E  ++ ++ L+EEKN + E L+ E     + E  R  L  + +++E    + ESR  E +++   L+ EK K+Q  I  L + L+ EE   QK Q +K++A+ +IK++E+++  LED+ +K  KEKK +E+R+A+  S LAEEEEK+K L K++++ E  I++LEERL +E+  RQ+LEK KR+L+ E ++  D ++      +E+++ L + E ++    A+ D+ET  K+ A + +R+ +  I E++ED E+EK S+ +AEK KRDL+EE+E+LK EL DT +T+  QQ +  K+E E+   KK+ E+ETK  E ++Q++R++ A  +E L+ Q+E A + K  +EK K  L+ +  +   E+  L+  KA+SE  +K  + Q+ E+  ++SE +  +++ AE   K Q EL D ++  LEE E K  +  K   S+ SQL D Q+  +EETR KLN  + +RQLE +   L++Q EEE+++++NLE  V ALQSQ+ D KKKV++D   +   +E++KK++++ E L  RLEE     ++ EK K  +Q EL D    L+ Q+   +  ++K KK +  + E  +++ +Y  E+D  E E REKETK + L R +    +   E E     L   + +L+SSKDDVGKNV  LEK+K  LE  +E  +  +EELE+E    +  K R+E+ + A KAQ +R+L ++DE ++E+ R++ K++R+ EA LE+E+K +   V+ KKK+E +  DL  Q+  + K ++E+ +Q++K Q    + QRE++E  A++++   Q KE EK+L++ E+ + QL E+L+ SERA+R    ERDE  +EI      +   + +K+R+E+ I+ L  + EE Q  +  L D+ +K   Q++ +  EL  ER    + +N +   ER NKEL  K++ELE     K+KAT++A ++KI  L+ QL+ + +E   AN+  ++ E+KLKEI   + DE + AD   EQ+EKA  R K+ +R L+  +E  +  +   R+LQR+L++  E  E   +E+  LK ++ R
Sbjct:   12 RYLFVDRAVIYNPATQADWTAKKLVWIPSERHGFEAASIKEERGDEVMVELAENGKKAMVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKGRK-------------DHNIPGELERQLLQANPILESFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHIFYQLLSGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGFSHEEILSMLKVVSSVLQFGNISFKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQADFAVEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPANPPGVLALLDEECWFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNVATLLHQSSDRFVAELWKDVDRIVGLDQVTGMTETAFGSAYKTKKGMFRTVGQLYKESLTKLMATLRNTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYRIGQSKIFFRAGVLAHLEEERDLKITDIIIFFQAVCRGYLARKAFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRVFTKVKPLLQVTRQEEELQAKDEELLKVKEKQTKVEGELEEMERKHQQLLEEKNILAEQLQAETELFAEAEEMRARLAAKKQELEEILHDLESRVEEEEERNQILQNEKKKMQAHIQDLEEQLDEEEGARQKLQLEKVTAEAKIKKMEEEILLLEDQNSKFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRNKQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKLQLAKKEEELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFESEKASRNKAEKQKRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKALEEETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKRKKLDAQVQELHAKVSEGDRLRVELAEKASKLQNEL-DNVSTLLEEAEKKGIKFAKDAASLESQLQDTQELLQEETRQKLNLSSRIRQLEEEKNSLQEQQEEEEEARKNLEKQVLALQSQLADTKKKVDDDLGTIESLEEAKKKLLKDAEALSQRLEEKALAYDKLEKTKNRLQQELDDLTVDLDHQRQVASNLEKKQKKFDQLLAEEKSISARYAEERDRAEAEAREKETKALSLARALEEALEAKEEFERQNKQLRADMEDLMSSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDELQATEDAKLRLEVNMQAMKAQFERDLQTRDEQNEEKKRLLIKQVRELEAELEDERKQRALAVASKKKMEIDLKDLEAQIEAANKARDEVIKQLRKLQAQMKDYQRELEEARASRDEIFAQSKESEKKLKSLEAEILQLQEELASSERARRHAEQERDELADEITNSASGKSALLDEKRRLEARIAQLEEELEEEQSNMELLNDRFRKTTLQVDTLNAELAAERSAAQKSDNARQQLERQNKELKAKLQELEGAVKSKFKATISALEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEIFMQVEDERRHADQYKEQMEKANARMKQLKRQLEEAEEEATRANASRRKLQRELDDATEANEGLSREVSTLKNRLRR 1930          
BLAST of Myosin heavy chain vs. Ensembl Human
Match: MYH10 (myosin heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:7568])

HSP 1 Score: 1713.35 bits (4436), Expect = 0.000e+0
Identity = 955/1932 (49.43%), Postives = 1354/1932 (70.08%), Query Frame = 1
Query:   97 QYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPM---GILSLLDEECFFPKATTKTFVEKLIKNQSTHPKL-KATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQ-ESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLD-AESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKIDR 5868
            +YL VD++++ + A  +DW  KKLVWIP +  GF + S+ EE+GDE  V+L ENGK   +  +++QK+NPPKF K EDMA+LT LNEASVL+NLKDRY+S LIYTYSGLFCVV+NPYK LPIY+ N+IE Y+G+KRHE PPHIYA+++ AYR MLQD+E+QSILCTGESGAGKTENTKKVIQYLA VA+S K +K        +   H    GELE QLLQANP+LE+FGNAKT+KNDNSSRFGKFIRINFD +G+I  ANIETYLLEK+R +RQA +ER FH+FYQLL GA + LK +L+LE  + Y+ LSNG I +P   +K  F++T+EA+ IMG S +E  S+ +V+++VL  GNI FK+ER++DQA++P+NTVAQK+ HLLG+ V E T+A+L P++K+GR+ V KAQTKEQA+F+VEA++K+TYER+FRWLV RIN+++DR  RQ  +FIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W FIDFGLDLQP I+LIE+P    G+L+LLDEEC+FPKAT KTFVEKL++ Q +H K  K    + KADF +IHYAGKVDY +D WL+KNMDPLN+NV +LL +S++ FV  +WKD + I+GL   T   E+AFG A  T+KGMFRTVGQLYKESLTKLM  L NTNPNFVRCIIPNHEK++GK+D  LV+DQL+CNGVLEGIRICRQGFPNRI+FQEF+QRY ILTPN I KGFMDG++A E M+  L++D + YRIGQSKIFF+AGVLA LEE+RD+K+T+II+ FQ+  RGYLARK    + Q L+A+K++QRNC AYLKLR+W WW++FT+VKPLL VTRQEE +  K+EEL K KE   K+  + E  ++ ++ L+EEKN + E L+ E     + E  R  L  + +++E    + ESR  E +++   L+ EK K+Q  I  L + L+ EE   QK Q +K++A+ +IK++E+++  LED+ +K  KEKK +E+R+A+  S LAEEEEK+K L K++++ E  I++LEERL +E+  RQ+LEK KR+L+ E ++  D ++      +E+++ L + E ++    A+ D+ET  K+ A + +R+ +  I E++ED E+EK S+ +AEK KRDL+EE+E+LK EL DT +T+  QQ +  K+E E+   KK+ E+ETK  E ++Q++R++ A  +E L+ Q+E A + K  +EK K  L+ +  +   E+  L+  KA+SE  +K  + Q+ E+  ++SE +  +++ AE   K Q EL D ++  LEE E K  +  K   S+ SQL D Q+  +EETR KLN  + +RQLE +   L++Q EEE+++++NLE  V ALQSQ+ D KKKV++D   +   +E++KK++++ E L  RLEE     ++ EK K  +Q EL D    L+ Q+   +  ++K KK +  + E  +++ +Y  E+D  E E REKETK + L R +    +   E E     L   + +L+SSKDDVGKNV  LEK+K  LE  +E  +  +EELE+E    +  K R+E+ + A KAQ +R+L ++DE ++E+ R++ K++R+ EA LE+E+K +   V+ KKK+E +  DL  Q+  + K ++E+ +Q++K Q    + QRE++E  A++++   Q KE EK+L++ E+ + QL E+L+ SERA+R    ERDE  +EI      +   + +K+R+E+ I+ L  + EE Q  +  L D+ +K   Q++ +  EL  ER    + +N +   ER NKEL  K++ELE     K+KAT++A ++KI  L+ QL+ + +E   AN+  ++ E+KLKEI   + DE + AD   EQ+EKA  R K+ +R L+  +E  +  +   R+LQR+L++  E  E   +E+  LK ++ R
Sbjct:   12 RYLFVDRAVIYNPATQADWTAKKLVWIPSERHGFEAASIKEERGDEVMVELAENGKKAMVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKGRKDHNIPESPKPVKHQ---GELERQLLQANPILESFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHIFYQLLSGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGFSHEEILSMLKVVSSVLQFGNISFKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQADFAVEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPANPPGVLALLDEECWFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNVATLLHQSSDRFVAELWKDVDRIVGLDQVTGMTETAFGSAYKTKKGMFRTVGQLYKESLTKLMATLRNTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYRIGQSKIFFRAGVLAHLEEERDLKITDIIIFFQAVCRGYLARKAFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRVFTKVKPLLQVTRQEEELQAKDEELLKVKEKQTKVEGELEEMERKHQQLLEEKNILAEQLQAETELFAEAEEMRARLAAKKQELEEILHDLESRVEEEEERNQILQNEKKKMQAHIQDLEEQLDEEEGARQKLQLEKVTAEAKIKKMEEEILLLEDQNSKFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRNKQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKLQLAKKEEELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFESEKASRNKAEKQKRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKALEEETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKRKKLDAQVQELHAKVSEGDRLRVELAEKASKLQNEL-DNVSTLLEEAEKKGIKFAKDAASLESQLQDTQELLQEETRQKLNLSSRIRQLEEEKNSLQEQQEEEEEARKNLEKQVLALQSQLADTKKKVDDDLGTIESLEEAKKKLLKDAEALSQRLEEKALAYDKLEKTKNRLQQELDDLTVDLDHQRQVASNLEKKQKKFDQLLAEEKSISARYAEERDRAEAEAREKETKALSLARALEEALEAKEEFERQNKQLRADMEDLMSSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDELQATEDAKLRLEVNMQAMKAQFERDLQTRDEQNEEKKRLLIKQVRELEAELEDERKQRALAVASKKKMEIDLKDLEAQIEAANKARDEVIKQLRKLQAQMKDYQRELEEARASRDEIFAQSKESEKKLKSLEAEILQLQEELASSERARRHAEQERDELADEITNSASGKSALLDEKRRLEARIAQLEEELEEEQSNMELLNDRFRKTTLQVDTLNAELAAERSAAQKSDNARQQLERQNKELKAKLQELEGAVKSKFKATISALEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEIFMQVEDERRHADQYKEQMEKANARMKQLKRQLEEAEEEATRANASRRKLQRELDDATEANEGLSREVSTLKNRLRR 1939          
BLAST of Myosin heavy chain vs. Ensembl Human
Match: MYH9 (myosin heavy chain 9 [Source:HGNC Symbol;Acc:HGNC:7579])

HSP 1 Score: 1712.58 bits (4434), Expect = 0.000e+0
Identity = 957/1935 (49.46%), Postives = 1346/1935 (69.56%), Query Frame = 1
Query:   97 QYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPMG---ILSLLDEECFFPKATTKTFVEKLIKNQSTHPKL-KATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTA-QESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXM---TADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKK-QTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKIDR 5868
            +YL VDK+ +++    +DWA KKLVW+P D  GF   SL EE G+EA V+L ENGK +K+  +++QK+NPPKF K EDMA+LT LNEASVL+NLK+RY+S LIYTYSGLFCVV+NPYK LPIY+  ++E YKG+KRHE PPHIYA+TD AYR+M+QD+E+QSILCTGESGAGKTENTKKVIQYLA VA+S K++K               + GELE QLLQANP+LEAFGNAKT+KNDNSSRFGKFIRINFD +G+I  ANIETYLLEK+R IRQA  ER FH+FY LL GA + LK +L+LE  + Y+ LSNG + +P   +K MF++T+EA+ IMGI ++EQ  + RVI+ VL +GNI FK+ER++DQA++PDNT AQKV+HLLG+ VT+ T+ +L P++K+GR+ V KAQTKEQA+F++EA++K+TYERMFRWLV+RIN+++D+  RQ  +FIGILDIAGFEIF++NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W FIDFGLDLQP I+LIEKP G   IL+LLDEEC+FPKAT K+FVEK+++ Q THPK  K    + KADF +IHYAGKVDY +D WL+KNMDPLN+N+ +LL +S++ FV  +WKD + IIGL       E+A  GA  TRKGMFRTVGQLYKE L KLM  L NTNPNFVRCIIPNHEKK+GK+D  LV+DQL+CNGVLEGIRICRQGFPNR++FQEF+QRY ILTPN I KGFMDG++A  LM+  L++D++ YRIGQSK+FF+AGVLA LEE+RD+K+T++I+ FQ+  RGYLARK    R Q L A+K++QRNC AYLKLRNW WW+LFT+VKPLL V+RQEE +  KEEEL K +E          + ET +     LM EK ++QE L+ E     + E  R  L  + +++E    + E+R  E +++C  L+ EK K+Q  I +L + LE EE   QK Q +K++ + ++K+LE++   LED+  KL KEKK LE+R+A+  + L EEEEKSK L KLK++HE  IT+LEERL RE+  RQ+LEKT+R+LE + ++ SD ++       E+++ L + E ++    A+++EE   K++A ++IR+ E+ I+E++EDLE+E+ S+ +AEK KRDL EE+E+LK EL DT +++  QQ +  K+E E+   KK+ E+E K  E ++QE+R+K +  +E L  Q+E   + K  +EKAK  L+ E  +  NE+  L   K DSE  +K  E QL E+  + +E E  + +   K+ K Q EL D +   L + +SK S+LTK   ++ SQL D Q+  +EE R KL+  T L+Q+E +    ++QLEEE+++K NLE  +  L +Q+ D+KKK+E+    L   +E ++K+ ++ E L  R EE +   ++ EK K  +Q EL D    L+ Q+      ++K KK +  + E   ++ KY  E+D  E E REKETK + L R +    ++ +ELE        ++ +L+SSKDDVGK+V  LEK+K  LE  +E  K  +EELE+E    +  K R+E+ L A KAQ +R+L  +DE  +E+ + + +++R+ EA LE+E+K ++  V+ +KK+E +  DL   +  + K ++E  +Q++K Q    +  RE+ +  A++ + L Q KE EK+L++ E+ + QL E+L+ +ERAKR    ERDE  +EIA  +     A+ +K+R+E+ I+ L  + EE Q     + D+ KK   Q++Q+  +LN+ER +  + EN +   ER NKEL  K++E+E     KYKA++ A ++KI  L+ QLD + +E   A +  ++ E+KLK+++  + DE + A+   +Q +KA+ R K+ +R L+  +E     +   R+LQR+LE+  ET +A ++E+  LK K+ R
Sbjct:    8 KYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVENGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVVINPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAYVASSHKSKK---------------DQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKYRFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGLLRVISGVLQLGNIVFKKERNTDQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKATYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDKSFVEKVMQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLLHQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMATLRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQRYEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKITDVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPLLQVSRQEEEMMAKEEELVKVREKQLAAENRLTEMETLQSQ---LMAEKLQLQEQLQAETELCAEAEELRARLTAKKQELEEICHDLEARVEEEEERCQHLQAEKKKMQQNIQELEEQLEEEESARQKLQLEKVTTEAKLKKLEEEQIILEDQNCKLAKEKKLLEDRIAEFTTNLTEEEEKSKSLAKLKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAKKEEELQAALARVEEEAAQKNMALKKIRELESQISELQEDLESERASRNKAEKQKRDLGEELEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLEEEAKTHEAQIQEMRQKHSQAVEELAEQLEQTKRVKANLEKAKQTLENERGELANEVKVLLQGKGDSEHKRKKVEAQLQELQVKFNEGERVRTELADKVTKLQVEL-DNVTGLLSQSDSKSSKLTKDFSALESQLQDTQELLQEENRQKLSLSTKLKQVEDEKNSFREQLEEEEEAKHNLEKQIATLHAQVADMKKKMEDSVGCLETAEEVKRKLQKDLEGLSQRHEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSACNLEKKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERLNKQFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEVNLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSMAVAARKKLEMDLKDLEAHIDSANKNRDEAIKQLRKLQAQMKDCMRELDDTRASREEILAQAKENEKKLKSMEAEMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEEEQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMEGTVKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRTEKKLKDVLLQVDDERRNAEQYKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRR 1923          
BLAST of Myosin heavy chain vs. Ensembl Human
Match: MYH10 (myosin heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:7568])

HSP 1 Score: 1698.33 bits (4397), Expect = 0.000e+0
Identity = 956/1954 (48.93%), Postives = 1357/1954 (69.45%), Query Frame = 1
Query:   97 QYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDV-NIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPM---GILSLLDEECFFPKATTKTFVEKLIKNQSTHPKL-KATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKD---------------------AENIIGLSTTTAQ-ESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLD-AESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKIDR 5868
            +YL VD++++ + A  +DW  KKLVWIP +  GF + S+ EE+GDE  V+L ENGK   +  +++QK+NPPKF K EDMA+LT LNEASVL+NLKDRY+S LIYTYSGLFCVV+NPYK LPIY+ N+IE Y+G+KRHE PPHIYA+++ AYR MLQD+E+QSILCTGESGAGKTENTKKVIQYLA VA+S K +K    + + Q     V + GELE QLLQANP+LE+FGNAKT+KNDNSSRFGKFIRINFD +G+I  ANIETYLLEK+R +RQA +ER FH+FYQLL GA + LK +L+LE  + Y+ LSNG I +P   +K  F++T+EA+ IMG S +E  S+ +V+++VL  GNI FK+ER++DQA++P+NTVAQK+ HLLG+ V E T+A+L P++K+GR+ V KAQTKEQA+F+VEA++K+TYER+FRWLV RIN+++DR  RQ  +FIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W FIDFGLDLQP I+LIE+P    G+L+LLDEEC+FPKAT KTFVEKL++ Q +H K  K    + KADF +IHYAGKVDY +D WL+KNMDPLN+NV +LL +S++ FV  +WKD                      + I+GL   T   E+AFG A  T+KGMFRTVGQLYKESLTKLM  L NTNPNFVRCIIPNHEK++GK+D  LV+DQL+CNGVLEGIRICRQGFPNRI+FQEF+QRY ILTPN I KGFMDG++A E M+  L++D + YRIGQSKIFF+AGVLA LEE+RD+K+T+II+ FQ+  RGYLARK    + Q L+A+K++QRNC AYLKLR+W WW++FT+VKPLL VTRQEE +  K+EEL K KE   K+  + E  ++ ++ L+EEKN + E L+ E     + E  R  L  + +++E    + ESR  E +++   L+ EK K+Q  I  L + L+ EE   QK Q +K++A+ +IK++E+++  LED+ +K  KEKK +E+R+A+  S LAEEEEK+K L K++++ E  I++LEERL +E+  RQ+LEK KR+L+ E ++  D ++      +E+++ L + E ++    A+ D+ET  K+ A + +R+ +  I E++ED E+EK S+ +AEK KRDL+EE+E+LK EL DT +T+  QQ +  K+E E+   KK+ E+ETK  E ++Q++R++ A  +E L+ Q+E A + K  +EK K  L+ +  +   E+  L+  KA+SE  +K  + Q+ E+  ++SE +  +++ AE   K Q EL D ++  LEE E K  +  K   S+ SQL D Q+  +EETR KLN  + +RQLE +   L++Q EEE+++++NLE  V ALQSQ+ D KKKV++D   +   +E++KK++++ E L  RLEE     ++ EK K  +Q EL D    L+ Q+   +  ++K KK +  + E  +++ +Y  E+D  E E REKETK + L R +    +   E E     L   + +L+SSKDDVGKNV  LEK+K  LE  +E  +  +EELE+E    +  K R+E+ + A KAQ +R+L ++DE ++E+ R++ K++R+ EA LE+E+K +   V+ KKK+E +  DL  Q+  + K ++E+ +Q++K Q    + QRE++E  A++++   Q KE EK+L++ E+ + QL E+L+ SERA+R    ERDE  +EI      +   + +K+R+E+ I+ L  + EE Q  +  L D+ +K   Q++ +  EL  ER    + +N +   ER NKEL  K++ELE     K+KAT++A ++KI  L+ QL+ + +E   AN+  ++ E+KLKEI   + DE + AD   EQ+EKA  R K+ +R L+  +E  +  +   R+LQR+L++  E  E   +E+  LK ++ R
Sbjct:   12 RYLFVDRAVIYNPATQADWTAKKLVWIPSERHGFEAASIKEERGDEVMVELAENGKKAMVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKGRK---DHNIPQESPKPVKHQGELERQLLQANPILESFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHIFYQLLSGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGFSHEEILSMLKVVSSVLQFGNISFKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQADFAVEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPANPPGVLALLDEECWFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNVATLLHQSSDRFVAELWKDEIQNIQRASFYDSVSGLHEPPVDRIVGLDQVTGMTETAFGSAYKTKKGMFRTVGQLYKESLTKLMATLRNTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYRIGQSKIFFRAGVLAHLEEERDLKITDIIIFFQAVCRGYLARKAFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRVFTKVKPLLQVTRQEEELQAKDEELLKVKEKQTKVEGELEEMERKHQQLLEEKNILAEQLQAETELFAEAEEMRARLAAKKQELEEILHDLESRVEEEEERNQILQNEKKKMQAHIQDLEEQLDEEEGARQKLQLEKVTAEAKIKKMEEEILLLEDQNSKFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRNKQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKLQLAKKEEELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFESEKASRNKAEKQKRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKALEEETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKRKKLDAQVQELHAKVSEGDRLRVELAEKASKLQNEL-DNVSTLLEEAEKKGIKFAKDAASLESQLQDTQELLQEETRQKLNLSSRIRQLEEEKNSLQEQQEEEEEARKNLEKQVLALQSQLADTKKKVDDDLGTIESLEEAKKKLLKDAEALSQRLEEKALAYDKLEKTKNRLQQELDDLTVDLDHQRQVASNLEKKQKKFDQLLAEEKSISARYAEERDRAEAEAREKETKALSLARALEEALEAKEEFERQNKQLRADMEDLMSSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDELQATEDAKLRLEVNMQAMKAQFERDLQTRDEQNEEKKRLLIKQVRELEAELEDERKQRALAVASKKKMEIDLKDLEAQIEAANKARDEVIKQLRKLQAQMKDYQRELEEARASRDEIFAQSKESEKKLKSLEAEILQLQEELASSERARRHAEQERDELADEITNSASGKSALLDEKRRLEARIAQLEEELEEEQSNMELLNDRFRKTTLQVDTLNAELAAERSAAQKSDNARQQLERQNKELKAKLQELEGAVKSKFKATISALEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEIFMQVEDERRHADQYKEQMEKANARMKQLKRQLEEAEEEATRANASRRKLQRELDDATEANEGLSREVSTLKNRLRR 1961          
BLAST of Myosin heavy chain vs. Ensembl Human
Match: MYH11 (myosin heavy chain 11 [Source:HGNC Symbol;Acc:HGNC:7569])

HSP 1 Score: 1677.53 bits (4343), Expect = 0.000e+0
Identity = 936/1931 (48.47%), Postives = 1341/1931 (69.45%), Query Frame = 1
Query:   91 DLQYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDR-NRQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKP---MGILSLLDEECFFPKATTKTFVEKLIKNQSTHPKL-KATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQ-ESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKI 5862
            D ++L VDK+ ++     +DWA K+LVW+P + +GF + S+ EEKGDE  V+L ENGK + +  +++QK+NPPKF K EDMA+LT LNEASVL+NL++RYFS LIYTYSGLFCVVVNPYK LPIY+  +++ YKG+KRHE PPHIYA+ D AYR+MLQD+E+QSILCTGESGAGKTENTKKVIQYLA VA+S K +K T+      F       GELE QLLQANP+LEAFGNAKT+KNDNSSRFGKFIRINFD +G+I  ANIETYLLEK+R IRQA +ER FH+FY ++ GA ++++ +L+LE  + Y  LSNG + +P   + +MF++TVEA+ IMG S++EQ SI +V+++VL +GNI FK+ER++DQA++PDNT AQKV HL+G+ VT+ T+++L P++K+GR+VV KAQTKEQA+F+VEA++K+TYER+FRW++ R+N+++D+ +RQ  +F+GILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W FIDFGLDLQP IELIE+P    G+L+LLDEEC+FPKAT K+FVEKL   Q +HPK  K    + K +F +IHYAGKVDY +  WL KNMDPLN+NV SLL  S++ FV  +WKD + I+GL       ES+   A  T+KGMFRTVGQLYKE L KLM  L NT PNFVRCIIPNHEK+SGK+D+ LV++QL+CNGVLEGIRICRQGFPNRI+FQEF+QRY IL  N I KGFMDG++A  LM+  L++D + YRIGQSKIFF+ GVLA LEE+RD+K+T++I+ FQ+  RGYLARK    R Q L A+K+IQRNC AYLKLRNW WW+LFT+VKPLL VTRQEE +  KE+EL+K+KE  +K   + +  ++ +  L EEKN +QE L+ E     + E  R  L  + +++E    E E+R  E +D+  +L+ E+ K+  ++  L + LE EE   QK Q +K++A+ +IK+LE ++  ++D+ NKL+KE+K LEER++D+ + LAEEEEK+K LTKLK++HE+ I+ELE RL +E+ +RQ+LEK KR+LE + S+  + ++       E+++ L + E ++    A+LD+E   K+ A ++IR+ E  I++++EDL++E+ ++ +AEK KRDL EE+E+LK EL DT +++  QQ +  K+E E+   KK+ ++ET+  E ++QE+R+K A  +E L  Q+E   ++K  ++K K  L++E  D   EL  L  +K + E  KK  E Q+ E+  + S+ E  + +   K+ K     + +   L E E K  +L K   S+ SQL D Q+  +EETR KLN  T LRQLE +   L+DQL+EE ++K+NLE H+  L  Q+ D KKK+++ A  +   +E +K+  +E E L  + EE     ++ EK K  +Q EL D    L++Q+   +  ++K +K +  + E  N++ KY  E+D  E E REKETK + L R +    +   ELE    +L  ++ +LVSSKDDVGKNV  LEK+K  LET +E  K  +EELE+E    +  K R+E+ + A K Q +R+L ++DE ++E+ R + ++L + E  LE+E+K +    + KKK+E +  DL  Q   + K +EE  +Q++K Q    + QRE+++  A++++     KE EK+ ++ E+++ QL EDL+ +ERA++    E++E  EE+A+    R+    +K+R+E+ I+ L  + EE Q  +  + D+ +K   Q EQ+ NEL  ER    + E+ +   ER NKEL  K+ E+E     K+K+T+AA ++KI  L+ Q++ +  E   A ++ K+ ++KLKEI+  + DE K A+   EQ EK   R K+ +R L+  +E +  ++   R+LQR+L+E  E+ EA  +E+  LK+K+
Sbjct:   10 DEKFLFVDKNFINSPVAQADWAAKRLVWVPSEKQGFEAASIKEEKGDEVVVELVENGKKVTVGKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLRERYFSGLIYTYSGLFCVVVNPYKHLPIYSEKIVDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKKDTSITQGPSFA-----YGELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQARDERTFHIFYYMIAGAKEKMRSDLLLEGFNNYTFLSNGFVPIPAAQDDEMFQETVEAMAIMGFSEEEQLSILKVVSSVLQLGNIVFKKERNTDQASMPDNTAAQKVCHLMGINVTDFTRSILTPRIKVGRDVVQKAQTKEQADFAVEALAKATYERLFRWILTRVNKALDKTHRQGASFLGILDIAGFEIFEVNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPNNPPGVLALLDEECWFPKATDKSFVEKLCTEQGSHPKFQKPKQLKDKTEFSIIHYAGKVDYNASAWLTKNMDPLNDNVTSLLNASSDKFVADLWKDVDRIVGLDQMAKMTESSLPSASKTKKGMFRTVGQLYKEQLGKLMTTLRNTTPNFVRCIIPNHEKRSGKLDAFLVLEQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFFRTGVLAHLEEERDLKITDVIMAFQAMCRGYLARKAFAKRQQQLTAMKVIQRNCAAYLKLRNWQWWRLFTKVKPLLQVTRQEEEMQAKEDELQKTKERQQKAENELKELEQKHSQLTEEKNLLQEQLQAETELYAEAEEMRVRLAAKKQELEEILHEMEARLEEEEDRGQQLQAERKKMAQQMLDLEEQLEEEEAARQKLQLEKVTAEAKIKKLEDEILVMDDQNNKLSKERKLLEERISDLTTNLAEEEEKAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKLKRKLEGDASDFHEQIADLQAQIAELKMQLAKKEEELQAALARLDDEIAQKNNALKKIRELEGHISDLQEDLDSERAARNKAEKQKRDLGEELEALKTELEDTLDSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASLSSQLQDTQELLQEETRQKLNVSTKLRQLEEERNSLQDQLDEEMEAKQNLERHISTLNIQLSDSKKKLQDFASTVEALEEGKKRFQKEIENLTQQYEEKAAAYDKLEKTKNRLQQELDDLVVDLDNQRQLVSNLEKKQRKFDQLLAEEKNISSKYADERDRAEAEAREKETKALSLARALEEALEAKEELERTNKMLKAEMEDLVSSKDDVGKNVHELEKSKRALETQMEEMKTQLEELEDELQATEDAKLRLEVNMQALKGQFERDLQARDEQNEEKRRQLQRQLHEYETELEDERKQRALAAAAKKKLEGDLKDLELQADSAIKGREEAIKQLRKLQAQMKDFQRELEDARASRDEIFATAKENEKKAKSLEADLMQLQEDLAAAERARKQADLEKEELAEELASSLSGRNALQDEKRRLEARIAQLEEELEEEQGNMEAMSDRVRKATQQAEQLSNELATERSTAQKNESARQQLERQNKELRSKLHEMEGAVKSKFKSTIAALEAKIAQLEEQVEQEAREKQAATKSLKQKDKKLKEILLQVEDERKMAEQYKEQAEKGNARVKQLKRQLEEAEEESQRINANRRKLQRELDEATESNEAMGREVNALKSKL 1935          
BLAST of Myosin heavy chain vs. Ensembl Celegans
Match: nmy-1 (Non-muscle MYosin [Source:UniProtKB/TrEMBL;Acc:Q20641])

HSP 1 Score: 1530 bits (3960), Expect = 0.000e+0
Identity = 892/1923 (46.39%), Postives = 1278/1923 (66.46%), Query Frame = 1
Query:   91 DLQYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVN--IGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDR-NRQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPMGILSLLDEECFFPKATTKTFVEKLIKNQSTHPKLKATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKE---RFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQL---SEDLSQSERAKRTIASERDEALEEIATITMARDTAIA--DKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQR---DLEEVNE 5814
            DLQYLQV ++ V+D A L+ WA +KL W+PD NEGF+ GS+  E  DE  V+L +  + + +  ++VQK NPPKF K EDM++LTYLNEASVL+NLKDRY+S LIYTYSGLFCVV+NPYK+LPIY+ ++IE +KG+KRHE PPHI+A+ D AYR+MLQ++E+QSILCTGESGAGKTENTKKVIQYLA VA + +N+   A+   +     DV   IGELE QLLQANP+LEAFGN+KT+KNDNSSRFGKFIRINFD SG+IS ANIE YLLEK+RV+RQA +ER FH+FYQ+L G   + K E +LE V  Y+ L N  I +P+ D+ Q F  T+ ++ IMG + DE  SI RV++AVL +GN+EF QE+ SDQA L D+ V QKV HLLGLPV E+ KA L+P++K+GRE V KAQ +EQAEF+VEAI+K++YER+F+WLV RIN+S+DR +RQ  +FIGILDIAGFEIF+INSFEQ+CINYTNEKLQQLFN+TMF+LEQEEY++E I+W+FIDFGLDLQPTI+LIEKPMG+L+LLDEEC FPKA  K+FVEKL K  + HPK    D R+K+ F V+HYAG+VDY +D WL+KNMDPLNENVV L+Q S + FV  IWKDAE   G+      E+AFG    +RKGMFRTV QL+KE LTKLM  L NT+P+FVRCIIPNHEKKSGKI+S LV++QL+CNGVLEGIRICRQGFPNR+ FQEF+ RY ILTP+VI K F+DG+++   M+  LDID + YRIGQSK+FF+ GVLA LEE+RD+KLT +I+ FQ+  RG+L+R+    R Q  +AI+IIQRN  AYLKLRNW WW+LFT+VKPLL VTR ++ +  K++EL+ +KE L KM  DF   +K  + ++ E+  IQE L++E      L D+ G  +   + L+ I +D ++  S E +  +K N    E+ K    +  L + LE EEQ  QK   DK + D+R++ LE+++ EL+D  +KL KEK+ LEE++  + + L + EE++K   K K R E  + ELE+ L+RE+  + +LE+ KR+L  EL +  D+L+ +    EE+   L + + ++     + DEE+   +L Q+Q+RD +  I E++ED+E E+ ++ +AE  +R++  ++E +K ++LD  + +   Q ++ +K+ E+   K++ E      E +++E + K +  +E L++QIE   K +  +EK + Q  +E  D   E+A L++S+AD +K +K  E  L EI   L+ES+EHK     +L++  +  D L    EE E   + + +   +   Q+ +L +  +EETRLK+      RQLE +   L D+ EE +  + +LE  + A +    + ++K EE   Q LE  E RKK +R+ E LQ +LEE+    ER  ++K+ IQ EL+D+   LE+ +     S+++ KK ESQ+ E     +K L ++D + +E R++ET+++ L  E++   + L E +  +  L ++L + +S+KDD GKNV  LEKAK  LE +L + +V +EELE+     +  + R+E+   A K++ DR +++KD   +E+ R + K++RD E  LE E++ K+  VS +KKIEN+  +L  QL  + ++KEE  +Q+KK Q      Q E +E   AK D    ++E +++ R  E+   QL   +E L Q        A ++ E   +      A+   I+  +K+R+E+ I+ L  + EE Q       DK +K   QLEQ+  +L++ER    + E +K + ER N++   KI ELE  A  + +A +AA ++K+Q L+ QL+ + +E   ANR  ++LE++L +      DE +  + A E +EK+  + +   R L   ++  S   T++R +QR   DL + NE
Sbjct:    3 DLQYLQVQRAAVADPATLAAWAQRKLCWVPDQNEGFLIGSIKRETNDEVLVELVDTSRQVTISRDDVQKANPPKFDKIEDMSELTYLNEASVLHNLKDRYYSSLIYTYSGLFCVVINPYKKLPIYSEDLIEEFKGKKRHEMPPHIFAIADTAYRSMLQEREDQSILCTGESGAGKTENTKKVIQYLAHVAGATRNKSLNAAAQQNIVQKPDVRNPIGELEHQLLQANPILEAFGNSKTVKNDNSSRFGKFIRINFDMSGYISGANIEFYLLEKSRVLRQAQDERSFHIFYQILRGCSAKEKSEYLLEGVDNYRFLVNRGITLPNVDDVQEFHSTINSMRIMGFADDEISSIMRVVSAVLLLGNLEFTQEKKSDQAMLQDDRVIQKVCHLLGLPVIELQKAFLRPRIKVGREFVNKAQNQEQAEFAVEAIAKASYERLFKWLVTRINKSLDRTHRQGASFIGILDIAGFEIFDINSFEQICINYTNEKLQQLFNNTMFILEQEEYQREGIEWDFIDFGLDLQPTIDLIEKPMGVLALLDEECLFPKANDKSFVEKLQKTHNKHPKFIVPDMRSKSHFAVVHYAGRVDYSADQWLMKNMDPLNENVVGLMQNSTDPFVAGIWKDAE-FAGICAAEMNETAFG--MRSRKGMFRTVSQLHKEQLTKLMTTLRNTSPHFVRCIIPNHEKKSGKINSNLVLEQLRCNGVLEGIRICRQGFPNRVPFQEFRHRYEILTPDVIPKNFIDGKESVRKMITALDIDTNLYRIGQSKVFFRTGVLAHLEEERDLKLTALIMNFQAQCRGFLSRRLYTRRQQQSSAIRIIQRNGLAYLKLRNWQWWRLFTKVKPLLQVTRTDDEIRAKDDELRATKERLLKMEHDFRENEKKLDQVIVERAVIQEQLQQESENSAELDDIRGRLQTRNQELEYIVNDMRDRLSEEEQQNEKNND---ERRKQMETVRDLEEQLEQEEQARQKLLLDKTNVDQRLRNLEERLVELQDAYDKLLKEKRLLEEKVEGLTTQLLDHEERAKHGVKAKGRLENQLHELEQDLNRERQYKSELEQHKRKLLAELEDSKDHLAEKMGKVEELNNQLMKRDEELQHQLTRYDEESANVTLMQKQMRDMQTTIDELREDMETERNARNKAEMTRREVVAQLEKVKGDVLDKVDEATMLQDLMSRKDEEVNATKRAIEQIQHTMEGKIEEQKAKFSRQVEELHDQIEQHKKQRSQLEKQQNQADQERADMAQEIALLQASRADIDKKRKIHEAHLMEIQANLAESDEHKRTLIDQLERSRDELDHLNRVREEEEHAFANMQRRLATAEGQIQELNEQIQEETRLKIANINRARQLEDEKNALLDEKEEAEGLRAHLEKEIHAARQGAGEARRKAEESVNQQLE--ELRKKNLRDVEHLQKQLEESEVAKERILQSKKKIQQELEDSSMELENVRASHRDSEKRQKKFESQMAEERVAVQKALLDRDAMSQELRDRETRVLSLLNEVDIMKEHLEESDRVRRSLQQELQDSISNKDDFGKNVHELEKAKRSLEAELNDMRVQMEELEDNLQIAEDARLRLEVTNQALKSESDRAISNKDVEAEEKRRGLLKQIRDLENELENEKRGKSGAVSHRKKIENQIGELEQQLEVANRLKEEYNKQLKKNQQIIKEYQIECEEARQAKEDIAALLREADRKFRAVEAEREQLREANEGLMQ--------ARKQLELENDELEELRAKGGGISSEEKRRLEAKIAQLEEELEEEQSNCELAIDKQRKAQVQLEQITTDLSMERTLNQKTEAEKQSLERSNRDYKAKITELESGAQSRARAQMAALEAKVQYLEDQLNVEGQEKTAANRAARRLEKRLNDTTQQFEDEKRANEQAKELLEKSNLKNRNLRRQLDEAEDEMSRERTKHRNVQREADDLLDANE 1909          
BLAST of Myosin heavy chain vs. Ensembl Celegans
Match: nmy-2 (Non-muscle MYosin [Source:UniProtKB/TrEMBL;Acc:G5EBY3])

HSP 1 Score: 1337.78 bits (3461), Expect = 0.000e+0
Identity = 774/1823 (42.46%), Postives = 1178/1823 (64.62%), Query Frame = 1
Query:  145 SDWANKKLVWIPDDNEGFISGSLIEEKGDEATVK---LENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVA--TSLKNQKT-----TASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILEN-VSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQE-RSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRNRQKT-NFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPMGILSLLDEECFFPKATTKTFVEKLIKNQSTHPKLKATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTT-TAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRY-GILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQL 5568
            +DWA KKL+W+P + +GF  G++I E   + T+    +E G+  ++  ++ QK NPPK+ K EDM+ LT LNEASVL+NLK RYFS+L YTYSGLFCVV+NPYKR+PIYT+ + E +K +KR E PPHI+AV D AYR+MLQ++++QSILCTGESGAGKTENTKKVIQYLA VA  + +KN+KT     T++N +         +G+LE QLLQANP+LEAFGN+KT+KNDNSSRFGKFIR++FD++G IS ANIE YLLEK+RV++QA NER FH+FYQLL G     ++  +LE+ +S YK +SNG   +   D+    K+T+ A+ IMG++ +E   I RV++AV+  GN+EF  E +++DQA L ++ VAQK+A LLG+ VTE+ +A LKPK+K+ R++V +AQ+ +Q  FSV AI+K++YER+FRWLV R+N+S+DR RQ++ +FIGILDIAGFEIFE NSFEQLCINYTNEKLQQLFN+TMFV EQ+EY  E ++W+F+DFGL+LQPTI+LI+KPMGI+S LD+ C FP+   ++FV++L    S HPK    + R+++DF V+HYAG+VDY S+ W VKNMDPLNENV+ +L+ S ES +  +WKD  ++  LS   +  ++   G++  +KGMFRTV QLYKE L +LM  LNNTNP+FVRCIIPNHEKK G +++ LV+DQL+CNGVLEGIRICRQGFP R+ FQEF+QRY  +L P+V   GFMDG+ A   ++  L++DA+ +RIGQSKIFF++GV+A  EE RD KL+ +I  FQ+  RG+L R+ +  R +   AIKI+QRN  A+++LR W WW+L T+VKPLL VT ++E++A +E+ELK + E L +        K+  E + EE+  ++  L+ E     ++  ER  +  R  ++E   +E   R    + K  K + E  KL   +  L +NLE EE++ QK   +K S + R+KELE +  ELED  NKL+KEKK+LEER  D+ S L +E E+SKQL K K+R E ++ E+ + L +E+  R + E  +R  ET+L E+ ++   ++   EE+   L R E+++ Q+  + DEE  A+   +R+IR+    + +  E+   EK ++++AEKA+RD+AEE+ES K EL ++ + +     +  K++ E  + +K  E+  K +E  ++E++ +    IE LN  I+   + K+  +KAK   + +  +   EL+N+ S++ ++EK +K  E  L E  H++ E + +  D  +KL K     + +       E+  S L K   S+  QL++L +  EE+ R +      +RQLE   A+  +  ++   ++E +E  V+ ++S + + +KK++E+ ++++E  E RKK  +E    + R + A    +++E+AK+    E +D    L        + +RK++K + Q+ E  N       E+D   +  R+ ETK + L  E++   D + +LE  K  L  +++ L S+KDD GKNV  LEK K +L+ +L   +  I ELE+        + RVE+ + A +++ +R+LAS++E  D++ + +  K+R+    LE EQ+++ A ++ KKKIE++  +L  +   S +  E+L+RQ++K Q    +LQ ++ E  AA  D L   ++ EKR R SE  + +L+ D+     +KR   +ERDE +EE++++  A   +  +K+R+E+ +  L    +E        ++K +K   QLEQ+  +L +ER    R E+ K   ER N++L  ++++ E  A  + +  +   ++K+ SL+ QL
Sbjct:   27 ADWAKKKLMWVPSEKDGFALGAVIGEPHADGTIDIELMETGERQRVSSDDCQKPNPPKYDKCEDMSMLTCLNEASVLHNLKQRYFSNLYYTYSGLFCVVINPYKRIPIYTDTIAEQFKCKKRKEMPPHIFAVADEAYRSMLQERDDQSILCTGESGAGKTENTKKVIQYLAYVANRSMVKNRKTSVDLDTSTNRI---------MGQLEEQLLQANPILEAFGNSKTVKNDNSSRFGKFIRVHFDSTGCISGANIEFYLLEKSRVLKQAPNERSFHIFYQLLKGLSKVQREHYLLEDSLSKYKFVSNGDSKLAGVDDGAEMKETLNAMSIMGLNDEEIGGILRVVSAVMLFGNLEFSHENKNNDQAVLLNDAVAQKIASLLGVNVTELMRAFLKPKIKVQRDLVHRAQSVDQVNFSVGAIAKASYERLFRWLVHRLNKSLDRTRQQSVSFIGILDIAGFEIFETNSFEQLCINYTNEKLQQLFNNTMFVREQQEYLDEGLEWKFLDFGLNLQPTIDLIDKPMGIMSTLDDVCLFPQGNDQSFVQRLNNTHSQHPKYVVPEIRSRSDFAVVHYAGRVDYQSEGWRVKNMDPLNENVIDVLKTSKESLIVDMWKDIADVCSLSAADSTSDTGVFGSRVPKKGMFRTVSQLYKEQLARLMSTLNNTNPHFVRCIIPNHEKKHGVLNAHLVLDQLRCNGVLEGIRICRQGFPTRLPFQEFRQRYEKLLAPDVNPAGFMDGKNAVYRIVQYLEVDANLFRIGQSKIFFRSGVIAEFEEMRDQKLSALIESFQAQCRGWLGRRVMVRRREQEVAIKILQRNGLAWMRLREWQWWRLLTKVKPLLEVTNKDELIAEREQELKVTAEKLRRSEVFISDYKQQMEKMDEERLVLKTRLDAESSERAEIFEERSRMAARRDELEGILEEVSKRLEIEEQKAKKADSESRKLTEMVRHLEENLEDEERSRQKLLLEKNSIESRLKELEAQGLELEDSGNKLSKEKKALEERCEDLSSRLIDEVERSKQLVKAKARLEATVAEINDELEKEKQQRHNAETARRAAETQLREEQESCLEKTRKAEELTNQLMRKESELSQISIRNDEELAARQQLEREIREIRAQLDDAIEETNKEKAARQKAEKARRDMAEELESYKQELEESNDKTVLHSQLKAKRDEEYAHLQKQLEETVKSSEEVVEEMKAQNQKKIEELNETIDQLKRQKISADKAKSSAESDNENFRAELSNIASARLEAEKKRKAAETSLMEKDHKMREMQSNLDDLMAKLSKMNNELESIQKAKSADETLNSNLLKKNASLDMQLSELTEASEEDRRTRATLNNKIRQLEEDLAVAVEARDDALDAQEKIEKEVKEVKSLLAEARKKLDEENREVME--ELRKKKEKELSAEKERADMAEQARDKAERAKKKAIQEAEDVQKELTDVVAATREMERKMRKFDQQLAEERNNTLLAQQERDMAHQMLRDAETKALVLSNELSEKKDIVDQLEKDKRTLKLEIDNLASTKDDAGKNVYELEKTKRRLDEELSRAEQQIIELEDALQLADDARSRVEVNMQAMRSEFERQLASREEDEDDRKKGLTSKIRNLTEELESEQRARQAAIANKKKIESQISELTEKNEASLRQIEDLSRQLRKAQLGWKDLQLDVTEARAAMEDALAGQRDAEKRARASEDEIKRLTADIQAVSSSKRKAEAERDELIEEVSSLR-ASSFSNEEKRRLEAKVIDLEDQLDEEASANELAQEKVRKSQQQLEQMTADLAMERSVCERTESDKIALERANRDLKQQLQDAENTAVARLRTQINVAEAKVSSLEQQL 1837          
BLAST of Myosin heavy chain vs. Ensembl Celegans
Match: unc-54 (Myosin-4 [Source:UniProtKB/Swiss-Prot;Acc:P02566])

HSP 1 Score: 999.964 bits (2584), Expect = 0.000e+0
Identity = 672/1834 (36.64%), Postives = 1068/1834 (58.23%), Query Frame = 1
Query:  151 WANKKLVWIPDDNEGFISGSLIEEKGDEATVKLENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGE--LETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDR---LKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNT-VAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSID-RNRQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPMGILSLLDEECFFPKATTKTFVEKLIKNQ-STHPKLK----ATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQES--NESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDAS----NYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAES-KLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDE---SRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRT----IASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDA 5574
            + +KK VWIPD  EG+++G +   KGD+ T+    G  + L  E VQ++NPPKF K+EDM++L++LN+ASVL+NL+ RY + LIYTYSGLFCVV+NPYKRLPIYT++    + G+++ E PPH++AV+D AYRNMLQD ENQS+L TGESGAGKTENTKKVI Y A+V  S   Q+   +         D N  +  LE Q++Q NPVLEAFGNAKT++N+NSSRFGKFIRI+F+  G ++S +IE YLLEK+RVIRQA  ERC+H+FYQ+   +D R    K+ L+   +  Y  ++   + +   D+ + F+ T EA DI+  S  E++  +R+++A +HMGN++FKQ R  ++ A PD T  A+K +++ G+   E  KAL KP++K+G E V+K Q  EQ  ++V A++K  Y R+F WLV + N ++D +   +  FIG+LDIAGFEIF+ NSFEQL IN+ NEKLQQ FNH MFVLEQEEY +E I+W FIDFGLDLQ  IELIEKP+GI+S+LDEEC  PKAT  T   KL+      HP  +        + +A F + HYAG V Y   NWL KN DPLN+ VVS +++S  N+  V+ IW+D       +   A+E   GG K  + G F TV  LY+ESL  LM +LN T+P+F+RCIIPN +K+SG ID+ LV++QL CNGVLEGIRICR+GFPNR L  +F QRY IL      K   D +K  E ++ +L  D S     +RIG +K+FFKAGVLA LE+ RD KL  I+  FQS  R +L  K+ + R +    + I+QRN  ++  LR W W+KL+ +VKP+L   ++ E +    +++K  +++L K     +  +++   L+EEK  +  +LE  +  L D E     L  + KD      E   +  + +D+   ++  K K++ E+  L + ++  E +L+KA+++K S D +I+ L+ ++ + ++ + KL KEKK  EE    +M  L  EE+K     K+K++ E ++ +LE+ L RE+ AR DL+K KR++E EL    +N+        ++   L++ E+++  + ++L++E    S  QRQI+D ++ I+E++E+LE E++S+ +A++AK DL  E+E L  +L + G  +  Q  V +K+E EL   ++  E+     E ++  +RKK    +  L +Q++  NK+K  VEK K Q   +  D   +L    S K ++EKL K  ELQL+E+  +  E      D  S K +  +E  D L   LE+ ES+++QLT+ +  + SQL + ++  +EE R +       +  + +   L++ LEEE + K  +   +    + +Q  K + E   + LL+ DE   ++++  ++  ELQ  L+ A ++    EK K  +  +L DA   +E      +  ++K K  +  ++E         AE D  +++ R   T + + +       + +  L      L++++ +L     + G++V  ++K   +LE + E  +  ++E E      +    R +++++  ++++++ +  K+E  +   +   + L   +A+LE E K K  ++ +KKK+E +  +L   L  + K   +  + +K+YQ     LQ +++E      D  +Q    EKR    +S   +L      +ERA++      A  RD+A E  A ++    +  + K+++E  I A+  D +E        E+++KK I+   ++  EL  E+++   ++  +   E+  KE+  +++E E  A K  K  +A  + +++ L+S+LD 
Sbjct:   27 YDSKKNVWIPDPEEGYLAGEITATKGDQVTIVTARGNEVTLKKELVQEMNPPKFEKTEDMSNLSFLNDASVLHNLRSRYAAMLIYTYSGLFCVVINPYKRLPIYTDSCARMFMGKRKTEMPPHLFAVSDEAYRNMLQDHENQSMLITGESGAGKTENTKKVICYFAAVGAS---QQEGGAEV-------DPNKKKVTLEDQIVQTNPVLEAFGNAKTVRNNNSSRFGKFIRIHFNKHGRLASCDIEHYLLEKSRVIRQAPGERCYHIFYQIY--SDFRPELKKELLLDLPIKDYWFVAQAELIIDGIDDVEEFQLTDEAFDILNFSAVEKQDCYRLMSAHMHMGNMKFKQ-RPREEQAEPDGTDEAEKASNMYGIGCEEFLKALTKPRVKVGTEWVSKGQNCEQVNWAVGAMAKGLYSRVFNWLVKKCNLTLDQKGIDRDYFIGVLDIAGFEIFDFNSFEQLWINFVNEKLQQFFNHHMFVLEQEEYAREGIQWVFIDFGLDLQACIELIEKPLGIISMLDEECIVPKATDLTLASKLVDQHLGKHPNFEKPKPPKGKQGEAHFAMRHYAGTVRYNCLNWLEKNKDPLNDTVVSAMKQSKGNDLLVE-IWQDY-TTQEEAAAKAKEGGGGGKKKGKSGSFMTVSMLYRESLNNLMTMLNKTHPHFIRCIIPNEKKQSGMIDAALVLNQLTCNGVLEGIRICRKGFPNRTLHPDFVQRYAILAAKEA-KSDDDKKKCAEAIMSKLVNDGSLSEEMFRIGLTKVFFKAGVLAHLEDIRDEKLATILTGFQSQIRWHLGLKDRKRRMEQRAGLLIVQRNVRSWCTLRTWEWFKLYGKVKPMLKAGKEAEELEKINDKVKALEDSLAKEEKLRKELEESSAKLVEEKTSLFTNLESTKTQLSDAEERLAKLEAQQKDASKQLSELNDQLADNEDRTADVQRAKKKIEAEVEALKKQIQDLEMSLRKAESEKQSKDHQIRSLQDEMQQQDEAIAKLNKEKKHQEEINRKLMEDLQSEEDKGNHQNKVKAKLEQTLDDLEDSLEREKRARADLDKQKRKVEGELKIAQENIDESGRQRHDLENNLKKKESELHSVSSRLEDEQALVSKLQRQIKDGQSRISELEEELENERQSRSKADRAKSDLQRELEELGEKLDEQGGATAAQVEVNKKREAELAKLRRDLEEANMNHENQLGGLRKKHTDAVAELTDQLDQLNKAKAKVEKDKAQAVRDAEDLAAQLDQETSGKLNNEKLAKQFELQLTELQSKADEQSRQLQDFTSLKGRLHSENGD-LVRQLEDAESQVNQLTRLKSQLTSQLEEARRTADEEARERQTVAAQAKNYQHEAEQLQESLEEEIEGKNEILRQLSKANADIQQWKARFE--GEGLLKADELEDAKRRQAQKINELQEALDAANSKNASLEKTKSRLVGDLDDAQVDVERANGVASALEKKQKGFDKIIDEWRKKTDDLAAELDGAQRDLRNTSTDLFKAKNAQEELAEVVEGLRRENKSLSQEIKDLTDQLGEGGRSVHEMQKIIRRLEIEKEELQHALDEAEAALEAEESKVLRAQVEVSQIRSEIEKRIQEKEEEFENTRKNHARALESMQASLETEAKGKAELLRIKKKLEGDINELEIALDHANKANADAQKNLKRYQEQVRELQLQVEEEQRNGADTREQFFNAEKRATLLQSEKEELLVANEAAERARKQAEYEAADARDQANEANAQVS----SLTSAKRKLEGEIQAIHADLDETLNEYKAAEERSKKAIADATRLAEELRQEQEHSQHVDRLRKGLEQQLKEIQVRLDEAEAAALKGGKKVIAKLEQRVRELESELDG 1837          
BLAST of Myosin heavy chain vs. Ensembl Celegans
Match: unc-54 (Myosin-4 [Source:UniProtKB/Swiss-Prot;Acc:P02566])

HSP 1 Score: 999.964 bits (2584), Expect = 0.000e+0
Identity = 672/1834 (36.64%), Postives = 1068/1834 (58.23%), Query Frame = 1
Query:  151 WANKKLVWIPDDNEGFISGSLIEEKGDEATVKLENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGE--LETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDR---LKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNT-VAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSID-RNRQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPMGILSLLDEECFFPKATTKTFVEKLIKNQ-STHPKLK----ATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQES--NESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDAS----NYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAES-KLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDE---SRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRT----IASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDA 5574
            + +KK VWIPD  EG+++G +   KGD+ T+    G  + L  E VQ++NPPKF K+EDM++L++LN+ASVL+NL+ RY + LIYTYSGLFCVV+NPYKRLPIYT++    + G+++ E PPH++AV+D AYRNMLQD ENQS+L TGESGAGKTENTKKVI Y A+V  S   Q+   +         D N  +  LE Q++Q NPVLEAFGNAKT++N+NSSRFGKFIRI+F+  G ++S +IE YLLEK+RVIRQA  ERC+H+FYQ+   +D R    K+ L+   +  Y  ++   + +   D+ + F+ T EA DI+  S  E++  +R+++A +HMGN++FKQ R  ++ A PD T  A+K +++ G+   E  KAL KP++K+G E V+K Q  EQ  ++V A++K  Y R+F WLV + N ++D +   +  FIG+LDIAGFEIF+ NSFEQL IN+ NEKLQQ FNH MFVLEQEEY +E I+W FIDFGLDLQ  IELIEKP+GI+S+LDEEC  PKAT  T   KL+      HP  +        + +A F + HYAG V Y   NWL KN DPLN+ VVS +++S  N+  V+ IW+D       +   A+E   GG K  + G F TV  LY+ESL  LM +LN T+P+F+RCIIPN +K+SG ID+ LV++QL CNGVLEGIRICR+GFPNR L  +F QRY IL      K   D +K  E ++ +L  D S     +RIG +K+FFKAGVLA LE+ RD KL  I+  FQS  R +L  K+ + R +    + I+QRN  ++  LR W W+KL+ +VKP+L   ++ E +    +++K  +++L K     +  +++   L+EEK  +  +LE  +  L D E     L  + KD      E   +  + +D+   ++  K K++ E+  L + ++  E +L+KA+++K S D +I+ L+ ++ + ++ + KL KEKK  EE    +M  L  EE+K     K+K++ E ++ +LE+ L RE+ AR DL+K KR++E EL    +N+        ++   L++ E+++  + ++L++E    S  QRQI+D ++ I+E++E+LE E++S+ +A++AK DL  E+E L  +L + G  +  Q  V +K+E EL   ++  E+     E ++  +RKK    +  L +Q++  NK+K  VEK K Q   +  D   +L    S K ++EKL K  ELQL+E+  +  E      D  S K +  +E  D L   LE+ ES+++QLT+ +  + SQL + ++  +EE R +       +  + +   L++ LEEE + K  +   +    + +Q  K + E   + LL+ DE   ++++  ++  ELQ  L+ A ++    EK K  +  +L DA   +E      +  ++K K  +  ++E         AE D  +++ R   T + + +       + +  L      L++++ +L     + G++V  ++K   +LE + E  +  ++E E      +    R +++++  ++++++ +  K+E  +   +   + L   +A+LE E K K  ++ +KKK+E +  +L   L  + K   +  + +K+YQ     LQ +++E      D  +Q    EKR    +S   +L      +ERA++      A  RD+A E  A ++    +  + K+++E  I A+  D +E        E+++KK I+   ++  EL  E+++   ++  +   E+  KE+  +++E E  A K  K  +A  + +++ L+S+LD 
Sbjct:   27 YDSKKNVWIPDPEEGYLAGEITATKGDQVTIVTARGNEVTLKKELVQEMNPPKFEKTEDMSNLSFLNDASVLHNLRSRYAAMLIYTYSGLFCVVINPYKRLPIYTDSCARMFMGKRKTEMPPHLFAVSDEAYRNMLQDHENQSMLITGESGAGKTENTKKVICYFAAVGAS---QQEGGAEV-------DPNKKKVTLEDQIVQTNPVLEAFGNAKTVRNNNSSRFGKFIRIHFNKHGRLASCDIEHYLLEKSRVIRQAPGERCYHIFYQIY--SDFRPELKKELLLDLPIKDYWFVAQAELIIDGIDDVEEFQLTDEAFDILNFSAVEKQDCYRLMSAHMHMGNMKFKQ-RPREEQAEPDGTDEAEKASNMYGIGCEEFLKALTKPRVKVGTEWVSKGQNCEQVNWAVGAMAKGLYSRVFNWLVKKCNLTLDQKGIDRDYFIGVLDIAGFEIFDFNSFEQLWINFVNEKLQQFFNHHMFVLEQEEYAREGIQWVFIDFGLDLQACIELIEKPLGIISMLDEECIVPKATDLTLASKLVDQHLGKHPNFEKPKPPKGKQGEAHFAMRHYAGTVRYNCLNWLEKNKDPLNDTVVSAMKQSKGNDLLVE-IWQDY-TTQEEAAAKAKEGGGGGKKKGKSGSFMTVSMLYRESLNNLMTMLNKTHPHFIRCIIPNEKKQSGMIDAALVLNQLTCNGVLEGIRICRKGFPNRTLHPDFVQRYAILAAKEA-KSDDDKKKCAEAIMSKLVNDGSLSEEMFRIGLTKVFFKAGVLAHLEDIRDEKLATILTGFQSQIRWHLGLKDRKRRMEQRAGLLIVQRNVRSWCTLRTWEWFKLYGKVKPMLKAGKEAEELEKINDKVKALEDSLAKEEKLRKELEESSAKLVEEKTSLFTNLESTKTQLSDAEERLAKLEAQQKDASKQLSELNDQLADNEDRTADVQRAKKKIEAEVEALKKQIQDLEMSLRKAESEKQSKDHQIRSLQDEMQQQDEAIAKLNKEKKHQEEINRKLMEDLQSEEDKGNHQNKVKAKLEQTLDDLEDSLEREKRARADLDKQKRKVEGELKIAQENIDESGRQRHDLENNLKKKESELHSVSSRLEDEQALVSKLQRQIKDGQSRISELEEELENERQSRSKADRAKSDLQRELEELGEKLDEQGGATAAQVEVNKKREAELAKLRRDLEEANMNHENQLGGLRKKHTDAVAELTDQLDQLNKAKAKVEKDKAQAVRDAEDLAAQLDQETSGKLNNEKLAKQFELQLTELQSKADEQSRQLQDFTSLKGRLHSENGD-LVRQLEDAESQVNQLTRLKSQLTSQLEEARRTADEEARERQTVAAQAKNYQHEAEQLQESLEEEIEGKNEILRQLSKANADIQQWKARFE--GEGLLKADELEDAKRRQAQKINELQEALDAANSKNASLEKTKSRLVGDLDDAQVDVERANGVASALEKKQKGFDKIIDEWRKKTDDLAAELDGAQRDLRNTSTDLFKAKNAQEELAEVVEGLRRENKSLSQEIKDLTDQLGEGGRSVHEMQKIIRRLEIEKEELQHALDEAEAALEAEESKVLRAQVEVSQIRSEIEKRIQEKEEEFENTRKNHARALESMQASLETEAKGKAELLRIKKKLEGDINELEIALDHANKANADAQKNLKRYQEQVRELQLQVEEEQRNGADTREQFFNAEKRATLLQSEKEELLVANEAAERARKQAEYEAADARDQANEANAQVS----SLTSAKRKLEGEIQAIHADLDETLNEYKAAEERSKKAIADATRLAEELRQEQEHSQHVDRLRKGLEQQLKEIQVRLDEAEAAALKGGKKVIAKLEQRVRELESELDG 1837          
BLAST of Myosin heavy chain vs. Ensembl Celegans
Match: unc-54 (Myosin-4 [Source:UniProtKB/Swiss-Prot;Acc:P02566])

HSP 1 Score: 999.964 bits (2584), Expect = 0.000e+0
Identity = 672/1834 (36.64%), Postives = 1068/1834 (58.23%), Query Frame = 1
Query:  151 WANKKLVWIPDDNEGFISGSLIEEKGDEATVKLENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGE--LETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDR---LKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNT-VAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSID-RNRQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPMGILSLLDEECFFPKATTKTFVEKLIKNQ-STHPKLK----ATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQES--NESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDAS----NYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAES-KLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDE---SRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRT----IASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDA 5574
            + +KK VWIPD  EG+++G +   KGD+ T+    G  + L  E VQ++NPPKF K+EDM++L++LN+ASVL+NL+ RY + LIYTYSGLFCVV+NPYKRLPIYT++    + G+++ E PPH++AV+D AYRNMLQD ENQS+L TGESGAGKTENTKKVI Y A+V  S   Q+   +         D N  +  LE Q++Q NPVLEAFGNAKT++N+NSSRFGKFIRI+F+  G ++S +IE YLLEK+RVIRQA  ERC+H+FYQ+   +D R    K+ L+   +  Y  ++   + +   D+ + F+ T EA DI+  S  E++  +R+++A +HMGN++FKQ R  ++ A PD T  A+K +++ G+   E  KAL KP++K+G E V+K Q  EQ  ++V A++K  Y R+F WLV + N ++D +   +  FIG+LDIAGFEIF+ NSFEQL IN+ NEKLQQ FNH MFVLEQEEY +E I+W FIDFGLDLQ  IELIEKP+GI+S+LDEEC  PKAT  T   KL+      HP  +        + +A F + HYAG V Y   NWL KN DPLN+ VVS +++S  N+  V+ IW+D       +   A+E   GG K  + G F TV  LY+ESL  LM +LN T+P+F+RCIIPN +K+SG ID+ LV++QL CNGVLEGIRICR+GFPNR L  +F QRY IL      K   D +K  E ++ +L  D S     +RIG +K+FFKAGVLA LE+ RD KL  I+  FQS  R +L  K+ + R +    + I+QRN  ++  LR W W+KL+ +VKP+L   ++ E +    +++K  +++L K     +  +++   L+EEK  +  +LE  +  L D E     L  + KD      E   +  + +D+   ++  K K++ E+  L + ++  E +L+KA+++K S D +I+ L+ ++ + ++ + KL KEKK  EE    +M  L  EE+K     K+K++ E ++ +LE+ L RE+ AR DL+K KR++E EL    +N+        ++   L++ E+++  + ++L++E    S  QRQI+D ++ I+E++E+LE E++S+ +A++AK DL  E+E L  +L + G  +  Q  V +K+E EL   ++  E+     E ++  +RKK    +  L +Q++  NK+K  VEK K Q   +  D   +L    S K ++EKL K  ELQL+E+  +  E      D  S K +  +E  D L   LE+ ES+++QLT+ +  + SQL + ++  +EE R +       +  + +   L++ LEEE + K  +   +    + +Q  K + E   + LL+ DE   ++++  ++  ELQ  L+ A ++    EK K  +  +L DA   +E      +  ++K K  +  ++E         AE D  +++ R   T + + +       + +  L      L++++ +L     + G++V  ++K   +LE + E  +  ++E E      +    R +++++  ++++++ +  K+E  +   +   + L   +A+LE E K K  ++ +KKK+E +  +L   L  + K   +  + +K+YQ     LQ +++E      D  +Q    EKR    +S   +L      +ERA++      A  RD+A E  A ++    +  + K+++E  I A+  D +E        E+++KK I+   ++  EL  E+++   ++  +   E+  KE+  +++E E  A K  K  +A  + +++ L+S+LD 
Sbjct:   27 YDSKKNVWIPDPEEGYLAGEITATKGDQVTIVTARGNEVTLKKELVQEMNPPKFEKTEDMSNLSFLNDASVLHNLRSRYAAMLIYTYSGLFCVVINPYKRLPIYTDSCARMFMGKRKTEMPPHLFAVSDEAYRNMLQDHENQSMLITGESGAGKTENTKKVICYFAAVGAS---QQEGGAEV-------DPNKKKVTLEDQIVQTNPVLEAFGNAKTVRNNNSSRFGKFIRIHFNKHGRLASCDIEHYLLEKSRVIRQAPGERCYHIFYQIY--SDFRPELKKELLLDLPIKDYWFVAQAELIIDGIDDVEEFQLTDEAFDILNFSAVEKQDCYRLMSAHMHMGNMKFKQ-RPREEQAEPDGTDEAEKASNMYGIGCEEFLKALTKPRVKVGTEWVSKGQNCEQVNWAVGAMAKGLYSRVFNWLVKKCNLTLDQKGIDRDYFIGVLDIAGFEIFDFNSFEQLWINFVNEKLQQFFNHHMFVLEQEEYAREGIQWVFIDFGLDLQACIELIEKPLGIISMLDEECIVPKATDLTLASKLVDQHLGKHPNFEKPKPPKGKQGEAHFAMRHYAGTVRYNCLNWLEKNKDPLNDTVVSAMKQSKGNDLLVE-IWQDY-TTQEEAAAKAKEGGGGGKKKGKSGSFMTVSMLYRESLNNLMTMLNKTHPHFIRCIIPNEKKQSGMIDAALVLNQLTCNGVLEGIRICRKGFPNRTLHPDFVQRYAILAAKEA-KSDDDKKKCAEAIMSKLVNDGSLSEEMFRIGLTKVFFKAGVLAHLEDIRDEKLATILTGFQSQIRWHLGLKDRKRRMEQRAGLLIVQRNVRSWCTLRTWEWFKLYGKVKPMLKAGKEAEELEKINDKVKALEDSLAKEEKLRKELEESSAKLVEEKTSLFTNLESTKTQLSDAEERLAKLEAQQKDASKQLSELNDQLADNEDRTADVQRAKKKIEAEVEALKKQIQDLEMSLRKAESEKQSKDHQIRSLQDEMQQQDEAIAKLNKEKKHQEEINRKLMEDLQSEEDKGNHQNKVKAKLEQTLDDLEDSLEREKRARADLDKQKRKVEGELKIAQENIDESGRQRHDLENNLKKKESELHSVSSRLEDEQALVSKLQRQIKDGQSRISELEEELENERQSRSKADRAKSDLQRELEELGEKLDEQGGATAAQVEVNKKREAELAKLRRDLEEANMNHENQLGGLRKKHTDAVAELTDQLDQLNKAKAKVEKDKAQAVRDAEDLAAQLDQETSGKLNNEKLAKQFELQLTELQSKADEQSRQLQDFTSLKGRLHSENGD-LVRQLEDAESQVNQLTRLKSQLTSQLEEARRTADEEARERQTVAAQAKNYQHEAEQLQESLEEEIEGKNEILRQLSKANADIQQWKARFE--GEGLLKADELEDAKRRQAQKINELQEALDAANSKNASLEKTKSRLVGDLDDAQVDVERANGVASALEKKQKGFDKIIDEWRKKTDDLAAELDGAQRDLRNTSTDLFKAKNAQEELAEVVEGLRRENKSLSQEIKDLTDQLGEGGRSVHEMQKIIRRLEIEKEELQHALDEAEAALEAEESKVLRAQVEVSQIRSEIEKRIQEKEEEFENTRKNHARALESMQASLETEAKGKAELLRIKKKLEGDINELEIALDHANKANADAQKNLKRYQEQVRELQLQVEEEQRNGADTREQFFNAEKRATLLQSEKEELLVANEAAERARKQAEYEAADARDQANEANAQVS----SLTSAKRKLEGEIQAIHADLDETLNEYKAAEERSKKAIADATRLAEELRQEQEHSQHVDRLRKGLEQQLKEIQVRLDEAEAAALKGGKKVIAKLEQRVRELESELDG 1837          
BLAST of Myosin heavy chain vs. Ensembl Fly
Match: zip (gene:FBgn0265434 transcript:FBtr0302572)

HSP 1 Score: 1714.51 bits (4439), Expect = 0.000e+0
Identity = 971/1936 (50.15%), Postives = 1367/1936 (70.61%), Query Frame = 1
Query:   73 ENIDAKD--LQYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPMGILSLLDEECFFPKATTKTFVEKLIKNQSTHPKLKATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKIDR 5868
            E +D  D  L+YL V+++  +D A  ++W  K+LVW+P +N+GF++ S+  E GDE  V+L E GK + +  +++QK+NPPKF K EDMA+LT LNEASVL+N+KDRY+S LIYTYSGLFCVVVNPYK+LPIYT  ++E YKG KRHE PPH++A+TD AYRNML D+E+QSILCTGESGAGKTENTKKVIQ+LA VA S    K   S A+       V IGELE QLLQANP+LEAFGNAKT+KNDNSSRFGKFIRINFD SGFIS ANIETYLLEK+R IRQA +ER FH+FYQLL GA    +++ IL++V +Y  LSNG + VP  D+   F+ TV++++IMG++ ++  SIFR+++AVL  G+++F+QER++DQA LPDNTVAQK+AHLLGL VT+MT+A L P++K+GR+ V KAQTKEQ EF+VEAI+K+ YERMF+WLV RINRS+DR  RQ  +FIGILD+AGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W+FIDFGLDLQPTI+LI+KP GI++LLDEEC+FPKAT KTFV+KL+   S HPK   TDFR  ADF ++HYAG+VDY +  WL+KNMDPLNEN+VSLLQ S + FV  IWKDAE I+G++     ++ FG    TRKGMFRTV  LYKE L KLMD L NTNPNFVRCIIPNHEK++GKID+ LV+DQL+CNGVLEGIRICRQGFPNRI FQEF+QRY +LTPNVI KGFMDG+KA E M+  L++D++ YR+GQSKIFF+AGVLA LEE+RD K++++IV FQ++ RG+LAR+N Q R Q LNAI+IIQRNC AYLKLRNW WW+L+T+VKPLL VT+QEE +  KE+ELK+ +E L+ +  + +  ++ Y+  + EK  + E L+ E     + E  R  L+ R +++E   QE E+R  E +++   L  EK KL+  I  L + LE EE   QK Q +K+  D +IK+ E+ +A  +D+  KL KEKK LEER  D+  TLAEEEEK+K L KLK++HE +I+ELEERL ++Q  RQ+ +++KR++ETE+++  + L+ +    +E++  L + E ++ Q   ++DEE+  K+ AQ+  R+ E+ + EI+EDLEAEK ++ +AEK +RDL+EE+E+LK ELLD+ +T+  QQ +  K+E EL   KKS E+ET   E  + ++R K +  + ++N+Q+E   K+K V+EKAK  L+ E  D   EL ++ SS+ ++++ +K  E Q++E+  +L+E E  + + + K  K  + A+ +   LEE E K S   KS  ++ SQL + Q+  EEETR KL   + LRQ+ES+   L++QLEE+ ++K N E  +  + +QMQ++KKK EEDA    E +E +K++ ++ E L+ +++E I Q +R +K+K+ IQ+EL+DA   LE+Q+    + ++K K  +  + E   ++++   E+DT E+E REKETK++ + RE++   DK+ +LEN +  L  +L++L +++    KNV  LEKAK  LE+ L   K   EELE++    +  K R+E+ + A ++Q +R+L +K+E  +E+ R + K+LRD E  L+EE+K +TA V+ KKK+E +  ++   +    KVKE+  +  KK Q    +  R+ +E  AAK +     KE E++++  E+ V QL+EDL+ SERA+R   +ERDE  EEIA         I +K+R+E+ I+ L  + EE Q     L D+++K   Q+EQ+  EL  E+ N  + EN ++  ER NKEL  K+ E+E     K KAT+A  ++KI +L+ QL+ + +E     + N+K+++K+KE+   + DE +  D   EQ++K   R K  +R+L   +E      TQ R+ QR+ E++ E++EA ++EI  LKTK+ R
Sbjct:    3 EEVDRNDPELKYLSVERNQFNDPATQAEWTQKRLVWVPHENQGFVAASIKREHGDEVEVELAETGKRVMILRDDIQKMNPPKFDKVEDMAELTCLNEASVLHNIKDRYYSGLIYTYSGLFCVVVNPYKKLPIYTEKIMERYKGIKRHEVPPHVFAITDSAYRNMLGDREDQSILCTGESGAGKTENTKKVIQFLAYVAAS----KPKGSGAVPH---PAVLIGELEQQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDASGFISGANIETYLLEKSRAIRQAKDERTFHIFYQLLAGATPEQREKFILDDVKSYAFLSNGSLPVPGVDDYAEFQATVKSMNIMGMTSEDFNSIFRIVSAVLLFGSMKFRQERNNDQATLPDNTVAQKIAHLLGLSVTDMTRAFLTPRIKVGRDFVTKAQTKEQVEFAVEAIAKACYERMFKWLVNRINRSLDRTKRQGASFIGILDMAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWKFIDFGLDLQPTIDLIDKPGGIMALLDEECWFPKATDKTFVDKLVSAHSMHPKFMKTDFRGVADFAIVHYAGRVDYSAAKWLMKNMDPLNENIVSLLQGSQDPFVVNIWKDAE-IVGMAQQALTDTQFGA--RTRKGMFRTVSHLYKEQLAKLMDTLRNTNPNFVRCIIPNHEKRAGKIDAPLVLDQLRCNGVLEGIRICRQGFPNRIPFQEFRQRYELLTPNVIPKGFMDGKKACEKMIQALELDSNLYRVGQSKIFFRAGVLAHLEEERDFKISDLIVNFQAFCRGFLARRNYQKRLQQLNAIRIIQRNCAAYLKLRNWQWWRLYTKVKPLLEVTKQEEKLVQKEDELKQVREKLDTLAKNTQEYERKYQQALVEKTTLAEQLQAEIELCAEAEESRSRLMARKQELEDMMQELETRIEEEEERVLALGGEKKKLELNIQDLEEQLEEEEAARQKLQLEKVQLDAKIKKYEEDLALTDDQNQKLLKEKKLLEERANDLSQTLAEEEEKAKHLAKLKAKHEATISELEERLHKDQQQRQESDRSKRKIETEVADLKEQLNERRVQVDEMQAQLAKREEELTQTLLRIDEESATKATAQKAQRELESQLAEIQEDLEAEKAARAKAEKVRRDLSEELEALKNELLDSLDTTAAQQELRSKREQELATLKKSLEEETVNHEGVLADMRHKHSQELNSINDQLENLRKAKTVLEKAKGTLEAENADLATELRSVNSSRQENDRRRKQAESQIAELQVKLAEIERARSELQEKCTKLQQEAENITNQLEEAELKASAAVKSASNMESQLTEAQQLLEEETRQKLGLSSKLRQIESEKEALQEQLEEDDEAKRNYERKLAEVTTQMQEIKKKAEEDADLAKELEEGKKRLNKDIEALERQVKELIAQNDRLDKSKKKIQSELEDATIELEAQRTKVLELEKKQKNFDKILAEEKAISEQIAQERDTAEREAREKETKVLSVSRELDEAFDKIEDLENKRKTLQNELDDLANTQGTADKNVHELEKAKRALESQLAELKAQNEELEDDLQLTEDAKLRLEVNMQALRSQFERDLLAKEEGAEEKRRGLVKQLRDLETELDEERKQRTAAVASKKKLEGDLKEIETTMEMHNKVKEDALKHAKKLQAQVKDALRDAEEAKAAKEELQALSKEAERKVKALEAEVLQLTEDLASSERARRAAETERDELAEEIANNANKGSLMIDEKRRLEARIATLEEELEEEQSNSEVLLDRSRKAQLQIEQLTTELANEKSNSQKNENGRALLERQNKELKAKLAEIETAQRTKVKATIATLEAKIANLEEQLENEGKERLLQQKANRKMDKKIKELTMNIEDERRHVDQHKEQMDKLNSRIKLLKRNLDETEEELQKEKTQKRKYQRECEDMIESQEAMNREINSLKTKLRR 1928          
BLAST of Myosin heavy chain vs. Ensembl Fly
Match: zip (gene:FBgn0265434 transcript:FBtr0302574)

HSP 1 Score: 1714.51 bits (4439), Expect = 0.000e+0
Identity = 971/1936 (50.15%), Postives = 1367/1936 (70.61%), Query Frame = 1
Query:   73 ENIDAKD--LQYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPMGILSLLDEECFFPKATTKTFVEKLIKNQSTHPKLKATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKIDR 5868
            E +D  D  L+YL V+++  +D A  ++W  K+LVW+P +N+GF++ S+  E GDE  V+L E GK + +  +++QK+NPPKF K EDMA+LT LNEASVL+N+KDRY+S LIYTYSGLFCVVVNPYK+LPIYT  ++E YKG KRHE PPH++A+TD AYRNML D+E+QSILCTGESGAGKTENTKKVIQ+LA VA S    K   S A+       V IGELE QLLQANP+LEAFGNAKT+KNDNSSRFGKFIRINFD SGFIS ANIETYLLEK+R IRQA +ER FH+FYQLL GA    +++ IL++V +Y  LSNG + VP  D+   F+ TV++++IMG++ ++  SIFR+++AVL  G+++F+QER++DQA LPDNTVAQK+AHLLGL VT+MT+A L P++K+GR+ V KAQTKEQ EF+VEAI+K+ YERMF+WLV RINRS+DR  RQ  +FIGILD+AGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W+FIDFGLDLQPTI+LI+KP GI++LLDEEC+FPKAT KTFV+KL+   S HPK   TDFR  ADF ++HYAG+VDY +  WL+KNMDPLNEN+VSLLQ S + FV  IWKDAE I+G++     ++ FG    TRKGMFRTV  LYKE L KLMD L NTNPNFVRCIIPNHEK++GKID+ LV+DQL+CNGVLEGIRICRQGFPNRI FQEF+QRY +LTPNVI KGFMDG+KA E M+  L++D++ YR+GQSKIFF+AGVLA LEE+RD K++++IV FQ++ RG+LAR+N Q R Q LNAI+IIQRNC AYLKLRNW WW+L+T+VKPLL VT+QEE +  KE+ELK+ +E L+ +  + +  ++ Y+  + EK  + E L+ E     + E  R  L+ R +++E   QE E+R  E +++   L  EK KL+  I  L + LE EE   QK Q +K+  D +IK+ E+ +A  +D+  KL KEKK LEER  D+  TLAEEEEK+K L KLK++HE +I+ELEERL ++Q  RQ+ +++KR++ETE+++  + L+ +    +E++  L + E ++ Q   ++DEE+  K+ AQ+  R+ E+ + EI+EDLEAEK ++ +AEK +RDL+EE+E+LK ELLD+ +T+  QQ +  K+E EL   KKS E+ET   E  + ++R K +  + ++N+Q+E   K+K V+EKAK  L+ E  D   EL ++ SS+ ++++ +K  E Q++E+  +L+E E  + + + K  K  + A+ +   LEE E K S   KS  ++ SQL + Q+  EEETR KL   + LRQ+ES+   L++QLEE+ ++K N E  +  + +QMQ++KKK EEDA    E +E +K++ ++ E L+ +++E I Q +R +K+K+ IQ+EL+DA   LE+Q+    + ++K K  +  + E   ++++   E+DT E+E REKETK++ + RE++   DK+ +LEN +  L  +L++L +++    KNV  LEKAK  LE+ L   K   EELE++    +  K R+E+ + A ++Q +R+L +K+E  +E+ R + K+LRD E  L+EE+K +TA V+ KKK+E +  ++   +    KVKE+  +  KK Q    +  R+ +E  AAK +     KE E++++  E+ V QL+EDL+ SERA+R   +ERDE  EEIA         I +K+R+E+ I+ L  + EE Q     L D+++K   Q+EQ+  EL  E+ N  + EN ++  ER NKEL  K+ E+E     K KAT+A  ++KI +L+ QL+ + +E     + N+K+++K+KE+   + DE +  D   EQ++K   R K  +R+L   +E      TQ R+ QR+ E++ E++EA ++EI  LKTK+ R
Sbjct:    3 EEVDRNDPELKYLSVERNQFNDPATQAEWTQKRLVWVPHENQGFVAASIKREHGDEVEVELAETGKRVMILRDDIQKMNPPKFDKVEDMAELTCLNEASVLHNIKDRYYSGLIYTYSGLFCVVVNPYKKLPIYTEKIMERYKGIKRHEVPPHVFAITDSAYRNMLGDREDQSILCTGESGAGKTENTKKVIQFLAYVAAS----KPKGSGAVPH---PAVLIGELEQQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDASGFISGANIETYLLEKSRAIRQAKDERTFHIFYQLLAGATPEQREKFILDDVKSYAFLSNGSLPVPGVDDYAEFQATVKSMNIMGMTSEDFNSIFRIVSAVLLFGSMKFRQERNNDQATLPDNTVAQKIAHLLGLSVTDMTRAFLTPRIKVGRDFVTKAQTKEQVEFAVEAIAKACYERMFKWLVNRINRSLDRTKRQGASFIGILDMAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWKFIDFGLDLQPTIDLIDKPGGIMALLDEECWFPKATDKTFVDKLVSAHSMHPKFMKTDFRGVADFAIVHYAGRVDYSAAKWLMKNMDPLNENIVSLLQGSQDPFVVNIWKDAE-IVGMAQQALTDTQFGA--RTRKGMFRTVSHLYKEQLAKLMDTLRNTNPNFVRCIIPNHEKRAGKIDAPLVLDQLRCNGVLEGIRICRQGFPNRIPFQEFRQRYELLTPNVIPKGFMDGKKACEKMIQALELDSNLYRVGQSKIFFRAGVLAHLEEERDFKISDLIVNFQAFCRGFLARRNYQKRLQQLNAIRIIQRNCAAYLKLRNWQWWRLYTKVKPLLEVTKQEEKLVQKEDELKQVREKLDTLAKNTQEYERKYQQALVEKTTLAEQLQAEIELCAEAEESRSRLMARKQELEDMMQELETRIEEEEERVLALGGEKKKLELNIQDLEEQLEEEEAARQKLQLEKVQLDAKIKKYEEDLALTDDQNQKLLKEKKLLEERANDLSQTLAEEEEKAKHLAKLKAKHEATISELEERLHKDQQQRQESDRSKRKIETEVADLKEQLNERRVQVDEMQAQLAKREEELTQTLLRIDEESATKATAQKAQRELESQLAEIQEDLEAEKAARAKAEKVRRDLSEELEALKNELLDSLDTTAAQQELRSKREQELATLKKSLEEETVNHEGVLADMRHKHSQELNSINDQLENLRKAKTVLEKAKGTLEAENADLATELRSVNSSRQENDRRRKQAESQIAELQVKLAEIERARSELQEKCTKLQQEAENITNQLEEAELKASAAVKSASNMESQLTEAQQLLEEETRQKLGLSSKLRQIESEKEALQEQLEEDDEAKRNYERKLAEVTTQMQEIKKKAEEDADLAKELEEGKKRLNKDIEALERQVKELIAQNDRLDKSKKKIQSELEDATIELEAQRTKVLELEKKQKNFDKILAEEKAISEQIAQERDTAEREAREKETKVLSVSRELDEAFDKIEDLENKRKTLQNELDDLANTQGTADKNVHELEKAKRALESQLAELKAQNEELEDDLQLTEDAKLRLEVNMQALRSQFERDLLAKEEGAEEKRRGLVKQLRDLETELDEERKQRTAAVASKKKLEGDLKEIETTMEMHNKVKEDALKHAKKLQAQVKDALRDAEEAKAAKEELQALSKEAERKVKALEAEVLQLTEDLASSERARRAAETERDELAEEIANNANKGSLMIDEKRRLEARIATLEEELEEEQSNSEVLLDRSRKAQLQIEQLTTELANEKSNSQKNENGRALLERQNKELKAKLAEIETAQRTKVKATIATLEAKIANLEEQLENEGKERLLQQKANRKMDKKIKELTMNIEDERRHVDQHKEQMDKLNSRIKLLKRNLDETEEELQKEKTQKRKYQRECEDMIESQEAMNREINSLKTKLRR 1928          
BLAST of Myosin heavy chain vs. Ensembl Fly
Match: zip (gene:FBgn0265434 transcript:FBtr0100466)

HSP 1 Score: 1714.51 bits (4439), Expect = 0.000e+0
Identity = 971/1936 (50.15%), Postives = 1367/1936 (70.61%), Query Frame = 1
Query:   73 ENIDAKD--LQYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPMGILSLLDEECFFPKATTKTFVEKLIKNQSTHPKLKATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKIDR 5868
            E +D  D  L+YL V+++  +D A  ++W  K+LVW+P +N+GF++ S+  E GDE  V+L E GK + +  +++QK+NPPKF K EDMA+LT LNEASVL+N+KDRY+S LIYTYSGLFCVVVNPYK+LPIYT  ++E YKG KRHE PPH++A+TD AYRNML D+E+QSILCTGESGAGKTENTKKVIQ+LA VA S    K   S A+       V IGELE QLLQANP+LEAFGNAKT+KNDNSSRFGKFIRINFD SGFIS ANIETYLLEK+R IRQA +ER FH+FYQLL GA    +++ IL++V +Y  LSNG + VP  D+   F+ TV++++IMG++ ++  SIFR+++AVL  G+++F+QER++DQA LPDNTVAQK+AHLLGL VT+MT+A L P++K+GR+ V KAQTKEQ EF+VEAI+K+ YERMF+WLV RINRS+DR  RQ  +FIGILD+AGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W+FIDFGLDLQPTI+LI+KP GI++LLDEEC+FPKAT KTFV+KL+   S HPK   TDFR  ADF ++HYAG+VDY +  WL+KNMDPLNEN+VSLLQ S + FV  IWKDAE I+G++     ++ FG    TRKGMFRTV  LYKE L KLMD L NTNPNFVRCIIPNHEK++GKID+ LV+DQL+CNGVLEGIRICRQGFPNRI FQEF+QRY +LTPNVI KGFMDG+KA E M+  L++D++ YR+GQSKIFF+AGVLA LEE+RD K++++IV FQ++ RG+LAR+N Q R Q LNAI+IIQRNC AYLKLRNW WW+L+T+VKPLL VT+QEE +  KE+ELK+ +E L+ +  + +  ++ Y+  + EK  + E L+ E     + E  R  L+ R +++E   QE E+R  E +++   L  EK KL+  I  L + LE EE   QK Q +K+  D +IK+ E+ +A  +D+  KL KEKK LEER  D+  TLAEEEEK+K L KLK++HE +I+ELEERL ++Q  RQ+ +++KR++ETE+++  + L+ +    +E++  L + E ++ Q   ++DEE+  K+ AQ+  R+ E+ + EI+EDLEAEK ++ +AEK +RDL+EE+E+LK ELLD+ +T+  QQ +  K+E EL   KKS E+ET   E  + ++R K +  + ++N+Q+E   K+K V+EKAK  L+ E  D   EL ++ SS+ ++++ +K  E Q++E+  +L+E E  + + + K  K  + A+ +   LEE E K S   KS  ++ SQL + Q+  EEETR KL   + LRQ+ES+   L++QLEE+ ++K N E  +  + +QMQ++KKK EEDA    E +E +K++ ++ E L+ +++E I Q +R +K+K+ IQ+EL+DA   LE+Q+    + ++K K  +  + E   ++++   E+DT E+E REKETK++ + RE++   DK+ +LEN +  L  +L++L +++    KNV  LEKAK  LE+ L   K   EELE++    +  K R+E+ + A ++Q +R+L +K+E  +E+ R + K+LRD E  L+EE+K +TA V+ KKK+E +  ++   +    KVKE+  +  KK Q    +  R+ +E  AAK +     KE E++++  E+ V QL+EDL+ SERA+R   +ERDE  EEIA         I +K+R+E+ I+ L  + EE Q     L D+++K   Q+EQ+  EL  E+ N  + EN ++  ER NKEL  K+ E+E     K KAT+A  ++KI +L+ QL+ + +E     + N+K+++K+KE+   + DE +  D   EQ++K   R K  +R+L   +E      TQ R+ QR+ E++ E++EA ++EI  LKTK+ R
Sbjct:    3 EEVDRNDPELKYLSVERNQFNDPATQAEWTQKRLVWVPHENQGFVAASIKREHGDEVEVELAETGKRVMILRDDIQKMNPPKFDKVEDMAELTCLNEASVLHNIKDRYYSGLIYTYSGLFCVVVNPYKKLPIYTEKIMERYKGIKRHEVPPHVFAITDSAYRNMLGDREDQSILCTGESGAGKTENTKKVIQFLAYVAAS----KPKGSGAVPH---PAVLIGELEQQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDASGFISGANIETYLLEKSRAIRQAKDERTFHIFYQLLAGATPEQREKFILDDVKSYAFLSNGSLPVPGVDDYAEFQATVKSMNIMGMTSEDFNSIFRIVSAVLLFGSMKFRQERNNDQATLPDNTVAQKIAHLLGLSVTDMTRAFLTPRIKVGRDFVTKAQTKEQVEFAVEAIAKACYERMFKWLVNRINRSLDRTKRQGASFIGILDMAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWKFIDFGLDLQPTIDLIDKPGGIMALLDEECWFPKATDKTFVDKLVSAHSMHPKFMKTDFRGVADFAIVHYAGRVDYSAAKWLMKNMDPLNENIVSLLQGSQDPFVVNIWKDAE-IVGMAQQALTDTQFGA--RTRKGMFRTVSHLYKEQLAKLMDTLRNTNPNFVRCIIPNHEKRAGKIDAPLVLDQLRCNGVLEGIRICRQGFPNRIPFQEFRQRYELLTPNVIPKGFMDGKKACEKMIQALELDSNLYRVGQSKIFFRAGVLAHLEEERDFKISDLIVNFQAFCRGFLARRNYQKRLQQLNAIRIIQRNCAAYLKLRNWQWWRLYTKVKPLLEVTKQEEKLVQKEDELKQVREKLDTLAKNTQEYERKYQQALVEKTTLAEQLQAEIELCAEAEESRSRLMARKQELEDMMQELETRIEEEEERVLALGGEKKKLELNIQDLEEQLEEEEAARQKLQLEKVQLDAKIKKYEEDLALTDDQNQKLLKEKKLLEERANDLSQTLAEEEEKAKHLAKLKAKHEATISELEERLHKDQQQRQESDRSKRKIETEVADLKEQLNERRVQVDEMQAQLAKREEELTQTLLRIDEESATKATAQKAQRELESQLAEIQEDLEAEKAARAKAEKVRRDLSEELEALKNELLDSLDTTAAQQELRSKREQELATLKKSLEEETVNHEGVLADMRHKHSQELNSINDQLENLRKAKTVLEKAKGTLEAENADLATELRSVNSSRQENDRRRKQAESQIAELQVKLAEIERARSELQEKCTKLQQEAENITNQLEEAELKASAAVKSASNMESQLTEAQQLLEEETRQKLGLSSKLRQIESEKEALQEQLEEDDEAKRNYERKLAEVTTQMQEIKKKAEEDADLAKELEEGKKRLNKDIEALERQVKELIAQNDRLDKSKKKIQSELEDATIELEAQRTKVLELEKKQKNFDKILAEEKAISEQIAQERDTAEREAREKETKVLSVSRELDEAFDKIEDLENKRKTLQNELDDLANTQGTADKNVHELEKAKRALESQLAELKAQNEELEDDLQLTEDAKLRLEVNMQALRSQFERDLLAKEEGAEEKRRGLVKQLRDLETELDEERKQRTAAVASKKKLEGDLKEIETTMEMHNKVKEDALKHAKKLQAQVKDALRDAEEAKAAKEELQALSKEAERKVKALEAEVLQLTEDLASSERARRAAETERDELAEEIANNANKGSLMIDEKRRLEARIATLEEELEEEQSNSEVLLDRSRKAQLQIEQLTTELANEKSNSQKNENGRALLERQNKELKAKLAEIETAQRTKVKATIATLEAKIANLEEQLENEGKERLLQQKANRKMDKKIKELTMNIEDERRHVDQHKEQMDKLNSRIKLLKRNLDETEEELQKEKTQKRKYQRECEDMIESQEAMNREINSLKTKLRR 1928          
BLAST of Myosin heavy chain vs. Ensembl Fly
Match: zip (gene:FBgn0265434 transcript:FBtr0100467)

HSP 1 Score: 1712.58 bits (4434), Expect = 0.000e+0
Identity = 971/1936 (50.15%), Postives = 1367/1936 (70.61%), Query Frame = 1
Query:   73 ENIDAKD--LQYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPMGILSLLDEECFFPKATTKTFVEKLIKNQSTHPKLKATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKIDR 5868
            E +D  D  L+YL V+++  +D A  ++W  K+LVW+P +N+GF++ S+  E GDE  V+L E GK + +  +++QK+NPPKF K EDMA+LT LNEASVL+N+KDRY+S LIYTYSGLFCVVVNPYK+LPIYT  ++E YKG KRHE PPH++A+TD AYRNML D+E+QSILCTGESGAGKTENTKKVIQ+LA VA S    K   S A+       V IGELE QLLQANP+LEAFGNAKT+KNDNSSRFGKFIRINFD SGFIS ANIETYLLEK+R IRQA +ER FH+FYQLL GA    +++ IL++V +Y  LSNG + VP  D+   F+ TV++++IMG++ ++  SIFR+++AVL  G+++F+QER++DQA LPDNTVAQK+AHLLGL VT+MT+A L P++K+GR+ V KAQTKEQ EF+VEAI+K+ YERMF+WLV RINRS+DR  RQ  +FIGILD+AGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W+FIDFGLDLQPTI+LI+KP GI++LLDEEC+FPKAT KTFV+KL+   S HPK   TDFR  ADF ++HYAG+VDY +  WL+KNMDPLNEN+VSLLQ S + FV  IWKDAE I+G++     ++ FG    TRKGMFRTV  LYKE L KLMD L NTNPNFVRCIIPNHEK++GKID+ LV+DQL+CNGVLEGIRICRQGFPNRI FQEF+QRY +LTPNVI KGFMDG+KA E M+  L++D++ YR+GQSKIFF+AGVLA LEE+RD K++++IV FQ++ RG+LAR+N Q R Q LNAI+IIQRNC AYLKLRNW WW+L+T+VKPLL VT+QEE +  KE+ELK+ +E L+ +  + +  ++ Y+  + EK  + E L+ E     + E  R  L+ R +++E   QE E+R  E +++   L  EK KL+  I  L + LE EE   QK Q +K+  D +IK+ E+ +A  +D+  KL KEKK LEER  D+  TLAEEEEK+K L KLK++HE +I+ELEERL ++Q  RQ+ +++KR++ETE+++  + L+ +    +E++  L + E ++ Q   ++DEE+  K+ AQ+  R+ E+ + EI+EDLEAEK ++ +AEK +RDL+EE+E+LK ELLD+ +T+  QQ +  K+E EL   KKS E+ET   E  + ++R K +  + ++N+Q+E   K+K V+EKAK  L+ E  D   EL ++ SS+ ++++ +K  E Q++E+  +L+E E  + + + K  K  + A+ +   LEE E K S   KS  ++ SQL + Q+  EEETR KL   + LRQ+ES+   L++QLEE+ ++K N E  +  + +QMQ++KKK EEDA    E +E +K++ ++ E L+ +++E I Q +R +K+K+ IQ+EL+DA   LE+Q+    + ++K K  +  + E   ++++   E+DT E+E REKETK++ + RE++   DK+ +LEN +  L  +L++L +++    KNV  LEKAK  LE+ L   K   EELE++    +  K R+E+ + A ++Q +R+L +K+E  +E+ R + K+LRD E  L+EE+K +TA V+ KKK+E +  ++   +    KVKE+  +  KK Q    +  R+ +E  AAK +     KE E++++  E+ V QL+EDL+ SERA+R   +ERDE  EEIA         I +K+R+E+ I+ L  + EE Q     L D+++K   Q+EQ+  EL  E+ N  + EN ++  ER NKEL  K+ E+E     K KAT+A  ++KI +L+ QL+ + +E     + N+K+++K+KE+   + DE +  D   EQ++K   R K  +R+L   +E      TQ R+ QR+ E++ E++EA ++EI  LKTK+ R
Sbjct:   48 EEVDRNDPELKYLSVERNQFNDPATQAEWTQKRLVWVPHENQGFVAASIKREHGDEVEVELAETGKRVMILRDDIQKMNPPKFDKVEDMAELTCLNEASVLHNIKDRYYSGLIYTYSGLFCVVVNPYKKLPIYTEKIMERYKGIKRHEVPPHVFAITDSAYRNMLGDREDQSILCTGESGAGKTENTKKVIQFLAYVAAS----KPKGSGAVPH---PAVLIGELEQQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDASGFISGANIETYLLEKSRAIRQAKDERTFHIFYQLLAGATPEQREKFILDDVKSYAFLSNGSLPVPGVDDYAEFQATVKSMNIMGMTSEDFNSIFRIVSAVLLFGSMKFRQERNNDQATLPDNTVAQKIAHLLGLSVTDMTRAFLTPRIKVGRDFVTKAQTKEQVEFAVEAIAKACYERMFKWLVNRINRSLDRTKRQGASFIGILDMAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWKFIDFGLDLQPTIDLIDKPGGIMALLDEECWFPKATDKTFVDKLVSAHSMHPKFMKTDFRGVADFAIVHYAGRVDYSAAKWLMKNMDPLNENIVSLLQGSQDPFVVNIWKDAE-IVGMAQQALTDTQFGA--RTRKGMFRTVSHLYKEQLAKLMDTLRNTNPNFVRCIIPNHEKRAGKIDAPLVLDQLRCNGVLEGIRICRQGFPNRIPFQEFRQRYELLTPNVIPKGFMDGKKACEKMIQALELDSNLYRVGQSKIFFRAGVLAHLEEERDFKISDLIVNFQAFCRGFLARRNYQKRLQQLNAIRIIQRNCAAYLKLRNWQWWRLYTKVKPLLEVTKQEEKLVQKEDELKQVREKLDTLAKNTQEYERKYQQALVEKTTLAEQLQAEIELCAEAEESRSRLMARKQELEDMMQELETRIEEEEERVLALGGEKKKLELNIQDLEEQLEEEEAARQKLQLEKVQLDAKIKKYEEDLALTDDQNQKLLKEKKLLEERANDLSQTLAEEEEKAKHLAKLKAKHEATISELEERLHKDQQQRQESDRSKRKIETEVADLKEQLNERRVQVDEMQAQLAKREEELTQTLLRIDEESATKATAQKAQRELESQLAEIQEDLEAEKAARAKAEKVRRDLSEELEALKNELLDSLDTTAAQQELRSKREQELATLKKSLEEETVNHEGVLADMRHKHSQELNSINDQLENLRKAKTVLEKAKGTLEAENADLATELRSVNSSRQENDRRRKQAESQIAELQVKLAEIERARSELQEKCTKLQQEAENITNQLEEAELKASAAVKSASNMESQLTEAQQLLEEETRQKLGLSSKLRQIESEKEALQEQLEEDDEAKRNYERKLAEVTTQMQEIKKKAEEDADLAKELEEGKKRLNKDIEALERQVKELIAQNDRLDKSKKKIQSELEDATIELEAQRTKVLELEKKQKNFDKILAEEKAISEQIAQERDTAEREAREKETKVLSVSRELDEAFDKIEDLENKRKTLQNELDDLANTQGTADKNVHELEKAKRALESQLAELKAQNEELEDDLQLTEDAKLRLEVNMQALRSQFERDLLAKEEGAEEKRRGLVKQLRDLETELDEERKQRTAAVASKKKLEGDLKEIETTMEMHNKVKEDALKHAKKLQAQVKDALRDAEEAKAAKEELQALSKEAERKVKALEAEVLQLTEDLASSERARRAAETERDELAEEIANNANKGSLMIDEKRRLEARIATLEEELEEEQSNSEVLLDRSRKAQLQIEQLTTELANEKSNSQKNENGRALLERQNKELKAKLAEIETAQRTKVKATIATLEAKIANLEEQLENEGKERLLQQKANRKMDKKIKELTMNIEDERRHVDQHKEQMDKLNSRIKLLKRNLDETEEELQKEKTQKRKYQRECEDMIESQEAMNREINSLKTKLRR 1973          
BLAST of Myosin heavy chain vs. Ensembl Fly
Match: zip (gene:FBgn0265434 transcript:FBtr0302573)

HSP 1 Score: 1711.04 bits (4430), Expect = 0.000e+0
Identity = 967/1937 (49.92%), Postives = 1365/1937 (70.47%), Query Frame = 1
Query:   73 ENIDAKD--LQYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAH-DVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPMGILSLLDEECFFPKATTKTFVEKLIKNQSTHPKLKATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKIDR 5868
            E +D  D  L+YL V+++  +D A  ++W  K+LVW+P +N+GF++ S+  E GDE  V+L E GK + +  +++QK+NPPKF K EDMA+LT LNEASVL+N+KDRY+S LIYTYSGLFCVVVNPYK+LPIYT  ++E YKG KRHE PPH++A+TD AYRNML D+E+QSILCTGESGAGKTENTKKVIQ+LA VA S         +      +H +   GELE QLLQANP+LEAFGNAKT+KNDNSSRFGKFIRINFD SGFIS ANIETYLLEK+R IRQA +ER FH+FYQLL GA    +++ IL++V +Y  LSNG + VP  D+   F+ TV++++IMG++ ++  SIFR+++AVL  G+++F+QER++DQA LPDNTVAQK+AHLLGL VT+MT+A L P++K+GR+ V KAQTKEQ EF+VEAI+K+ YERMF+WLV RINRS+DR  RQ  +FIGILD+AGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W+FIDFGLDLQPTI+LI+KP GI++LLDEEC+FPKAT KTFV+KL+   S HPK   TDFR  ADF ++HYAG+VDY +  WL+KNMDPLNEN+VSLLQ S + FV  IWKDAE I+G++     ++ FG    TRKGMFRTV  LYKE L KLMD L NTNPNFVRCIIPNHEK++GKID+ LV+DQL+CNGVLEGIRICRQGFPNRI FQEF+QRY +LTPNVI KGFMDG+KA E M+  L++D++ YR+GQSKIFF+AGVLA LEE+RD K++++IV FQ++ RG+LAR+N Q R Q LNAI+IIQRNC AYLKLRNW WW+L+T+VKPLL VT+QEE +  KE+ELK+ +E L+ +  + +  ++ Y+  + EK  + E L+ E     + E  R  L+ R +++E   QE E+R  E +++   L  EK KL+  I  L + LE EE   QK Q +K+  D +IK+ E+ +A  +D+  KL KEKK LEER  D+  TLAEEEEK+K L KLK++HE +I+ELEERL ++Q  RQ+ +++KR++ETE+++  + L+ +    +E++  L + E ++ Q   ++DEE+  K+ AQ+  R+ E+ + EI+EDLEAEK ++ +AEK +RDL+EE+E+LK ELLD+ +T+  QQ +  K+E EL   KKS E+ET   E  + ++R K +  + ++N+Q+E   K+K V+EKAK  L+ E  D   EL ++ SS+ ++++ +K  E Q++E+  +L+E E  + + + K  K  + A+ +   LEE E K S   KS  ++ SQL + Q+  EEETR KL   + LRQ+ES+   L++QLEE+ ++K N E  +  + +QMQ++KKK EEDA    E +E +K++ ++ E L+ +++E I Q +R +K+K+ IQ+EL+DA   LE+Q+    + ++K K  +  + E   ++++   E+DT E+E REKETK++ + RE++   DK+ +LEN +  L  +L++L +++    KNV  LEKAK  LE+ L   K   EELE++    +  K R+E+ + A ++Q +R+L +K+E  +E+ R + K+LRD E  L+EE+K +TA V+ KKK+E +  ++   +    KVKE+  +  KK Q    +  R+ +E  AAK +     KE E++++  E+ V QL+EDL+ SERA+R   +ERDE  EEIA         I +K+R+E+ I+ L  + EE Q     L D+++K   Q+EQ+  EL  E+ N  + EN ++  ER NKEL  K+ E+E     K KAT+A  ++KI +L+ QL+ + +E     + N+K+++K+KE+   + DE +  D   EQ++K   R K  +R+L   +E      TQ R+ QR+ E++ E++EA ++EI  LKTK+ R
Sbjct:    3 EEVDRNDPELKYLSVERNQFNDPATQAEWTQKRLVWVPHENQGFVAASIKREHGDEVEVELAETGKRVMILRDDIQKMNPPKFDKVEDMAELTCLNEASVLHNIKDRYYSGLIYTYSGLFCVVVNPYKKLPIYTEKIMERYKGIKRHEVPPHVFAITDSAYRNMLGDREDQSILCTGESGAGKTENTKKVIQFLAYVAASKPKGSGAVPHPAVLISSHQETFAGELEQQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDASGFISGANIETYLLEKSRAIRQAKDERTFHIFYQLLAGATPEQREKFILDDVKSYAFLSNGSLPVPGVDDYAEFQATVKSMNIMGMTSEDFNSIFRIVSAVLLFGSMKFRQERNNDQATLPDNTVAQKIAHLLGLSVTDMTRAFLTPRIKVGRDFVTKAQTKEQVEFAVEAIAKACYERMFKWLVNRINRSLDRTKRQGASFIGILDMAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWKFIDFGLDLQPTIDLIDKPGGIMALLDEECWFPKATDKTFVDKLVSAHSMHPKFMKTDFRGVADFAIVHYAGRVDYSAAKWLMKNMDPLNENIVSLLQGSQDPFVVNIWKDAE-IVGMAQQALTDTQFGA--RTRKGMFRTVSHLYKEQLAKLMDTLRNTNPNFVRCIIPNHEKRAGKIDAPLVLDQLRCNGVLEGIRICRQGFPNRIPFQEFRQRYELLTPNVIPKGFMDGKKACEKMIQALELDSNLYRVGQSKIFFRAGVLAHLEEERDFKISDLIVNFQAFCRGFLARRNYQKRLQQLNAIRIIQRNCAAYLKLRNWQWWRLYTKVKPLLEVTKQEEKLVQKEDELKQVREKLDTLAKNTQEYERKYQQALVEKTTLAEQLQAEIELCAEAEESRSRLMARKQELEDMMQELETRIEEEEERVLALGGEKKKLELNIQDLEEQLEEEEAARQKLQLEKVQLDAKIKKYEEDLALTDDQNQKLLKEKKLLEERANDLSQTLAEEEEKAKHLAKLKAKHEATISELEERLHKDQQQRQESDRSKRKIETEVADLKEQLNERRVQVDEMQAQLAKREEELTQTLLRIDEESATKATAQKAQRELESQLAEIQEDLEAEKAARAKAEKVRRDLSEELEALKNELLDSLDTTAAQQELRSKREQELATLKKSLEEETVNHEGVLADMRHKHSQELNSINDQLENLRKAKTVLEKAKGTLEAENADLATELRSVNSSRQENDRRRKQAESQIAELQVKLAEIERARSELQEKCTKLQQEAENITNQLEEAELKASAAVKSASNMESQLTEAQQLLEEETRQKLGLSSKLRQIESEKEALQEQLEEDDEAKRNYERKLAEVTTQMQEIKKKAEEDADLAKELEEGKKRLNKDIEALERQVKELIAQNDRLDKSKKKIQSELEDATIELEAQRTKVLELEKKQKNFDKILAEEKAISEQIAQERDTAEREAREKETKVLSVSRELDEAFDKIEDLENKRKTLQNELDDLANTQGTADKNVHELEKAKRALESQLAELKAQNEELEDDLQLTEDAKLRLEVNMQALRSQFERDLLAKEEGAEEKRRGLVKQLRDLETELDEERKQRTAAVASKKKLEGDLKEIETTMEMHNKVKEDALKHAKKLQAQVKDALRDAEEAKAAKEELQALSKEAERKVKALEAEVLQLTEDLASSERARRAAETERDELAEEIANNANKGSLMIDEKRRLEARIATLEEELEEEQSNSEVLLDRSRKAQLQIEQLTTELANEKSNSQKNENGRALLERQNKELKAKLAEIETAQRTKVKATIATLEAKIANLEEQLENEGKERLLQQKANRKMDKKIKELTMNIEDERRHVDQHKEQMDKLNSRIKLLKRNLDETEEELQKEKTQKRKYQRECEDMIESQEAMNREINSLKTKLRR 1936          
BLAST of Myosin heavy chain vs. Ensembl Zebrafish
Match: myh9a (myosin, heavy chain 9a, non-muscle [Source:ZFIN;Acc:ZDB-GENE-030131-5870])

HSP 1 Score: 1703.72 bits (4411), Expect = 0.000e+0
Identity = 962/1933 (49.77%), Postives = 1349/1933 (69.79%), Query Frame = 1
Query:   97 QYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKP---MGILSLLDEECFFPKATTKTFVEKLIKNQSTHPKL-KATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHK---LDAESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKIDR 5868
            ++L  D++ ++D    +DWA KKLVW+P +  GF +GS+ EE GDE  V+L ++GK +K+  +++QK+NPPKF K EDMA+LT LNEASVL+NL++RY+S LIYTYSGLFCVV+NPYK LPIYT  ++E YKG+KRHE PPHIYA+TD AYR+M+QD+E+QSILCTGESGAGKTENTKKVIQYLA VA+S K +K  +S ALS         GELE QLLQANP+LEAFGNAKT+KNDNSSRFGKFIRINFD +G+I  ANIETYLLEK+R IRQA +ER FH+FY LL GA D+L+ EL LE+ + Y+ LSNG + +P   ++++F +T++A  IMGI +DEQ  + +V++AVL +GN+ FK+ER+SDQA++PD+T AQKV+HLLG+ VT+ T+A+L P++K+GR+ V KAQT+EQAEF+VEA++K+TYER+FRWLVMRIN+++D+  RQ  +FIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W FIDFGLDLQP IELIEKP    GIL+LLDEEC+FPKAT K+FVEK+++    +PK  K    +  ADF +IHYAGKVDY ++ WL+KNMDPLN+NV +LL +S + FV  +WKD + I+GL        +  GA  TRKGMFRTVGQLYKE L  LM  L NTNPNFVRCIIPNHEKK+GK+   LV+DQL+CNGVLEGIRICRQGFPNRI+FQEF+QRY ILTPN I KGFMDG++A  LM+  L++D++ YRIGQSK+FF+AGVLA LEE+RD+K+T++I+ FQ++ RGY+AR+    R Q L A+++IQRNC AYLKLRNW WW+LFT+VKPLL VTRQEE +  KEEEL K KE  ++     + ++   + L  EK  +QE L+ E    Q+ E  R  L  R++++E    E ESR  E +++  + + EK K+Q  I  L Q L+ EE   QK Q +K++ D ++K++E+ +  +ED+  KL+KEKK +EER+++  + LAEEEEKSK L KLK++HET IT+LE+RL +E+  RQ+LEK +R+LE + +E  D ++       E+R  L + E ++    A+++EE   K+ AQ+ IR+ E  I+E++EDLE EK ++ +AEK +RDL EE+E+LK EL DT +++  QQ +  K+E E+   KK+ EDE +  E  + E+R+K     E LN Q+E + +SK  V+KAK  L+ E N+   EL +L  SK DSE  +K  E QL E+  + +ESE  K   LD  SK+  Q EL + L   + ++ESK  +  K   +V SQL D Q   EEETR KL   T LRQLE +   LK+ LEEE++SK+N+E  +   Q+Q+ ++KKK+E++AQ L   ++ +KK+ RE E +  +LEE     ++ +K K  +Q EL D        +    + +RK KK +  + E  +++ KY  E+D  E E REKETK + L RE+ A  D  +ELE     L  ++ +LVSSKDD GK+V  LE+AK  +E  LE  K  +EELE+E    +  K R+E+ + A KAQ +R+L S+DE  +E+ + + K++R+ E  LE+E+K +   VS++KK+E +  +L  Q+  + K ++E  +Q+KK Q       RE ++L  ++++ L Q KE E+++++ E+ + QL EDL+ ++RAKR I  ERDE  +EI +       +  +++R+E+ I+ L  + EE  L +  + D+ KK   Q EQV  EL  ER N  RLE  +S  +R NK++  K++ELE     KYK+T+ A ++KIQ L+ QLD++++E  Q+ +  +++E+KLKE++  + DE + AD +  + EKA  R K+ +R L+  +E  +  +   R+L+R+LE+  E+  A ++E+  LK K+ R
Sbjct:    9 KFLYADRNTINDPLAQADWATKKLVWVPSEKLGFEAGSIKEETGDECLVELADSGKKIKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLRERYYSGLIYTYSGLFCVVINPYKYLPIYTEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAYVASSFKTKKDQSSIALSH--------GELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVNGYIVGANIETYLLEKSRAIRQAKDERAFHIFYYLLTGAGDKLRSELCLEDYNKYRFLSNGNVTIPGQQDRELFAETIDAFRIMGIPEDEQTGLLKVVSAVLQLGNMSFKKERNSDQASMPDDTAAQKVSHLLGMNVTDFTRAILSPRIKVGRDFVQKAQTQEQAEFAVEALAKATYERLFRWLVMRINKALDKTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWSFIDFGLDLQPCIELIEKPNGPPGILALLDEECWFPKATDKSFVEKVVQELGNNPKFQKPKKLKDDADFCIIHYAGKVDYKANEWLMKNMDPLNDNVATLLNQSVDKFVSELWKDVDRIVGLDKVAGMGESLHGAVKTRKGMFRTVGQLYKEQLMNLMTTLRNTNPNFVRCIIPNHEKKAGKLAHHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACVLMVKALELDSNLYRIGQSKVFFRAGVLAHLEEERDMKITDVIINFQAWCRGYVARRAFAKRQQQLTAMRVIQRNCAAYLKLRNWQWWRLFTKVKPLLQVTRQEEEMVAKEEELVKMKERQQQAEDQLKESEAKQKQLNAEKLALQEQLQAETELCQEAEEMRSRLTARMQEMEEVLHELESRLEEEEERVAQFQSEKKKMQQNIGDLEQQLDEEEAARQKLQLEKVTMDAKLKKIEEDLMVIEDQNAKLSKEKKQMEERISEFTTNLAEEEEKSKSLQKLKTKHETMITDLEDRLRKEEKMRQELEKNRRKLEGDSTELHDQIAELQAQIAELRAQLAKKEEELQAALARIEEEAALKNAAQKSIREMEAQISELQEDLELEKAARNKAEKQRRDLGEELEALKTELEDTLDSTAAQQELRAKRETEVTQLKKTLEDEARAHEQMLSEVRQKHNQAFEELNEQLEQSKRSKASVDKAKQALESERNELQIELKSLSQSKNDSENRRKKAESQLQELQVKHTESERQKHELLDKVSKM--QAEL-ESLQGTVTKVESKSIKAAKDCSAVESQLKDAQALLEEETRQKLAISTRLRQLEDEQNNLKEMLEEEEESKKNVEKQLHTAQAQLAEMKKKIEQEAQSLESMEDGKKKLQREVESVLQQLEERNASYDKLDKTKTRLQRELDDVLVDQGHLRQTVQELERKQKKFDQMLAEEKSISTKYAEERDRAEAEAREKETKSLTLARELEAMTDLKNELERVNKQLKTEMEDLVSSKDDAGKSVHELERAKRGMEQQLEEMKTQLEELEDELQLTEDAKLRLEVNMQALKAQFERDLQSRDEQGEEKRKQLVKQVREMEMELEDERKQRAQAVSVRKKLELDLSELAAQIDLANKARDEALKQLKKLQAQMKEQMREFEDLRLSRDESLNQAKENERKIKSMEAEIMQLHEDLAAADRAKRQIQQERDELQDEINSQNAKNSLSSDERRRLEARIAQLEEELEEEHLSVELVNDRLKKASLQAEQVTVELTAERSNSQRLEGLRSQLDRQNKDMKQKLQELEGAVKSKYKSTITALETKIQQLEEQLDSEMKERQQSTKQVRRVEKKLKEVLLQVEDERRNADQSKTETEKANIRLKQMKRQLEETEEEAARANASCRKLRRELEDATESASAMNREVSTLKNKLRR 1930          
BLAST of Myosin heavy chain vs. Ensembl Zebrafish
Match: myh10 (myosin, heavy chain 10, non-muscle [Source:ZFIN;Acc:ZDB-GENE-030616-162])

HSP 1 Score: 1691.4 bits (4379), Expect = 0.000e+0
Identity = 945/1936 (48.81%), Postives = 1349/1936 (69.68%), Query Frame = 1
Query:   97 QYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQK----TTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPM---GILSLLDEECFFPKATTKTFVEKLIKNQSTHPKL-KATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQ-ESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLD-AESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKIDR 5868
            +YL VD+++V +    +DW  KKLVW+P +  GF + S+ EE+G+E  V+L ENGK   +  +++QK+NPPKF K EDMA+LT LNEASVL+NLKDRY+S LIYTYSGLFCVV+NPYK LPIY+ N+IE Y+G+KRHE PPHIYA+++ AYR MLQD+E+QSILCTGESGAGKTENTKKVIQYLA VA+S K +K       S    +     +  GELE QLLQANP+LE+FGNAKT+KNDNSSRFGKFIRINFD +G+I  ANIETYLLEK+R IRQA +ER FHVFYQLL GA + L+ +L+LE  ++Y+ LSNG I +P   +K  F++T+EA+ IM  + +E  S+ +V++AVL  GNI FK+ER++DQA++P+NT AQK+ HLLG+ V E T+A+L P++K+GR+ V KAQTKEQA+F+VEA++K+TYER+FRWLV RIN+++DR  RQ  +FIGILDIAGFEIF++NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W FIDFGLDLQP I+LIE+P    G+L+LLDEEC+FPKAT KTFV+KL++ Q TH K  K    + KADF +IHYAG+VDY +D WL+KNMDPLN+NV +LL +S + FV  +WKD + I+GL       E+AFG A  T+KGMFRTVGQLYKESLTKLM  L NTNPNFVRCIIPNHEK++GK++  LV+DQL+CNGVLEGIRICRQGFPNRI+FQEF+QRY ILTPN I KGFMDG++A E M+  L++D + YRIGQSKIFF+ GVLA LEE+RD+K+T+II+ FQS  RGYLARK    + Q L+A+K++QRNC AYLKLR+W WW+LFT+VKPLL VTRQEE +  K+EEL K KE   K+  +    ++ ++ L+EEKN + E L+ E     + E  R  L+ + +++E    + ESR  E +++   L+ EK K+Q+ I  L + L+ EE   QK Q +K++A+ +IK++E+ +  LED+ +K  KEKK LE+R+ ++ S LAEEEEK+K L K+K++ E  + +LEERL +E+  RQ+LEK KR+L+ E ++  D ++      +E++I L + E ++  + A+ DEE   K+ A +Q+R+ +  + E++EDLE+EK ++ +AEK KRDL+EE+E+LK EL DT +T+  QQ +  K+E E+   KK+ +DET+  E ++QE+R++    +E ++ Q+E A + K  +EK K  L+ +  +  NE+ +L+ +K++SE  +K  E QL E+  R SE E+ K + A+   K QTEL D ++  LE+ E K  +LTK   S+ SQL D Q+  +EETR KLN  + +RQLE +   L +Q EEE++S++NLE  +  LQ+Q+ + KKK+E+D   L   +E ++K+ ++ E    +LEE     ++ EK K  +Q EL D    L+ Q+   +  ++K KK +  + E   ++ +Y  E+D  E E REK+TK + + R ++   +   E E     L  ++ +L+SSKDDVGKNV  LEK+K  LE  +E  +  +EELE+E    +  K R+E+ + A KAQ DR+L ++DE ++E+ R + K++R+ EA LE+E+K +   V+ KKK+E +  D+  Q+  + K ++E  +Q++K Q    + QRE++E   ++++   Q KE EK+L++ E+ + QL EDL+ SERA+R    ERDE  +EI+     +   + +K+R+E+ I+ L  + EE Q  +  L D+ +K   Q++ +  EL  ER    + EN +   ER NK+L  K++ELE     K+KA++AA ++KI  L+ QL+ + +E   AN+  ++ E+KLKE+   + DE + AD   EQ+EKA  R K+ +R L+  +E  +  +   R+LQR+L++  E  E   +E+  LK ++ R
Sbjct:   15 RYLFVDRAVVYNPTTQADWTAKKLVWVPSERHGFEAASIREERGEEVLVELAENGKKAMVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKGRKDHNIPPESPKAVKLQNGILFYGELERQLLQANPILESFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQAKDERTFHVFYQLLAGAGEHLRSDLLLEGFNSYRFLSNGNIPIPGQQDKDNFQETMEAMHIMSFNHEEILSMLKVVSAVLQFGNIVFKKERNTDQASMPENTAAQKLCHLLGMNVMEFTRAILSPRIKVGRDYVQKAQTKEQADFAVEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFQLNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWSFIDFGLDLQPCIDLIERPANPPGVLALLDEECWFPKATDKTFVDKLVQEQGTHGKFQKPRQLKDKADFCIIHYAGRVDYKADEWLMKNMDPLNDNVATLLHQSTDKFVAELWKDVDRIVGLDQVAGMNETAFGAAYKTKKGMFRTVGQLYKESLTKLMATLRNTNPNFVRCIIPNHEKRAGKLEPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYRIGQSKIFFRTGVLAHLEEERDLKITDIIIYFQSVCRGYLARKAFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRLFTKVKPLLQVTRQEEEMQAKDEELIKVKERQVKVENELVEMERKHQQLLEEKNILAEQLQAETELFAEAEEMRARLVAKKQELEEILHDLESRVEEEEERNQSLQNEKKKMQSHIQDLEEQLDEEEAARQKLQLEKVTAEAKIKKMEEDILLLEDQNSKFLKEKKLLEDRVGEMTSQLAEEEEKAKNLGKVKNKQEMMMVDLEERLKKEEKTRQELEKAKRKLDAETTDLQDQIAELQAQIDELKIQLAKKEEELQAVLARGDEEVAQKNNALKQLRELQAQLAELQEDLESEKAARNKAEKLKRDLSEELEALKTELEDTLDTTAAQQELRSKREQEVAELKKAIDDETRNHESQIQEMRQRHGTALEEISEQLEQAKRVKGNLEKNKQTLESDNKELTNEVKSLQQAKSESEHKRKKLEAQLQEVMARFSEGEKVKGELADRTHKIQTEL-DNVSCLLEDAEKKGIKLTKDVSSLESQLQDTQELLQEETRQKLNLSSRIRQLEEEKNNLLEQQEEEEESRKNLEKQLATLQAQLVETKKKLEDDVGALEGLEEVKRKLQKDMEVTSQKLEEKAIAFDKLEKTKNRLQQELDDLMVDLDHQRQIVSNLEKKQKKFDQMLAEEKTISARYAEERDRAEAEAREKDTKALSMARALDEALEAKEEFERLNKQLRAEMEDLISSKDDVGKNVHELEKSKRTLEQQVEEMRTQLEELEDELQATEDAKLRLEVNMQAMKAQFDRDLQARDEQNEEKKRALVKQVREMEAELEDERKQRALAVAAKKKLEMDLKDVEAQIEAANKARDEAIKQLRKLQAQMKDYQRELEEARTSRDEIFTQSKENEKKLKSLEAEILQLQEDLASSERARRHAEQERDELADEISNSASGKAALLDEKRRLEARIAQLEEELEEEQSNMELLNDRFRKTTMQVDTLNTELAGERSAAQKSENARQQLERQNKDLKSKLQELEGSVKSKFKASIAALEAKILQLEEQLEQEAKERAAANKIVRRTEKKLKEVFMQVEDERRHADQYKEQMEKANSRMKQLKRQLEEAEEEATRANASRRKLQRELDDATEASEGLSREVNTLKNRLRR 1949          
BLAST of Myosin heavy chain vs. Ensembl Zebrafish
Match: myh11a (myosin, heavy chain 11a, smooth muscle [Source:ZFIN;Acc:ZDB-GENE-050531-1])

HSP 1 Score: 1691.01 bits (4378), Expect = 0.000e+0
Identity = 941/1933 (48.68%), Postives = 1338/1933 (69.22%), Query Frame = 1
Query:   91 DLQYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKP---MGILSLLDEECFFPKATTKTFVEKLIKNQSTHPKL-KATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESAFG-GAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKIDR 5868
            D ++L  DK  ++     +DW+ KKLVW+P +  GF S S+ EE GDE  V+L +NGK + +  +++QK+NPPKF K EDMA+LT LNEASVL+NL++RY+S LIYTYSGLFCVVVNPYK LPIY+  +IE YKG+KRHE PPHIY++TD AYRNM+QD+E+QSILCTGESGAGKTENTKKVIQYLA VA+S K +K             D++ GELE QLLQANP+LEAFGNAKTIKNDNSSRFGKFIRINFD +GFI  ANIETYLLEK+R IRQA  ER FH+FY ++ G  D+L++EL+LEN + Y+ LS G + +P   + +M+ +T+EA++IMG S +E+  + +V++ VL +GNIEFK+ER+ +QA +PDNT AQKV HL G+ VT+ T+A+L P++K+GREVV KAQTKEQA+F++EA++K+ YER+FRW+++R+N+++D+  RQ  +F+GILDIAGFEIFE NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W FIDFGLDLQP IELIE+P    GIL+LLDEEC+FPKAT  +FVEKL    + H K  K    + K +F V HYAG+VDY +  WL KNMDPLN+NV +LL  S+  FVQ +WKDA+ ++GL T      +    A  T+KGMFRTVGQLYKESL KLM  L+NT PNFVRCIIPNHEK++GK+D+ LV++QL+CNGVLEGIRICRQGFPNRI+FQEF+QRY IL  N I KGFMDG++A  LM+  LDID + YRIGQSKIFF+ GVLA+LEE+RD+K+T II+ FQS ARG+LARK    R Q L A+K+IQRNC AYLKLRNW WW+LFT+VKPLL VTRQEE ++LKEEEL+K+KE+ +K   + +     +  LM+E+N++QE L+ E     + E  R  L  + +++E    E E+R  E +D+   L++EK K+  +I  L ++LE EE   QK Q +K++ D +IK+LE  +  ++D+ NKL KE+K LEER+AD  S LAEEEEKSK LTKLK++HE+ I+ELE RL +E+  RQ+L+K KR+LE E ++  + ++       +++  L + E ++    A+L++ET  K+ A ++IR+ E  I++++EDLE+E+ ++ +AEK KRDL EE+E+LK EL DT +T+  QQ +  K+E E+   K++ EDE++  E ++QE+R+K    +E L  Q+E + + K+ +EKAK  L++E ++ + EL +L   K D E  KK  E QL+++  R ++SE HK +   ++ K T   + +   L E E K  +L+K   S+ SQ+ D Q+   EETR KL   T LRQ+E     L++QL+EE ++K N+E HV  L  Q+ D KKK+EE    +   +E +K++ R+ E    + EE     ++ EK K  +Q EL+D    L++Q+   +  ++K KK +  + E  +++ KY  E+D  E E REKETK + L R +    +   E E A   L  ++ +LVSSKDDVGKNV  LEK+K  LE  +E  K  +EELE+E    +  K R+E+ + A KAQ +R+L  +DE  +E+ R + K++R+ E  LE+E+K +TA+ + KKK+E +  DL  Q+  S K ++E  +Q++K Q    + QRE+ +  AA+ + L   KE E++ +T E+ + QL EDL+ +ERAK+ + +ERDE  +E+A+    +     +K+R+E+ I  L  + EE Q  +  L D+ +K   Q++Q+ NEL  ER    + E+ +   ER NKEL  K++E+E +   K+K++++A ++K+  L+ QL+ +  +     +  ++ ++KLKE+M  + DE K+A+   +Q +KAT R K+ +R L+  +E +  ++   R+LQR+L+E  ET +A  +E+  LK+K+ R
Sbjct:    9 DEKFLFTDKDFINSPVAQADWSAKKLVWVPSEKHGFESASIKEEHGDEVLVELMDNGKKITVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLRERYYSGLIYTYSGLFCVVVNPYKMLPIYSEKIIEMYKGKKRHEVPPHIYSITDNAYRNMMQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKK-------------DMSAGELEKQLLQANPILEAFGNAKTIKNDNSSRFGKFIRINFDVTGFIVGANIETYLLEKSRCIRQAKTERAFHIFYYMVAGTKDKLREELLLENFNNYRFLSAGHVQIPGNQDDEMYDETMEAMEIMGFSVEERADVLKVVSTVLQLGNIEFKKERNQEQATMPDNTAAQKVCHLQGINVTDFTRAILTPRIKVGREVVQKAQTKEQADFAIEALAKAMYERLFRWILLRVNKALDKTKRQGASFLGILDIAGFEIFENNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPNNPPGILALLDEECWFPKATDVSFVEKLCNTHANHTKFAKPKQLKDKTEFSVQHYAGRVDYNAVAWLTKNMDPLNDNVTALLNNSSNPFVQDLWKDADRVVGLETIAKMSDSLAPSASKTKKGMFRTVGQLYKESLAKLMTTLHNTQPNFVRCIIPNHEKRAGKLDAHLVLEQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILAANAIPKGFMDGKQACCLMIKHLDIDPNLYRIGQSKIFFRTGVLAQLEEERDLKITVIIIAFQSQARGFLARKAFAKRQQQLTAMKVIQRNCAAYLKLRNWQWWRLFTKVKPLLQVTRQEEEMSLKEEELQKAKESAQKFEIELKDIALKHTQLMDERNQLQEKLQAETELYAEAEEMRVRLASKKQELEEILHEMEARLEEEEDRGAALQMEKKKMHEQIKDLEEHLEEEEDARQKLQLEKVTCDAKIKKLEDDILIMDDQNNKLQKERKILEERIADFSSNLAEEEEKSKNLTKLKNKHESMISELEVRLKKEEKTRQELDKAKRKLEAESNDLQEQIADLQAQIADLKAQLAKKEEELQAALARLEDETGQKNNALKKIRELEGHISDLQEDLESERAARNKAEKTKRDLGEELEALKSELEDTLDTTATQQELRAKREQEVTLLKRAIEDESRVHEAQVQEMRQKHTQALEELTEQLEQSKRVKVNLEKAKQALEKETSELHVELRSLTQGKQDVEHKKKKLEGQLADLQSRFNDSERHKAELGDRVSKITVELESVTNLLNEAEGKNIKLSKDVASLSSQVQDTQELLAEETRQKLQLSTKLRQIEDDRNALQEQLDEEAEAKRNVERHVSTLNIQLSDFKKKLEEMTGNVELLEEGKKRLQRDLEAANTQFEEKAAAYDKLEKTKNRLQQELEDTLMDLDNQRQLVSNLEKKQKKFDQMLAEEKSISSKYADERDRAEAEAREKETKALSLARALEEAQEAREEFERANKALRAEMEDLVSSKDDVGKNVHELEKSKRGLEAQVEEMKTQLEELEDELQAAEDAKLRLEVNMQALKAQFERDLQGRDEQGEEKKRQLVKQVRELETELEDERKQRTALAASKKKLEGDLKDLEGQIETSNKGRDEAIKQLRKLQAQMKDFQRELDDAHAAREEVLSSAKENERKAKTLEAELLQLQEDLAAAERAKKQVEAERDELADELASNASGKSALSDEKRRLEAKIQQLEEELEEEQGNMEMLNDRLRKSAQQVDQLTNELQAERTTSQKNESARQLMERQNKELKAKLQEMENQVKSKFKSSISALEAKVAQLEEQLEQESRDKQNTAKAVRQKDKKLKEMMTQVEDERKQAEQYKDQADKATARVKQLKRQLEESEEESQRITAARRKLQRELDEATETNDAMSREVNSLKSKLRR 1928          
BLAST of Myosin heavy chain vs. Ensembl Zebrafish
Match: myh10 (myosin, heavy chain 10, non-muscle [Source:ZFIN;Acc:ZDB-GENE-030616-162])

HSP 1 Score: 1690.63 bits (4377), Expect = 0.000e+0
Identity = 945/1933 (48.89%), Postives = 1350/1933 (69.84%), Query Frame = 1
Query:   97 QYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNI-GELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPM---GILSLLDEECFFPKATTKTFVEKLIKNQSTHPKL-KATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQ-ESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLD-AESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKIDR 5868
            +YL VD+++V +    +DW  KKLVW+P +  GF + S+ EE+G+E  V+L ENGK   +  +++QK+NPPKF K EDMA+LT LNEASVL+NLKDRY+S LIYTYSGLFCVV+NPYK LPIY+ N+IE Y+G+KRHE PPHIYA+++ AYR MLQD+E+QSILCTGESGAGKTENTKKVIQYLA VA+S K +K    + +       V + GELE QLLQANP+LE+FGNAKT+KNDNSSRFGKFIRINFD +G+I  ANIETYLLEK+R IRQA +ER FHVFYQLL GA + L+ +L+LE  ++Y+ LSNG I +P   +K  F++T+EA+ IM  + +E  S+ +V++AVL  GNI FK+ER++DQA++P+NT AQK+ HLLG+ V E T+A+L P++K+GR+ V KAQTKEQA+F+VEA++K+TYER+FRWLV RIN+++DR  RQ  +FIGILDIAGFEIF++NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W FIDFGLDLQP I+LIE+P    G+L+LLDEEC+FPKAT KTFV+KL++ Q TH K  K    + KADF +IHYAG+VDY +D WL+KNMDPLN+NV +LL +S + FV  +WKD + I+GL       E+AFG A  T+KGMFRTVGQLYKESLTKLM  L NTNPNFVRCIIPNHEK++GK++  LV+DQL+CNGVLEGIRICRQGFPNRI+FQEF+QRY ILTPN I KGFMDG++A E M+  L++D + YRIGQSKIFF+ GVLA LEE+RD+K+T+II+ FQS  RGYLARK    + Q L+A+K++QRNC AYLKLR+W WW+LFT+VKPLL VTRQEE +  K+EEL K KE   K+  +    ++ ++ L+EEKN + E L+ E     + E  R  L+ + +++E    + ESR  E +++   L+ EK K+Q+ I  L + L+ EE   QK Q +K++A+ +IK++E+ +  LED+ +K  KEKK LE+R+ ++ S LAEEEEK+K L K+K++ E  + +LEERL +E+  RQ+LEK KR+L+ E ++  D ++      +E++I L + E ++  + A+ DEE   K+ A +Q+R+ +  + E++EDLE+EK ++ +AEK KRDL+EE+E+LK EL DT +T+  QQ +  K+E E+   KK+ +DET+  E ++QE+R++    +E ++ Q+E A + K  +EK K  L+ +  +  NE+ +L+ +K++SE  +K  E QL E+  R SE E+ K + A+   K QTEL D ++  LE+ E K  +LTK   S+ SQL D Q+  +EETR KLN  + +RQLE +   L +Q EEE++S++NLE  +  LQ+Q+ + KKK+E+D   L   +E ++K+ ++ E    +LEE     ++ EK K  +Q EL D    L+ Q+   +  ++K KK +  + E   ++ +Y  E+D  E E REK+TK + + R ++   +   E E     L  ++ +L+SSKDDVGKNV  LEK+K  LE  +E  +  +EELE+E    +  K R+E+ + A KAQ DR+L ++DE ++E+ R + K++R+ EA LE+E+K +   V+ KKK+E +  D+  Q+  + K ++E  +Q++K Q    + QRE++E   ++++   Q KE EK+L++ E+ + QL EDL+ SERA+R    ERDE  +EI+     +   + +K+R+E+ I+ L  + EE Q  +  L D+ +K   Q++ +  EL  ER    + EN +   ER NK+L  K++ELE     K+KA++AA ++KI  L+ QL+ + +E   AN+  ++ E+KLKE+   + DE + AD   EQ+EKA  R K+ +R L+  +E  +  +   R+LQR+L++  E  E   +E+  LK ++ R
Sbjct:   15 RYLFVDRAVVYNPTTQADWTAKKLVWVPSERHGFEAASIREERGEEVLVELAENGKKAMVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKGRK---DHNIPPESPKAVKLQGELERQLLQANPILESFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQAKDERTFHVFYQLLAGAGEHLRSDLLLEGFNSYRFLSNGNIPIPGQQDKDNFQETMEAMHIMSFNHEEILSMLKVVSAVLQFGNIVFKKERNTDQASMPENTAAQKLCHLLGMNVMEFTRAILSPRIKVGRDYVQKAQTKEQADFAVEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFQLNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWSFIDFGLDLQPCIDLIERPANPPGVLALLDEECWFPKATDKTFVDKLVQEQGTHGKFQKPRQLKDKADFCIIHYAGRVDYKADEWLMKNMDPLNDNVATLLHQSTDKFVAELWKDVDRIVGLDQVAGMNETAFGAAYKTKKGMFRTVGQLYKESLTKLMATLRNTNPNFVRCIIPNHEKRAGKLEPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYRIGQSKIFFRTGVLAHLEEERDLKITDIIIYFQSVCRGYLARKAFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRLFTKVKPLLQVTRQEEEMQAKDEELIKVKERQVKVENELVEMERKHQQLLEEKNILAEQLQAETELFAEAEEMRARLVAKKQELEEILHDLESRVEEEEERNQSLQNEKKKMQSHIQDLEEQLDEEEAARQKLQLEKVTAEAKIKKMEEDILLLEDQNSKFLKEKKLLEDRVGEMTSQLAEEEEKAKNLGKVKNKQEMMMVDLEERLKKEEKTRQELEKAKRKLDAETTDLQDQIAELQAQIDELKIQLAKKEEELQAVLARGDEEVAQKNNALKQLRELQAQLAELQEDLESEKAARNKAEKLKRDLSEELEALKTELEDTLDTTAAQQELRSKREQEVAELKKAIDDETRNHESQIQEMRQRHGTALEEISEQLEQAKRVKGNLEKNKQTLESDNKELTNEVKSLQQAKSESEHKRKKLEAQLQEVMARFSEGEKVKGELADRTHKIQTEL-DNVSCLLEDAEKKGIKLTKDVSSLESQLQDTQELLQEETRQKLNLSSRIRQLEEEKNNLLEQQEEEEESRKNLEKQLATLQAQLVETKKKLEDDVGALEGLEEVKRKLQKDMEVTSQKLEEKAIAFDKLEKTKNRLQQELDDLMVDLDHQRQIVSNLEKKQKKFDQMLAEEKTISARYAEERDRAEAEAREKDTKALSMARALDEALEAKEEFERLNKQLRAEMEDLISSKDDVGKNVHELEKSKRTLEQQVEEMRTQLEELEDELQATEDAKLRLEVNMQAMKAQFDRDLQARDEQNEEKKRALVKQVREMEAELEDERKQRALAVAAKKKLEMDLKDVEAQIEAANKARDEAIKQLRKLQAQMKDYQRELEEARTSRDEIFTQSKENEKKLKSLEAEILQLQEDLASSERARRHAEQERDELADEISNSASGKAALLDEKRRLEARIAQLEEELEEEQSNMELLNDRFRKTTMQVDTLNTELAGERSAAQKSENARQQLERQNKDLKSKLQELEGSVKSKFKASIAALEAKILQLEEQLEQEAKERAAANKIVRRTEKKLKEVFMQVEDERRHADQYKEQMEKANSRMKQLKRQLEEAEEEATRANASRRKLQRELDDATEASEGLSREVNTLKNRLRR 1943          
BLAST of Myosin heavy chain vs. Ensembl Zebrafish
Match: myh10 (myosin, heavy chain 10, non-muscle [Source:ZFIN;Acc:ZDB-GENE-030616-162])

HSP 1 Score: 1690.63 bits (4377), Expect = 0.000e+0
Identity = 945/1933 (48.89%), Postives = 1350/1933 (69.84%), Query Frame = 1
Query:   97 QYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNI-GELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPM---GILSLLDEECFFPKATTKTFVEKLIKNQSTHPKL-KATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQ-ESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLD-AESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKIDR 5868
            +YL VD+++V +    +DW  KKLVW+P +  GF + S+ EE+G+E  V+L ENGK   +  +++QK+NPPKF K EDMA+LT LNEASVL+NLKDRY+S LIYTYSGLFCVV+NPYK LPIY+ N+IE Y+G+KRHE PPHIYA+++ AYR MLQD+E+QSILCTGESGAGKTENTKKVIQYLA VA+S K +K    + +       V + GELE QLLQANP+LE+FGNAKT+KNDNSSRFGKFIRINFD +G+I  ANIETYLLEK+R IRQA +ER FHVFYQLL GA + L+ +L+LE  ++Y+ LSNG I +P   +K  F++T+EA+ IM  + +E  S+ +V++AVL  GNI FK+ER++DQA++P+NT AQK+ HLLG+ V E T+A+L P++K+GR+ V KAQTKEQA+F+VEA++K+TYER+FRWLV RIN+++DR  RQ  +FIGILDIAGFEIF++NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W FIDFGLDLQP I+LIE+P    G+L+LLDEEC+FPKAT KTFV+KL++ Q TH K  K    + KADF +IHYAG+VDY +D WL+KNMDPLN+NV +LL +S + FV  +WKD + I+GL       E+AFG A  T+KGMFRTVGQLYKESLTKLM  L NTNPNFVRCIIPNHEK++GK++  LV+DQL+CNGVLEGIRICRQGFPNRI+FQEF+QRY ILTPN I KGFMDG++A E M+  L++D + YRIGQSKIFF+ GVLA LEE+RD+K+T+II+ FQS  RGYLARK    + Q L+A+K++QRNC AYLKLR+W WW+LFT+VKPLL VTRQEE +  K+EEL K KE   K+  +    ++ ++ L+EEKN + E L+ E     + E  R  L+ + +++E    + ESR  E +++   L+ EK K+Q+ I  L + L+ EE   QK Q +K++A+ +IK++E+ +  LED+ +K  KEKK LE+R+ ++ S LAEEEEK+K L K+K++ E  + +LEERL +E+  RQ+LEK KR+L+ E ++  D ++      +E++I L + E ++  + A+ DEE   K+ A +Q+R+ +  + E++EDLE+EK ++ +AEK KRDL+EE+E+LK EL DT +T+  QQ +  K+E E+   KK+ +DET+  E ++QE+R++    +E ++ Q+E A + K  +EK K  L+ +  +  NE+ +L+ +K++SE  +K  E QL E+  R SE E+ K + A+   K QTEL D ++  LE+ E K  +LTK   S+ SQL D Q+  +EETR KLN  + +RQLE +   L +Q EEE++S++NLE  +  LQ+Q+ + KKK+E+D   L   +E ++K+ ++ E    +LEE     ++ EK K  +Q EL D    L+ Q+   +  ++K KK +  + E   ++ +Y  E+D  E E REK+TK + + R ++   +   E E     L  ++ +L+SSKDDVGKNV  LEK+K  LE  +E  +  +EELE+E    +  K R+E+ + A KAQ DR+L ++DE ++E+ R + K++R+ EA LE+E+K +   V+ KKK+E +  D+  Q+  + K ++E  +Q++K Q    + QRE++E   ++++   Q KE EK+L++ E+ + QL EDL+ SERA+R    ERDE  +EI+     +   + +K+R+E+ I+ L  + EE Q  +  L D+ +K   Q++ +  EL  ER    + EN +   ER NK+L  K++ELE     K+KA++AA ++KI  L+ QL+ + +E   AN+  ++ E+KLKE+   + DE + AD   EQ+EKA  R K+ +R L+  +E  +  +   R+LQR+L++  E  E   +E+  LK ++ R
Sbjct:   15 RYLFVDRAVVYNPTTQADWTAKKLVWVPSERHGFEAASIREERGEEVLVELAENGKKAMVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKGRK---DHNIPPESPKAVKLQGELERQLLQANPILESFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQAKDERTFHVFYQLLAGAGEHLRSDLLLEGFNSYRFLSNGNIPIPGQQDKDNFQETMEAMHIMSFNHEEILSMLKVVSAVLQFGNIVFKKERNTDQASMPENTAAQKLCHLLGMNVMEFTRAILSPRIKVGRDYVQKAQTKEQADFAVEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFQLNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWSFIDFGLDLQPCIDLIERPANPPGVLALLDEECWFPKATDKTFVDKLVQEQGTHGKFQKPRQLKDKADFCIIHYAGRVDYKADEWLMKNMDPLNDNVATLLHQSTDKFVAELWKDVDRIVGLDQVAGMNETAFGAAYKTKKGMFRTVGQLYKESLTKLMATLRNTNPNFVRCIIPNHEKRAGKLEPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYRIGQSKIFFRTGVLAHLEEERDLKITDIIIYFQSVCRGYLARKAFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRLFTKVKPLLQVTRQEEEMQAKDEELIKVKERQVKVENELVEMERKHQQLLEEKNILAEQLQAETELFAEAEEMRARLVAKKQELEEILHDLESRVEEEEERNQSLQNEKKKMQSHIQDLEEQLDEEEAARQKLQLEKVTAEAKIKKMEEDILLLEDQNSKFLKEKKLLEDRVGEMTSQLAEEEEKAKNLGKVKNKQEMMMVDLEERLKKEEKTRQELEKAKRKLDAETTDLQDQIAELQAQIDELKIQLAKKEEELQAVLARGDEEVAQKNNALKQLRELQAQLAELQEDLESEKAARNKAEKLKRDLSEELEALKTELEDTLDTTAAQQELRSKREQEVAELKKAIDDETRNHESQIQEMRQRHGTALEEISEQLEQAKRVKGNLEKNKQTLESDNKELTNEVKSLQQAKSESEHKRKKLEAQLQEVMARFSEGEKVKGELADRTHKIQTEL-DNVSCLLEDAEKKGIKLTKDVSSLESQLQDTQELLQEETRQKLNLSSRIRQLEEEKNNLLEQQEEEEESRKNLEKQLATLQAQLVETKKKLEDDVGALEGLEEVKRKLQKDMEVTSQKLEEKAIAFDKLEKTKNRLQQELDDLMVDLDHQRQIVSNLEKKQKKFDQMLAEEKTISARYAEERDRAEAEAREKDTKALSMARALDEALEAKEEFERLNKQLRAEMEDLISSKDDVGKNVHELEKSKRTLEQQVEEMRTQLEELEDELQATEDAKLRLEVNMQAMKAQFDRDLQARDEQNEEKKRALVKQVREMEAELEDERKQRALAVAAKKKLEMDLKDVEAQIEAANKARDEAIKQLRKLQAQMKDYQRELEEARTSRDEIFTQSKENEKKLKSLEAEILQLQEDLASSERARRHAEQERDELADEISNSASGKAALLDEKRRLEARIAQLEEELEEEQSNMELLNDRFRKTTMQVDTLNTELAGERSAAQKSENARQQLERQNKDLKSKLQELEGSVKSKFKASIAALEAKILQLEEQLEQEAKERAAANKIVRRTEKKLKEVFMQVEDERRHADQYKEQMEKANSRMKQLKRQLEEAEEEATRANASRRKLQRELDDATEASEGLSREVNTLKNRLRR 1943          
BLAST of Myosin heavy chain vs. Ensembl Xenopus
Match: MYH9 (myosin, heavy chain 9, non-muscle [Source:NCBI gene;Acc:100487997])

HSP 1 Score: 1694.86 bits (4388), Expect = 0.000e+0
Identity = 941/1937 (48.58%), Postives = 1339/1937 (69.13%), Query Frame = 1
Query:   97 QYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPM---GILSLLDEECFFPKATTKTFVEKLIKNQSTHPKL-KATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQ-ESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVK-PLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKKQTELADKLAMNLEEIESKLSQ-------LTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKI 5862
            +YL VD++ V++    +DWA KKLVW+P +  GF + S+ EE GDEA V+L ENGK  K+  +++QK+NPPKF K EDM++L  LNEASVL+NLK+RY+S LIYTYSGLFCVV+NPYK LPIY+  ++E YKG+KRHE PPHIYA+TD AYR+M+QD+E+QSILCTGESGAGKTENTKKVIQYLA VATS K++K                 GELE QLLQANP+LEAFGNAKT+KNDNSSRFGKFIRINFD +G+I  ANIETYLLEK+R IRQA  ER FH+FY LL GA + LK +L+LE  + Y+ LSNG + +P   +K +F++T+EA+ IMG +++EQ  + RV+++VL +GNI FK+ER++DQA++PDNT AQK+ HL+G+ V + T+ +L P++K+GR+ V KAQTKEQA+F++EA++K+TYERMFRWLVMR+N+++D+  RQ  +FIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W FIDFGLDLQP IELIEKP    GIL+LLDEEC+FPKAT K+FVEK+++ Q +H K  K    + KADF +IHYAGKVDY +D WL+KNMDPLN+NV +LL +S++ FV  +W+D + I+GL       ++A  GA  TRKGMFRTVGQLYKE L+KLM  L NTNPNFVRCIIPNHEKKSGK+D+ LV+DQL+CNGVLEGIRICRQGFPNR++FQEF+QRY ILTPN I KGFMDG++A  LM+  L++D++ YRIGQSK+FF+AGVLA LEE+RD+K+T++I+ FQ++ RGYLARK    R Q L A+K+IQRNC AYLKLRNW WW+LFT+V+     V  Q+        E K S+    +M             L +EK ++QE L+ E     + E  R  L  + +++E    + ESR  E +++C  L+ +K K+Q+ I +L + LE EE   QK Q +K++ + ++K+LE+ V  LED+ +KL KEKK  EER+A+  + LAEEEEKSK L KLK++HET I++LEERL RE+  RQ+LEKT+R+LE + ++  D ++       E+++ L + E ++    A+++EE+  K++A ++IR+ E+ I+E++EDLE E+ ++ +AEK KRDL EE+E+LK EL DT +++  QQ +  K+E E+   KK+ EDE +  E+++QEIR+K +  +E L+ Q+E   + K  +EKAK  L+ E N+  NE+  L   K DSE  +K  E QL E+  +++E +  ++ AE      +E A++L + L+ + S LSQ       L K   ++ SQL D Q+  +EETR KL+  T L+Q+E +   L +Q+EEE+++K+NL   +  LQSQM D+KKK++E+   L   +E +KK+ ++ E +  R EE     ++ EK K  +Q EL D    L+ Q+   +  ++K KK +  + E   ++ KY  E+D  E E REKETK + L R +    +  +ELE     L  ++ +LVSSKDDVGK+V  LEK+K  LE  +E  K  +EELE+E    +  K R+E+ L A KAQ +R+L  +DE  +++ + + +++++ EA LE+E+K ++  V+ +KK+E +  DL  Q+  + K +EE  +Q++K Q    + QRE+ +  A+++D L Q KE EK+L++ E+ +  + E+L+ +ER KR    ERDE  +EIA  +     A+ +K+R+ES I+ L  + EE Q     + D+ KK   Q++Q+  +LN ER N  + EN +   +R NKEL  K++ELE     K+KA + A ++KI  L+ QLD + +E   A++  ++ E+KLK++M  + DE + A+   +Q EK   R K+ +R ++  +E     +   R+LQR+LE+  ET EA ++E+  LK+K+
Sbjct:    8 KYLYVDRNFVNNPLAQADWAAKKLVWVPSEKHGFEAASVKEEVGDEAIVELAENGKKAKVNKDDIQKMNPPKFSKVEDMSELACLNEASVLHNLKERYYSGLIYTYSGLFCVVINPYKYLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAYVATSHKSKKEQ---------------GELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKSDLLLEAYNKYRFLSNGHVTIPGQQDKDLFQETMEAMKIMGFTEEEQIGLLRVVSSVLQLGNIAFKKERNTDQASMPDNTAAQKLCHLMGINVNDFTRGILLPRIKVGRDFVQKAQTKEQADFAIEALAKATYERMFRWLVMRVNKALDKTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIEKPAGPPGILALLDEECWFPKATDKSFVEKVVQEQGSHSKFQKPKQLKDKADFCIIHYAGKVDYKADEWLLKNMDPLNDNVATLLNQSSDKFVSELWRDVDRIVGLDQVAGMADTALPGAFKTRKGMFRTVGQLYKEQLSKLMATLRNTNPNFVRCIIPNHEKKSGKLDAHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQRYEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKITDVIISFQAFCRGYLARKAFAKRQQQLTAMKVIQRNCAAYLKLRNWQWWRLFTKVRLHAKEVELQKVKELQVSSEQKVSEMENVQM------------MLQQEKMQLQEQLQAEIELCAEAEEMRARLATKKQELEEILHDLESRVEEEEERCQILQADKKKMQHNIVELEEQLEEEEAARQKLQLEKVTVEAKMKKLEEDVLVLEDQNSKLGKEKKLYEERIAEFTTNLAEEEEKSKSLAKLKNKHETMISDLEERLRREEKQRQELEKTRRKLEGDSTDLHDQIAELQAQIAELKMQLAKKEEELQAALARVEEESAQKNIALKKIRELESQISELQEDLETERAARNKAEKQKRDLGEELEALKTELEDTLDSTAAQQELRTKREQEVTQLKKTLEDEARTHEVQIQEIRQKHSQAVEELSEQLEQTKRLKGNLEKAKQSLEGERNELANEVKALLQGKGDSEHKRKKVEGQLQELQVKVTEGD--RVRAEL-----SEKANRLQVELDNVNSLLSQADGKSIKLGKDFSTLESQLQDTQELLQEETRQKLSFSTKLKQMEDEKNGLLEQIEEEEEAKKNLSKQISTLQSQMADMKKKMDENVGSLETVEELKKKLQKDLESVNQRFEEKAAAYDKLEKTKTRLQQELDDIAVDLDHQRQIVSNLEKKQKKFDQLLGEEKTISAKYADERDRAEAEAREKETKALALARSLEEALEAKAELERLNKQLRTEMEDLVSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEVNLQAMKAQFERDLQGRDEQSEDKKKQLVRQVKEMEAELEDERKQRSVAVAARKKLEMDLKDLEGQIDSANKNREEAIKQLRKLQAQIKDYQRELDDTRASRDDILSQSKESEKKLKSMEAEMIHMQEELAAAERGKRQAQQERDELADEIANNSGKGALALEEKRRLESRIAQLEEELEEEQGNTELVNDRLKKATLQVDQLNADLNAERSNAQKNENARQQMDRQNKELKTKLQELEGTVKSKFKANITALEAKIAQLEEQLDTETKERQNASKQVRRTEKKLKDVMMQVDDERRNAEQYKDQAEKNNVRMKQLKRQVEEAEEEAQRANAMRRKLQRELEDATETAEAMNREVNTLKSKL 1910          
BLAST of Myosin heavy chain vs. Ensembl Xenopus
Match: MYH9 (myosin, heavy chain 9, non-muscle [Source:NCBI gene;Acc:100487997])

HSP 1 Score: 1681.77 bits (4354), Expect = 0.000e+0
Identity = 937/1948 (48.10%), Postives = 1342/1948 (68.89%), Query Frame = 1
Query:   97 QYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPM---GILSLLDEECFFPKATTKTFVEKLIKNQSTHPKL-KATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKD---------------AENIIGLSTTTAQ-ESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKKQTELADKLAMNLEEIESKLSQ-------LTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILK 5853
            +YL VD++ V++    +DWA KKLVW+P +  GF + S+ EE GDEA V+L ENGK  K+  +++QK+NPPKF K EDM++L  LNEASVL+NLK+RY+S LIYTYSGLFCVV+NPYK LPIY+  ++E YKG+KRHE PPHIYA+TD AYR+M+QD+E+QSILCTGESGAGKTENTKKVIQYLA VATS K++K                 GELE QLLQANP+LEAFGNAKT+KNDNSSRFGKFIRINFD +G+I  ANIETYLLEK+R IRQA  ER FH+FY LL GA + LK +L+LE  + Y+ LSNG + +P   +K +F++T+EA+ IMG +++EQ  + RV+++VL +GNI FK+ER++DQA++PDNT AQK+ HL+G+ V + T+ +L P++K+GR+ V KAQTKEQA+F++EA++K+TYERMFRWLVMR+N+++D+  RQ  +FIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W FIDFGLDLQP IELIEKP    GIL+LLDEEC+FPKAT K+FVEK+++ Q +H K  K    + KADF +IHYAGKVDY +D WL+KNMDPLN+NV +LL +S++ FV  +W+D                + I+GL       ++A  GA  TRKGMFRTVGQLYKE L+KLM  L NTNPNFVRCIIPNHEKKSGK+D+ LV+DQL+CNGVLEGIRICRQGFPNR++FQEF+QRY ILTPN I KGFMDG++A  LM+  L++D++ YRIGQSK+FF+AGVLA LEE+RD+K+T++I+ FQ++ RGYLARK    R Q L A+K+IQRNC AYLKLRNW WW+LFT+V+             ++ +++K+ + + E+  ++ E  +     L +EK ++QE L+ E     + E  R  L  + +++E    + ESR  E +++C  L+ +K K+Q+ I +L + LE EE   QK Q +K++ + ++K+LE+ V  LED+ +KL KEKK  EER+A+  + LAEEEEKSK L KLK++HET I++LEERL RE+  RQ+LEKT+R+LE + ++  D ++       E+++ L + E ++    A+++EE+  K++A ++IR+ E+ I+E++EDLE E+ ++ +AEK KRDL EE+E+LK EL DT +++  QQ +  K+E E+   KK+ EDE +  E+++QEIR+K +  +E L+ Q+E   + K  +EKAK  L+ E N+  NE+  L   K DSE  +K  E QL E+  +++E +  ++ AE      +E A++L + L+ + S LSQ       L K   ++ SQL D Q+  +EETR KL+  T L+Q+E +   L +Q+EEE+++K+NL   +  LQSQM D+KKK++E+   L   +E +KK+ ++ E +  R EE     ++ EK K  +Q EL D    L+ Q+   +  ++K KK +  + E   ++ KY  E+D  E E REKETK + L R +    +  +ELE     L  ++ +LVSSKDDVGK+V  LEK+K  LE  +E  K  +EELE+E    +  K R+E+ L A KAQ +R+L  +DE  +++ + + +++++ EA LE+E+K ++  V+ +KK+E +  DL  Q+  + K +EE  +Q++K Q    + QRE+ +  A+++D L Q KE EK+L++ E+ +  + E+L+ +ER KR    ERDE  +EIA  +     A+ +K+R+ES I+ L  + EE Q     + D+ KK   Q++Q+  +LN ER N  + EN +   +R NKEL  K++ELE     K+KA + A ++KI  L+ QLD + +E   A++  ++ E+KLK++M  + DE + A+   +Q EK   R K+ +R ++  +E     +   R+LQR+LE+  ET EA ++E+  LK
Sbjct:    8 KYLYVDRNFVNNPLAQADWAAKKLVWVPSEKHGFEAASVKEEVGDEAIVELAENGKKAKVNKDDIQKMNPPKFSKVEDMSELACLNEASVLHNLKERYYSGLIYTYSGLFCVVINPYKYLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAYVATSHKSKKEQ---------------GELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKSDLLLEAYNKYRFLSNGHVTIPGQQDKDLFQETMEAMKIMGFTEEEQIGLLRVVSSVLQLGNIAFKKERNTDQASMPDNTAAQKLCHLMGINVNDFTRGILLPRIKVGRDFVQKAQTKEQADFAIEALAKATYERMFRWLVMRVNKALDKTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIEKPAGPPGILALLDEECWFPKATDKSFVEKVVQEQGSHSKFQKPKQLKDKADFCIIHYAGKVDYKADEWLLKNMDPLNDNVATLLNQSSDKFVSELWRDVSFLYTLMAGIFFCLVDRIVGLDQVAGMADTALPGAFKTRKGMFRTVGQLYKEQLSKLMATLRNTNPNFVRCIIPNHEKKSGKLDAHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQRYEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKITDVIISFQAFCRGYLARKAFAKRQQQLTAMKVIQRNCAAYLKLRNWQWWRLFTKVR--------LHAKEVELQKVKELQVSSEQKVSEMENVQM---MLQQEKMQLQEQLQAEIELCAEAEEMRARLATKKQELEEILHDLESRVEEEEERCQILQADKKKMQHNIVELEEQLEEEEAARQKLQLEKVTVEAKMKKLEEDVLVLEDQNSKLGKEKKLYEERIAEFTTNLAEEEEKSKSLAKLKNKHETMISDLEERLRREEKQRQELEKTRRKLEGDSTDLHDQIAELQAQIAELKMQLAKKEEELQAALARVEEESAQKNIALKKIRELESQISELQEDLETERAARNKAEKQKRDLGEELEALKTELEDTLDSTAAQQELRTKREQEVTQLKKTLEDEARTHEVQIQEIRQKHSQAVEELSEQLEQTKRLKGNLEKAKQSLEGERNELANEVKALLQGKGDSEHKRKKVEGQLQELQVKVTEGD--RVRAEL-----SEKANRLQVELDNVNSLLSQADGKSIKLGKDFSTLESQLQDTQELLQEETRQKLSFSTKLKQMEDEKNGLLEQIEEEEEAKKNLSKQISTLQSQMADMKKKMDENVGSLETVEELKKKLQKDLESVNQRFEEKAAAYDKLEKTKTRLQQELDDIAVDLDHQRQIVSNLEKKQKKFDQLLGEEKTISAKYADERDRAEAEAREKETKALALARSLEEALEAKAELERLNKQLRTEMEDLVSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEVNLQAMKAQFERDLQGRDEQSEDKKKQLVRQVKEMEAELEDERKQRSVAVAARKKLEMDLKDLEGQIDSANKNREEAIKQLRKLQAQIKDYQRELDDTRASRDDILSQSKESEKKLKSMEAEMIHMQEELAAAERGKRQAQQERDELADEIANNSGKGALALEEKRRLESRIAQLEEELEEEQGNTELVNDRLKKATLQVDQLNADLNAERSNAQKNENARQQMDRQNKELKTKLQELEGTVKSKFKANITALEAKIAQLEEQLDTETKERQNASKQVRRTEKKLKDVMMQVDDERRNAEQYKDQAEKNNVRMKQLKRQVEEAEEEAQRANAMRRKLQRELEDATETAEAMNREVNTLK 1922          
BLAST of Myosin heavy chain vs. Ensembl Xenopus
Match: MYH9 (myosin, heavy chain 9, non-muscle [Source:NCBI gene;Acc:100487997])

HSP 1 Score: 1681.38 bits (4353), Expect = 0.000e+0
Identity = 929/1929 (48.16%), Postives = 1327/1929 (68.79%), Query Frame = 1
Query:   97 QYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPM---GILSLLDEECFFPKATTKTFVEKLIKNQSTHPKL-KATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQ-ESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKI 5862
            +YL VD++ V++    +DWA KKLVW+P +  GF + S+ EE GDEA V+L ENGK  K+  +++QK+NPPKF K EDM++L  LNEASVL+NLK+RY+S LIYTYSGLFCVV+NPYK LPIY+  ++E YKG+KRHE PPHIYA+TD AYR+M+QD+E+QSILCTGESGAGKTENTKKVIQYLA VATS K++K                 GELE QLLQANP+LEAFGNAKT+KNDNSSRFGKFIRINFD +G+I  ANIETYLLEK+R IRQA  ER FH+FY LL GA + LK +L+LE  + Y+ LSNG + +P   +K +F++T+EA+ IMG +++EQ  + RV+++VL +GNI FK+ER++DQA++PDNT AQK+ HL+G+ V + T+ +L P++K+GR+ V KAQTKEQA+F++EA++K+TYERMFRWLVMR+N+++D+  RQ  +FIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W FIDFGLDLQP IELIEKP    GIL+LLDEEC+FPKAT K+FVEK+++ Q +H K  K    + KADF +IHYAGKVDY +D WL+KNMDPLN+NV +LL +S++ FV  +W+D + I+GL       ++A  GA  TRKGMFRTVGQLYKE L+KLM  L NTNPNFVRCIIPNHEKKSGK+D+ LV+DQL+CNGVLEGIRICRQGFPNR++FQEF+QRY ILTPN I KGFMDG++A  LM+  L++D++ YRIGQSK+FF+AGVLA LEE+RD+K+T++I+ FQ++ RGYLARK    R Q L A+K+IQRNC AYLKLRNW WW+LFT+V+                   +   + ++++    E      E L +EK ++QE L+ E     + E  R  L  + +++E    + ESR  E +++C  L+ +K K+Q+ I +L + LE EE   QK Q +K++ + ++K+LE+ V  LED+ +KL KEKK  EER+A+  + LAEEEEKSK L KLK++HET I++LEERL RE+  RQ+LEKT+R+LE + ++  D ++       E+++ L + E ++    A+++EE+  K++A ++IR+ E+ I+E++EDLE E+ ++ +AEK KRDL EE+E+LK EL DT +++  QQ +  K+E E+   KK+ EDE +  E+++QEIR+K +  +E L+ Q+E   + K  +EKAK  L+ E N+  NE+  L   K DSE  +K  E QL E+  +++E                   D++   LE+ + K  +L K   ++ SQL D Q+  +EETR KL+  T L+Q+E +   L +Q+EEE+++K+NL   +  LQSQ+  +KKK++E+   L   +E +KK+ ++ E +  R EE     ++ EK K  +Q EL D    L+ Q+   +  ++K KK +  + E   ++ KY  E+D  E E REKETK + L R +    +  +ELE     L  ++ +LVSSKDDVGK+V  LEK+K  LE  +E  K  +EELE+E    +  K R+E+ L A KAQ +R+L  +DE  +++ + + +++++ EA LE+E+K ++  V+ +KK+E +  DL  Q+  + K +EE  +Q++K Q    + QRE+ +  A+++D L Q KE EK+L++ E+ +  + E+L+ +ER KR    ERDE  +EIA  +     A+ +K+R+ES I+ L  + EE Q     + D+ KK   Q++Q+  +LN ER N  + EN +   +R NKEL  K++ELE     K+KA + A ++KI  L+ QLD + +E   A++  ++ E+KLK++M  + DE + A+   +Q EK   R K+ +R ++  +E     +   R+LQR+LE+  ET EA ++E+  LK+K+
Sbjct:    8 KYLYVDRNFVNNPLAQADWAAKKLVWVPSEKHGFEAASVKEEVGDEAIVELAENGKKAKVNKDDIQKMNPPKFSKVEDMSELACLNEASVLHNLKERYYSGLIYTYSGLFCVVINPYKYLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAYVATSHKSKKEQ---------------GELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKSDLLLEAYNKYRFLSNGHVTIPGQQDKDLFQETMEAMKIMGFTEEEQIGLLRVVSSVLQLGNIAFKKERNTDQASMPDNTAAQKLCHLMGINVNDFTRGILLPRIKVGRDFVQKAQTKEQADFAIEALAKATYERMFRWLVMRVNKALDKTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIEKPAGPPGILALLDEECWFPKATDKSFVEKVVQEQGSHSKFQKPKQLKDKADFCIIHYAGKVDYKADEWLLKNMDPLNDNVATLLNQSSDKFVSELWRDVDRIVGLDQVAGMADTALPGAFKTRKGMFRTVGQLYKEQLSKLMATLRNTNPNFVRCIIPNHEKKSGKLDAHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQRYEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKITDVIISFQAFCRGYLARKAFAKRQQQLTAMKVIQRNCAAYLKLRNWQWWRLFTKVR---------------LHAKEVELQKVKELQVSSEQKVSEMENLQQEKMQLQEQLQAEIELCAEAEEMRARLATKKQELEEILHDLESRVEEEEERCQILQADKKKMQHNIVELEEQLEEEEAARQKLQLEKVTVEAKMKKLEEDVLVLEDQNSKLGKEKKLYEERIAEFTTNLAEEEEKSKSLAKLKNKHETMISDLEERLRREEKQRQELEKTRRKLEGDSTDLHDQIAELQAQIAELKMQLAKKEEELQAALARVEEESAQKNIALKKIRELESQISELQEDLETERAARNKAEKQKRDLGEELEALKTELEDTLDSTAAQQELRTKREQEVTQLKKTLEDEARTHEVQIQEIRQKHSQAVEELSEQLEQTKRLKGNLEKAKQSLEGERNELANEVKALLQGKGDSEHKRKKVEGQLQELQVKVTE------------------GDRVPF-LEDSDGKSIKLGKDFSTLESQLQDTQELLQEETRQKLSFSTKLKQMEDEKNGLLEQIEEEEEAKKNLSKQISTLQSQVY-MKKKMDENVGSLETVEELKKKLQKDLESVNQRFEEKAAAYDKLEKTKTRLQQELDDIAVDLDHQRQIVSNLEKKQKKFDQLLGEEKTISAKYADERDRAEAEAREKETKALALARSLEEALEAKAELERLNKQLRTEMEDLVSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEVNLQAMKAQFERDLQGRDEQSEDKKKQLVRQVKEMEAELEDERKQRSVAVAARKKLEMDLKDLEGQIDSANKNREEAIKQLRKLQAQIKDYQRELDDTRASRDDILSQSKESEKKLKSMEAEMIHMQEELAAAERGKRQAQQERDELADEIANNSGKGALALEEKRRLESRIAQLEEELEEEQGNTELVNDRLKKATLQVDQLNADLNAERSNAQKNENARQQMDRQNKELKTKLQELEGTVKSKFKANITALEAKIAQLEEQLDTETKERQNASKQVRRTEKKLKDVMMQVDDERRNAEQYKDQAEKNNVRMKQLKRQVEEAEEEAQRANAMRRKLQRELEDATETAEAMNREVNTLKSKL 1886          
BLAST of Myosin heavy chain vs. Ensembl Xenopus
Match: MYH9 (myosin, heavy chain 9, non-muscle [Source:NCBI gene;Acc:100487997])

HSP 1 Score: 1679.84 bits (4349), Expect = 0.000e+0
Identity = 938/1937 (48.43%), Postives = 1336/1937 (68.97%), Query Frame = 1
Query:   97 QYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPM---GILSLLDEECFFPKATTKTFVEKLIKNQSTHPKL-KATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQ-ESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVK-PLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKKQTELADKLAMNLEEIESKLSQ-------LTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKI 5862
            +YL VD++ V++    +DWA KKLVW+P +  GF + S+ EE GDEA V+L ENGK  K+  +++QK+NPPKF K EDM++L  LNEASVL+NLK+RY+S LIYTYSGLFCVV+NPYK LPIY+  ++E YKG+KRHE PPHIYA+TD AYR+M+QD+E+QSILCTGESGAGKTENTKKVIQYLA VATS K++K                 GELE QLLQANP+LEAFGNAKT+KNDNSSRFGKFIRINFD +G+I  ANIETYLLEK+R IRQA  ER FH+FY LL GA + LK +L+LE  + Y+ LSNG + +P   +K +F++T+EA+ IMG +++EQ  + RV+++VL +GNI FK+ER++DQA++PDNT AQK+ HL+G+ V + T+ +L P++K+GR+ V KAQTKEQA+F++EA++K+TYERMFRWLVMR+N+++D+  RQ  +FIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W FIDFGLDLQP IELIEKP    GIL+LLDEEC+FPKAT K+FVEK+++ Q +H K  K    + KADF +IHYAGKVDY +D WL+KNMDPLN+NV +LL +S++ FV  +W+D + I+GL       ++A  GA  TRKGMFRTVGQLYKE L+KLM  L NTNPNFVRCIIPNHEKKSGK+D+ LV+DQL+CNGVLEGIRICRQGFPNR++FQEF+QRY ILTPN I KGFMDG++A  LM+  L++D++ YRIGQSK+FF+AGVLA LEE+RD+K+T++I+ FQ++ RGYLARK    R Q L A+K+IQRNC AYLKLRNW WW+LFT+V+     V  Q+        E K S+    +M             L +EK ++QE L+ E     + E  R  L  + +++E    + ESR  E +++C  L+ +K K+Q+ I +L + LE EE   QK Q +K++ + ++K+LE+ V  LED+ +KL KEKK  EER+A+  + LAEEEEKSK L KLK++HET I++LEERL RE+  RQ+LEKT+R+LE + ++  D ++       E+++ L + E ++    A+++EE+  K++A ++IR+ E+ I+E++EDLE E+ ++ +AEK KRDL EE+E+LK EL DT +++  QQ +  K+E E+   KK+ EDE +  E+++QEIR+K +  +E L+ Q+E   + K  +EKAK  L+ E N+  NE+  L   K DSE  +K  E QL E+  +++E +  ++ AE      +E A++L + L+ + S LSQ       L K   ++ SQL D Q+  +EETR KL+  T L+Q+E +   L +Q+EEE+++K+NL   +  LQSQ+  +KKK++E+   L   +E +KK+ ++ E +  R EE     ++ EK K  +Q EL D    L+ Q+   +  ++K KK +  + E   ++ KY  E+D  E E REKETK + L R +    +  +ELE     L  ++ +LVSSKDDVGK+V  LEK+K  LE  +E  K  +EELE+E    +  K R+E+ L A KAQ +R+L  +DE  +++ + + +++++ EA LE+E+K ++  V+ +KK+E +  DL  Q+  + K +EE  +Q++K Q    + QRE+ +  A+++D L Q KE EK+L++ E+ +  + E+L+ +ER KR    ERDE  +EIA  +        +K+R+ES I+ L  + EE Q     + D+ KK   Q++Q+  +LN ER N  + EN +   +R NKEL  K++ELE     K+KA + A ++KI  L+ QLD + +E   A++  ++ E+KLK++M  + DE + A+   +Q EK   R K+ +R ++  +E     +   R+LQR+LE+  ET EA ++E+  LK+K+
Sbjct:    7 KYLYVDRNFVNNPLAQADWAAKKLVWVPSEKHGFEAASVKEEVGDEAIVELAENGKKAKVNKDDIQKMNPPKFSKVEDMSELACLNEASVLHNLKERYYSGLIYTYSGLFCVVINPYKYLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAYVATSHKSKKEQ---------------GELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKSDLLLEAYNKYRFLSNGHVTIPGQQDKDLFQETMEAMKIMGFTEEEQIGLLRVVSSVLQLGNIAFKKERNTDQASMPDNTAAQKLCHLMGINVNDFTRGILLPRIKVGRDFVQKAQTKEQADFAIEALAKATYERMFRWLVMRVNKALDKTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIEKPAGPPGILALLDEECWFPKATDKSFVEKVVQEQGSHSKFQKPKQLKDKADFCIIHYAGKVDYKADEWLLKNMDPLNDNVATLLNQSSDKFVSELWRDVDRIVGLDQVAGMADTALPGAFKTRKGMFRTVGQLYKEQLSKLMATLRNTNPNFVRCIIPNHEKKSGKLDAHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQRYEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKITDVIISFQAFCRGYLARKAFAKRQQQLTAMKVIQRNCAAYLKLRNWQWWRLFTKVRLHAKEVELQKVKELQVSSEQKVSEMENVQM------------MLQQEKMQLQEQLQAEIELCAEAEEMRARLATKKQELEEILHDLESRVEEEEERCQILQADKKKMQHNIVELEEQLEEEEAARQKLQLEKVTVEAKMKKLEEDVLVLEDQNSKLGKEKKLYEERIAEFTTNLAEEEEKSKSLAKLKNKHETMISDLEERLRREEKQRQELEKTRRKLEGDSTDLHDQIAELQAQIAELKMQLAKKEEELQAALARVEEESAQKNIALKKIRELESQISELQEDLETERAARNKAEKQKRDLGEELEALKTELEDTLDSTAAQQELRTKREQEVTQLKKTLEDEARTHEVQIQEIRQKHSQAVEELSEQLEQTKRLKGNLEKAKQSLEGERNELANEVKALLQGKGDSEHKRKKVEGQLQELQVKVTEGD--RVRAEL-----SEKANRLQVELDNVNSLLSQADGKSIKLGKDFSTLESQLQDTQELLQEETRQKLSFSTKLKQMEDEKNGLLEQIEEEEEAKKNLSKQISTLQSQVY-MKKKMDENVGSLETVEELKKKLQKDLESVNQRFEEKAAAYDKLEKTKTRLQQELDDIAVDLDHQRQIVSNLEKKQKKFDQLLGEEKTISAKYADERDRAEAEAREKETKALALARSLEEALEAKAELERLNKQLRTEMEDLVSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEVNLQAMKAQFERDLQGRDEQSEDKKKQLVRQVKEMEAELEDERKQRSVAVAARKKLEMDLKDLEGQIDSANKNREEAIKQLRKLQAQIKDYQRELDDTRASRDDILSQSKESEKKLKSMEAEMIHMQEELAAAERGKRQAQQERDELADEIANNS--------EKRRLESRIAQLEEELEEEQGNTELVNDRLKKATLQVDQLNADLNAERSNAQKNENARQQMDRQNKELKTKLQELEGTVKSKFKANITALEAKIAQLEEQLDTETKERQNASKQVRRTEKKLKDVMMQVDDERRNAEQYKDQAEKNNVRMKQLKRQVEEAEEEAQRANAMRRKLQRELEDATETAEAMNREVNTLKSKL 1900          
BLAST of Myosin heavy chain vs. Ensembl Xenopus
Match: MYH9 (myosin, heavy chain 9, non-muscle [Source:NCBI gene;Acc:100487997])

HSP 1 Score: 1660.97 bits (4300), Expect = 0.000e+0
Identity = 932/1937 (48.12%), Postives = 1326/1937 (68.46%), Query Frame = 1
Query:   97 QYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPM---GILSLLDEECFFPKATTKTFVEKLIKNQSTHPKL-KATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQ-ESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVK-PLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKKQTELADKLAMNLEEIESKLSQ-------LTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKI 5862
            +YL VD++ V++    +DWA KKLVW+P +  GF + S+ EE GDEA V+L ENGK  K+  +++QK+NPPKF K EDM++L  LNEASVL+NLK+RY+S LIYTYSGLFCVV+NPYK LPIY+  ++E YKG+KRHE PPHIYA+TD AYR+M+QD+E+QSILCTGESGAGKTENTKKVIQYLA VATS K++K                 GELE QLLQANP+LEAFGNAKT+KNDNSSRFGKFIRINFD +G+I  ANIETYLLEK+R IRQA  ER FH+FY LL GA + LK +L+LE  + Y+ LSNG + +P   +K +F++T+EA+ IMG +++EQ  + RV+++VL +GNI FK+ER++DQA++PDNT AQK+ HL+G+ V + T+ +L P++K+GR+ V KAQTKEQA+F++EA++K+TYERMFRWLVMR+N+++D+  RQ  +FIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W FIDFGLDLQP IELIEKP    GIL+LLDEEC+FPKAT K+FVEK+++ Q +H K  K    + KADF +IHYAGKVDY +D WL+KNMDPLN+NV +LL +S++ FV  +W+D + I+GL       ++A  GA  TRKGMFRTVGQLYKE L+KLM  L NTNPNFVRCIIPNHEKKSGK+D+ LV+DQL+CNGVLEGIRICRQGFPNR++FQEF+QRY ILTPN I KGFMDG++A  LM+  L++D++ YRIGQSK+FF+AGVLA LEE+RD+K+T++I+ FQ++ RGYLARK    R Q L A+K+IQRNC AYLKLRNW WW+LFT+V+     V  Q+        E K S+    +M             L +EK ++QE L+ E     + E  R  L  + +++E    + ESR  E +++C  L+ +K K+Q+ I +L + LE EE   QK Q +K++ + ++K+LE+ V  LED+ +KL KEKK  EER+A+  + LAEEEEKSK L KLK++HET I++LEERL RE+  RQ+LEKT+R+LE + ++  D ++       E+++ L + E ++    A+++EE+  K++A ++IR+ E+ I+E++EDLE E+ ++ +AEK KRDL EE+E+LK EL DT +++  QQ +  K+E E+   KK+ EDE +  E+++QEIR+K +  +E L+ Q+E   + K  +EKAK  L+ E N+  NE+  L   K DSE  +K  E QL E+  +++E +  ++ AE      +E A++L + L+ + S LSQ       L K   ++ SQL D Q+  +EETR KL+  T L+Q+E +   L +Q+EEE+++K+NL   +  LQSQM D+KKK++E+   L   +E +KK+ ++ E +  R EE     ++ EK K  +Q EL D    L+ Q+   +  ++K KK +  + E   ++ KY  E+D  E E REKETK + L R +    +  +ELE     L  ++ +LVSSKDDVGK+V  LEK+K  LE  +E  K  +EELE+E    +  K R+E+ L A KAQ +R+L  +DE  +++ + + +++++ EA LE+E+K ++  V+ +KK+E +  DL  Q+  + K +EE  +Q++K Q    + QRE+ +  A+++D L Q KE EK+L++ E+ +  + E       A      +   AL            A+ +K+R+ES I+ L  + EE Q     + D+ KK   Q++Q+  +LN ER N  + EN +   +R NKEL  K++ELE     K+KA + A ++KI  L+ QLD + +E   A++  ++ E+KLK++M  + DE + A+   +Q EK   R K+ +R ++  +E     +   R+LQR+LE+  ET EA ++E+  LK+K+
Sbjct:    8 KYLYVDRNFVNNPLAQADWAAKKLVWVPSEKHGFEAASVKEEVGDEAIVELAENGKKAKVNKDDIQKMNPPKFSKVEDMSELACLNEASVLHNLKERYYSGLIYTYSGLFCVVINPYKYLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAYVATSHKSKKEQ---------------GELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKSDLLLEAYNKYRFLSNGHVTIPGQQDKDLFQETMEAMKIMGFTEEEQIGLLRVVSSVLQLGNIAFKKERNTDQASMPDNTAAQKLCHLMGINVNDFTRGILLPRIKVGRDFVQKAQTKEQADFAIEALAKATYERMFRWLVMRVNKALDKTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIEKPAGPPGILALLDEECWFPKATDKSFVEKVVQEQGSHSKFQKPKQLKDKADFCIIHYAGKVDYKADEWLLKNMDPLNDNVATLLNQSSDKFVSELWRDVDRIVGLDQVAGMADTALPGAFKTRKGMFRTVGQLYKEQLSKLMATLRNTNPNFVRCIIPNHEKKSGKLDAHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQRYEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKITDVIISFQAFCRGYLARKAFAKRQQQLTAMKVIQRNCAAYLKLRNWQWWRLFTKVRLHAKEVELQKVKELQVSSEQKVSEMENVQM------------MLQQEKMQLQEQLQAEIELCAEAEEMRARLATKKQELEEILHDLESRVEEEEERCQILQADKKKMQHNIVELEEQLEEEEAARQKLQLEKVTVEAKMKKLEEDVLVLEDQNSKLGKEKKLYEERIAEFTTNLAEEEEKSKSLAKLKNKHETMISDLEERLRREEKQRQELEKTRRKLEGDSTDLHDQIAELQAQIAELKMQLAKKEEELQAALARVEEESAQKNIALKKIRELESQISELQEDLETERAARNKAEKQKRDLGEELEALKTELEDTLDSTAAQQELRTKREQEVTQLKKTLEDEARTHEVQIQEIRQKHSQAVEELSEQLEQTKRLKGNLEKAKQSLEGERNELANEVKALLQGKGDSEHKRKKVEGQLQELQVKVTEGD--RVRAEL-----SEKANRLQVELDNVNSLLSQADGKSIKLGKDFSTLESQLQDTQELLQEETRQKLSFSTKLKQMEDEKNGLLEQIEEEEEAKKNLSKQISTLQSQMADMKKKMDENVGSLETVEELKKKLQKDLESVNQRFEEKAAAYDKLEKTKTRLQQELDDIAVDLDHQRQIVSNLEKKQKKFDQLLGEEKTISAKYADERDRAEAEAREKETKALALARSLEEALEAKAELERLNKQLRTEMEDLVSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEVNLQAMKAQFERDLQGRDEQSEDKKKQLVRQVKEMEAELEDERKQRSVAVAARKKLEMDLKDLEGQIDSANKNREEAIKQLRKLQAQIKDYQRELDDTRASRDDILSQSKESEKKLKSMEAEMIHMQE-------ASNGFIPKGYWAL------------ALEEKRRLESRIAQLEEELEEEQGNTELVNDRLKKATLQVDQLNADLNAERSNAQKNENARQQMDRQNKELKTKLQELEGTVKSKFKANITALEAKIAQLEEQLDTETKERQNASKQVRRTEKKLKDVMMQVDDERRNAEQYKDQAEKNNVRMKQLKRQVEEAEEEAQRANAMRRKLQRELEDATETAEAMNREVNTLKSKL 1891          
BLAST of Myosin heavy chain vs. Ensembl Mouse
Match: Myh10 (myosin, heavy polypeptide 10, non-muscle [Source:MGI Symbol;Acc:MGI:1930780])

HSP 1 Score: 1716.44 bits (4444), Expect = 0.000e+0
Identity = 959/1933 (49.61%), Postives = 1354/1933 (70.05%), Query Frame = 1
Query:   97 QYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNI-GELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPM---GILSLLDEECFFPKATTKTFVEKLIKNQSTHPKL-KATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQ-ESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLD-AESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKIDR 5868
            +YL VD++++ + A  +DW  KKLVWIP +  GF + S+ EE+GDE  V+L ENGK   +  +++QK+NPPKF K EDMA+LT LNEASVL+NLKDRY+S LIYTYSGLFCVV+NPYK LPIY+ N+IE Y+G+KRHE PPHIYA+++ AYR MLQD+E+QSILCTGESGAGKTENTKKVIQYLA VA+S K +K             D NI GELE QLLQANP+LE+FGNAKT+KNDNSSRFGKFIRINFD +G+I  ANIETYLLEK+R +RQA +ER FH+FYQLL GA + LK +L+LE  + Y+ LSNG I +P   +K  F++T+EA+ IMG S +E  S+ +V+++VL  GNI FK+ER++DQA++P+NTVAQK+ HLLG+ V E T+A+L P++K+GR+ V KAQTKEQA+F+VEA++K+TYER+FRWLV RIN+++DR  RQ  +FIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W FIDFGLDLQP I+LIE+P    G+L+LLDEEC+FPKAT KTFVEKL++ Q +H K  K    + KADF +IHYAGKVDY +D WL+KNMDPLN+NV +LL +S++ FV  +WKD + I+GL   T   E+AFG A  T+KGMFRTVGQLYKESLTKLM  L NTNPNFVRCIIPNHEK++GK+D  LV+DQL+CNGVLEGIRICRQGFPNRI+FQEF+QRY ILTPN I KGFMDG++A E M+  L++D + YRIGQSKIFF+AGVLA LEE+RD+K+T+II+ FQ+  RGYLARK    + Q L+A+K++QRNC AYLKLR+W WW++FT+VKPLL VTRQEE +  K+EEL K KE   K+  + E  ++ ++ L+EEKN + E L+ E     + E  R  L  + +++E    + ESR  E +++   L+ EK K+Q  I  L + L+ EE   QK Q +K++A+ +IK++E++V  LED+ +K  KEKK +E+R+A+  S LAEEEEK+K L K++++ E  I++LEERL +E+  RQ+LEK KR+L+ E ++  D ++      +E+++ L + E ++    A+ D+ET  K+ A +  R+ +  I E++ED E+EK S+ +AEK KRDL+EE+E+LK EL DT +T+  QQ +  K+E E+   KK+ EDETK  E ++Q++R++ A  +E L+ Q+E A + K  +EK K  L+ +  +   E+  L+  KA+SE  +K  + Q+ E+  ++SE +  +++ AE   K Q EL D ++  LEE E K  +  K    + SQL D Q+  +EETR KLN  + +RQLE +   L++Q EEE+++++NLE  V ALQSQ+ D KKKV++D   +   +E++KK++++ E L  RLEE +   ++ EK K  +Q EL D    L+ Q+   +  ++K KK +  + E   ++ +Y  E+D  E E REKETK + L R +    +   E E     L   + +L+SSKDDVGKNV  LEK+K  LE  +E  +  +EELE+E    +  K R+E+ + A KAQ +R+L ++DE ++E+ R++ K++R+ EA LE+E+K +   V+ KKK+E +  DL  Q+  + K ++E+ +Q++K Q    + QRE++E  A++++   Q KE EK+L++ E+ + QL E+L+ SERA+R    ERDE  +EIA     +   + +K+R+E+ I+ L  + EE Q  +  L D+ +K   Q++ +  EL  ER    + +N +   ER NKEL  K++ELE     K+KAT++A ++KI  L+ QL+ + +E   AN+  ++ E+KLKEI   + DE + AD   EQ+EKA  R K+ +R L+  +E  +  +   R+LQR+L++  E  E   +E+  LK ++ R
Sbjct:   12 RYLFVDRAVIYNPATQADWTAKKLVWIPSERHGFEAASIKEERGDEVMVELAENGKKAMVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKGRK-------------DHNIPGELERQLLQANPILESFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHIFYQLLSGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGFSHEEILSMLKVVSSVLQFGNISFKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQADFAVEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPANPPGVLALLDEECWFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNVATLLHQSSDRFVAELWKDVDRIVGLDQVTGMTETAFGSAYKTKKGMFRTVGQLYKESLTKLMATLRNTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYRIGQSKIFFRAGVLAHLEEERDLKITDIIIFFQAVCRGYLARKAFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRVFTKVKPLLQVTRQEEELQAKDEELLKVKEKQTKVEGELEEMERKHQQLLEEKNILAEQLQAETELFAEAEEMRARLAAKKQELEEILHDLESRVEEEEERNQILQNEKKKMQAHIQDLEEQLDEEEGARQKLQLEKVTAEAKIKKMEEEVLLLEDQNSKFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRNKQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQVDELKVQLTKKEEELQGALARGDDETLHKNNALKVARELQAQIAELQEDFESEKASRNKAEKQKRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKALEDETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKRKKLDAQVQELHAKVSEGDRLRVELAEKANKLQNEL-DNVSTLLEEAEKKGIKFAKDAAGLESQLQDTQELLQEETRQKLNLSSRIRQLEEEKNSLQEQQEEEEEARKNLEKQVLALQSQLADTKKKVDDDLGTIESLEEAKKKLLKDVEALSQRLEEKVLAYDKLEKTKNRLQQELDDLTVDLDHQRQIVSNLEKKQKKFDQLLAEEKGISARYAEERDRAEAEAREKETKALSLARALEEALEAKEEFERQNKQLRADMEDLMSSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDELQATEDAKLRLEVNMQAMKAQFERDLQTRDEQNEEKKRLLLKQVRELEAELEDERKQRALAVASKKKMEIDLKDLEAQIEAANKARDEVIKQLRKLQAQMKDYQRELEEARASRDEIFAQSKESEKKLKSLEAEILQLQEELASSERARRHAEQERDELADEIANSASGKSALLDEKRRLEARIAQLEEELEEEQSNMELLNDRFRKTTLQVDTLNTELAAERSAAQKSDNARQQLERQNKELKAKLQELEGAVKSKFKATISALEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEIFMQVEDERRHADQYKEQMEKANARMKQLKRQLEEAEEEATRANASRRKLQRELDDATEANEGLSREVSTLKNRLRR 1930          
BLAST of Myosin heavy chain vs. Ensembl Mouse
Match: Myh9 (myosin, heavy polypeptide 9, non-muscle [Source:MGI Symbol;Acc:MGI:107717])

HSP 1 Score: 1715.28 bits (4441), Expect = 0.000e+0
Identity = 952/1932 (49.28%), Postives = 1343/1932 (69.51%), Query Frame = 1
Query:   97 QYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPMG---ILSLLDEECFFPKATTKTFVEKLIKNQSTHPKL-KATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTA-QESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKK-QTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKIDR 5868
            +YL VDK+ +++    +DWA KKLVW+P    GF   SL EE G+EA V+L ENGK +K+  +++QK+NPPKF K EDMA+LT LNEASVL+NLK+RY+S LIYTYSGLFCVV+NPYK LPIY+  ++E YKG+KRHE PPHIYA+TD AYR+M+QD+E+QSILCTGESGAGKTENTKKVIQYLA VA+S K++K               + GELE QLLQANP+LEAFGNAKT+KNDNSSRFGKFIRINFD +G+I  ANIETYLLEK+R IRQA  ER FH+FY LL GA + LK +L+LE  + Y+ LSNG + +P   +K MF++T+EA+ IMGI +DEQ  + RVI+ VL +GNI FK+ER++DQA++PDNT AQKV+HLLG+ VT+ T+ +L P++K+GR+ V KAQTKEQA+F++EA++K+TYERMFRWLV+RIN+++D+  RQ  +FIGILDIAGFEIF++NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W FIDFGLDLQP I+LIEKP G   IL+LLDEEC+FPKAT K+FVEK+++ Q THPK  K    + KADF +IHYAGKVDY +D WL+KNMDPLN+N+ +LL +S++ FV  +WKD + IIGL       E+A  GA  TRKGMFRTVGQLYKE L KLM  L NTNPNFVRCIIPNHEKK+GK+D  LV+DQL+CNGVLEGIRICRQGFPNR++FQEF+QRY ILTPN I KGFMDG++A  LM+  L++D++ YRIGQSK+FF+AGVLA LEE+RD+K+T++I+ FQ+  RGYLARK    R Q L A+K++QRNC AYL+LRNW WW+LFT+VKPLL+  R E+ +  KE EL K +E            +     LM EK ++QE L+ E     + E  R  L  + +++E    + E+R  E +++C  L+ EK K+Q  I +L + LE EE   QK Q +K++ + ++K+LE+    +ED+  KL KEKK LE+R+A+  + L EEEEKSK L KLK++HE  IT+LEERL RE+  RQ+LEKT+R+LE + ++ SD ++       E+++ L + E ++    A+++EE   K++A ++IR+ E  I+E++EDLE+E+ S+ +AEK KRDL EE+E+LK EL DT +++  QQ +  K+E E+   KK+ EDE K  E ++QE+R+K +  +E L +Q+E   + K  +EKAK  L+ E  +  NE+  L   K DSE  +K  E QL E+  + SE E  + +   K+ K Q EL D +   L + +SK S+LTK   ++ SQL D Q+  +EE R KL+  T L+Q+E +    ++QLEEE+++K NLE  +  L +Q+ D+KKK+E+    L   +E+++++ ++ E L  RLEE +   ++ EK K  +Q EL D    L+ Q+   +  ++K KK +  + E   ++ KY  E+D  E E REKETK + L R +    ++ +ELE        ++ +L+SSKDDVGK+V  LEK+K  LE  +E  K  +EELE+E    +  K R+E+ L A KAQ +R+L  +DE  +E+ + + +++R+ EA LE+E+K ++  ++ +KK+E +  DL   +  + K +EE  +Q++K Q    +  RE+ +  A++ + L Q KE EK+L++ E+ + QL E+L+ +ERAKR    ERDE  +EIA  +     A+ +K+R+E+ I+ L  + EE Q     + D+ KK   Q++Q+  +LN+ER +  + EN +   ER NKEL  K++E+E     KYKA++AA ++KI  L+ QLD + +E   A++  ++ E+KLK+++  + DE + A+   +Q +KA+ R K+ +R L+  +E     +   R+LQR+LE+  ET +A ++E+  LK K+ R
Sbjct:    8 KYLYVDKNFINNPLAQADWAAKKLVWVPSSKNGFEPASLKEEVGEEAIVELVENGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVVINPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKSKK---------------DQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKYRFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEDEQMGLLRVISGVLQLGNIAFKKERNTDQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKATYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDKSFVEKVVQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLLHQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMATLRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQRYEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKITDVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLRLRNWQWWRLFTKVKPLLNSIRHEDELLAKEAELTKVREKHLAAENRLTEMETMQSQLMAEKLQLQEQLQAETELCAEAEELRARLTAKKQELEEICHDLEARVEEEEERCQYLQAEKKKMQQNIQELEEQLEEEESARQKLQLEKVTTEAKLKKLEEDQIIMEDQNCKLAKEKKLLEDRVAEFTTNLMEEEEKSKSLAKLKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAKKEEELQAALARVEEEAAQKNMALKKIRELETQISELQEDLESERASRNKAEKQKRDLGEELEALKTELEDTLDSTAAQQELRSKREQEVSILKKTLEDEAKTHEAQIQEMRQKHSQAVEELADQLEQTKRVKATLEKAKQTLENERGELANEVKALLQGKGDSEHKRKKVEAQLQELQVKFSEGERVRTELADKVTKLQVEL-DSVTGLLSQSDSKSSKLTKDFSALESQLQDTQELLQEENRQKLSLSTKLKQMEDEKNSFREQLEEEEEAKRNLEKQIATLHAQVTDMKKKMEDGVGCLETAEEAKRRLQKDLEGLSQRLEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSVSNLEKKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERLNKQFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEVNLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSMAMAARKKLEMDLKDLEAHIDTANKNREEAIKQLRKLQAQMKDCMRELDDTRASREEILAQAKENEKKLKSMEAEMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEEEQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKAKLQEMESAVKSKYKASIAALEAKIAQLEEQLDNETKERQAASKQVRRTEKKLKDVLLQVEDERRNAEQFKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRR 1923          
BLAST of Myosin heavy chain vs. Ensembl Mouse
Match: Myh10 (myosin, heavy polypeptide 10, non-muscle [Source:MGI Symbol;Acc:MGI:1930780])

HSP 1 Score: 1712.58 bits (4434), Expect = 0.000e+0
Identity = 959/1933 (49.61%), Postives = 1354/1933 (70.05%), Query Frame = 1
Query:   97 QYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNI-GELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPM---GILSLLDEECFFPKATTKTFVEKLIKNQSTHPKL-KATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQ-ESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLD-AESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKIDR 5868
            +YL VD++++ + A  +DW  KKLVWIP +  GF + S+ EE+GDE  V+L ENGK   +  +++QK+NPPKF K EDMA+LT LNEASVL+NLKDRY+S LIYTYSGLFCVV+NPYK LPIY+ N+IE Y+G+KRHE PPHIYA+++ AYR MLQD+E+QSILCTGESGAGKTENTKKVIQYLA VA+S K +K             D NI GELE QLLQANP+LE+FGNAKT+KNDNSSRFGKFIRINFD +G+I  ANIETYLLEK+R +RQA +ER FH+FYQLL GA + LK +L+LE  + Y+ LSNG I +P   +K  F++T+EA+ IMG S +E  S+ +V+++VL  GNI FK+ER++DQA++P+NTVAQK+ HLLG+ V E T+A+L P++K+GR+ V KAQTKEQA+F+VEA++K+TYER+FRWLV RIN+++DR  RQ  +FIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W FIDFGLDLQP I+LIE+P    G+L+LLDEEC+FPKAT KTFVEKL++ Q +H K  K    + KADF +IHYAGKVDY +D WL+KNMDPLN+NV +LL +S++ FV  +WKD + I+GL   T   E+AFG A  T+KGMFRTVGQLYKESLTKLM  L NTNPNFVRCIIPNHEK++GK+D  LV+DQL+CNGVLEGIRICRQGFPNRI+FQEF+QRY ILTPN I KGFMDG++A E M+  L++D + YRIGQSKIFF+AGVLA LEE+RD+K+T+II+ FQ+  RGYLARK    + Q L+A+K++QRNC AYLKLR+W WW++FT+VKPLL VTRQEE +  K+EEL K KE   K+  + E  ++ ++ L+EEKN + E L+ E     + E  R  L  + +++E    + ESR  E +++   L+ EK K+Q  I  L + L+ EE   QK Q +K++A+ +IK++E++V  LED+ +K  KEKK +E+R+A+  S LAEEEEK+K L K++++ E  I++LEERL +E+  RQ+LEK KR+L+ E ++  D ++      +E+++ L + E ++    A+ D+ET  K+ A +  R+ +  I E++ED E+EK S+ +AEK KRDL+EE+E+LK EL DT +T+  QQ +  K+E E+   KK+ EDETK  E ++Q++R++ A  +E L+ Q+E A + K  +EK K  L+ +  +   E+  L+  KA+SE  +K  + Q+ E+  ++SE +  +++ AE   K Q EL D ++  LEE E K  +  K    + SQL D Q+  +EETR KLN  + +RQLE +   L++Q EEE+++++NLE  V ALQSQ+ D KKKV++D   +   +E++KK++++ E L  RLEE +   ++ EK K  +Q EL D    L+ Q+   +  ++K KK +  + E   ++ +Y  E+D  E E REKETK + L R +    +   E E     L   + +L+SSKDDVGKNV  LEK+K  LE  +E  +  +EELE+E    +  K R+E+ + A KAQ +R+L ++DE ++E+ R++ K++R+ EA LE+E+K +   V+ KKK+E +  DL  Q+  + K ++E+ +Q++K Q    + QRE++E  A++++   Q KE EK+L++ E+ + QL E+L+ SERA+R    ERDE  +EIA     +   + +K+R+E+ I+ L  + EE Q  +  L D+ +K   Q++ +  EL  ER    + +N +   ER NKEL  K++ELE     K+KAT++A ++KI  L+ QL+ + +E   AN+  ++ E+KLKEI   + DE + AD   EQ+EKA  R K+ +R L+  +E  +  +   R+LQR+L++  E  E   +E+  LK ++ R
Sbjct:   49 RYLFVDRAVIYNPATQADWTAKKLVWIPSERHGFEAASIKEERGDEVMVELAENGKKAMVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKGRK-------------DHNIPGELERQLLQANPILESFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHIFYQLLSGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGFSHEEILSMLKVVSSVLQFGNISFKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQADFAVEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPANPPGVLALLDEECWFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNVATLLHQSSDRFVAELWKDVDRIVGLDQVTGMTETAFGSAYKTKKGMFRTVGQLYKESLTKLMATLRNTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYRIGQSKIFFRAGVLAHLEEERDLKITDIIIFFQAVCRGYLARKAFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRVFTKVKPLLQVTRQEEELQAKDEELLKVKEKQTKVEGELEEMERKHQQLLEEKNILAEQLQAETELFAEAEEMRARLAAKKQELEEILHDLESRVEEEEERNQILQNEKKKMQAHIQDLEEQLDEEEGARQKLQLEKVTAEAKIKKMEEEVLLLEDQNSKFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRNKQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQVDELKVQLTKKEEELQGALARGDDETLHKNNALKVARELQAQIAELQEDFESEKASRNKAEKQKRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKALEDETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKRKKLDAQVQELHAKVSEGDRLRVELAEKANKLQNEL-DNVSTLLEEAEKKGIKFAKDAAGLESQLQDTQELLQEETRQKLNLSSRIRQLEEEKNSLQEQQEEEEEARKNLEKQVLALQSQLADTKKKVDDDLGTIESLEEAKKKLLKDVEALSQRLEEKVLAYDKLEKTKNRLQQELDDLTVDLDHQRQIVSNLEKKQKKFDQLLAEEKGISARYAEERDRAEAEAREKETKALSLARALEEALEAKEEFERQNKQLRADMEDLMSSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDELQATEDAKLRLEVNMQAMKAQFERDLQTRDEQNEEKKRLLLKQVRELEAELEDERKQRALAVASKKKMEIDLKDLEAQIEAANKARDEVIKQLRKLQAQMKDYQRELEEARASRDEIFAQSKESEKKLKSLEAEILQLQEELASSERARRHAEQERDELADEIANSASGKSALLDEKRRLEARIAQLEEELEEEQSNMELLNDRFRKTTLQVDTLNTELAAERSAAQKSDNARQQLERQNKELKAKLQELEGAVKSKFKATISALEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEIFMQVEDERRHADQYKEQMEKANARMKQLKRQLEEAEEEATRANASRRKLQRELDDATEANEGLSREVSTLKNRLRR 1967          
BLAST of Myosin heavy chain vs. Ensembl Mouse
Match: Myh10 (myosin, heavy polypeptide 10, non-muscle [Source:MGI Symbol;Acc:MGI:1930780])

HSP 1 Score: 1700.26 bits (4402), Expect = 0.000e+0
Identity = 958/1954 (49.03%), Postives = 1355/1954 (69.34%), Query Frame = 1
Query:   97 QYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNI-GELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPM---GILSLLDEECFFPKATTKTFVEKLIKNQSTHPKL-KATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKD---------------------AENIIGLSTTTAQ-ESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLD-AESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKIDR 5868
            +YL VD++++ + A  +DW  KKLVWIP +  GF + S+ EE+GDE  V+L ENGK   +  +++QK+NPPKF K EDMA+LT LNEASVL+NLKDRY+S LIYTYSGLFCVV+NPYK LPIY+ N+IE Y+G+KRHE PPHIYA+++ AYR MLQD+E+QSILCTGESGAGKTENTKKVIQYLA VA+S K +K    + + Q     V   GELE QLLQANP+LE+FGNAKT+KNDNSSRFGKFIRINFD +G+I  ANIETYLLEK+R +RQA +ER FH+FYQLL GA + LK +L+LE  + Y+ LSNG I +P   +K  F++T+EA+ IMG S +E  S+ +V+++VL  GNI FK+ER++DQA++P+NTVAQK+ HLLG+ V E T+A+L P++K+GR+ V KAQTKEQA+F+VEA++K+TYER+FRWLV RIN+++DR  RQ  +FIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W FIDFGLDLQP I+LIE+P    G+L+LLDEEC+FPKAT KTFVEKL++ Q +H K  K    + KADF +IHYAGKVDY +D WL+KNMDPLN+NV +LL +S++ FV  +WKD                      + I+GL   T   E+AFG A  T+KGMFRTVGQLYKESLTKLM  L NTNPNFVRCIIPNHEK++GK+D  LV+DQL+CNGVLEGIRICRQGFPNRI+FQEF+QRY ILTPN I KGFMDG++A E M+  L++D + YRIGQSKIFF+AGVLA LEE+RD+K+T+II+ FQ+  RGYLARK    + Q L+A+K++QRNC AYLKLR+W WW++FT+VKPLL VTRQEE +  K+EEL K KE   K+  + E  ++ ++ L+EEKN + E L+ E     + E  R  L  + +++E    + ESR  E +++   L+ EK K+Q  I  L + L+ EE   QK Q +K++A+ +IK++E++V  LED+ +K  KEKK +E+R+A+  S LAEEEEK+K L K++++ E  I++LEERL +E+  RQ+LEK KR+L+ E ++  D ++      +E+++ L + E ++    A+ D+ET  K+ A +  R+ +  I E++ED E+EK S+ +AEK KRDL+EE+E+LK EL DT +T+  QQ +  K+E E+   KK+ EDETK  E ++Q++R++ A  +E L+ Q+E A + K  +EK K  L+ +  +   E+  L+  KA+SE  +K  + Q+ E+  ++SE +  +++ AE   K Q EL D ++  LEE E K  +  K    + SQL D Q+  +EETR KLN  + +RQLE +   L++Q EEE+++++NLE  V ALQSQ+ D KKKV++D   +   +E++KK++++ E L  RLEE +   ++ EK K  +Q EL D    L+ Q+   +  ++K KK +  + E   ++ +Y  E+D  E E REKETK + L R +    +   E E     L   + +L+SSKDDVGKNV  LEK+K  LE  +E  +  +EELE+E    +  K R+E+ + A KAQ +R+L ++DE ++E+ R++ K++R+ EA LE+E+K +   V+ KKK+E +  DL  Q+  + K ++E+ +Q++K Q    + QRE++E  A++++   Q KE EK+L++ E+ + QL E+L+ SERA+R    ERDE  +EIA     +   + +K+R+E+ I+ L  + EE Q  +  L D+ +K   Q++ +  EL  ER    + +N +   ER NKEL  K++ELE     K+KAT++A ++KI  L+ QL+ + +E   AN+  ++ E+KLKEI   + DE + AD   EQ+EKA  R K+ +R L+  +E  +  +   R+LQR+L++  E  E   +E+  LK ++ R
Sbjct:   12 RYLFVDRAVIYNPATQADWTAKKLVWIPSERHGFEAASIKEERGDEVMVELAENGKKAMVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKGRK---DHNIPQESPKPVKPQGELERQLLQANPILESFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHIFYQLLSGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGFSHEEILSMLKVVSSVLQFGNISFKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQADFAVEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPANPPGVLALLDEECWFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNVATLLHQSSDRFVAELWKDEIQTIQRASFYDSVSGLHEPPVDRIVGLDQVTGMTETAFGSAYKTKKGMFRTVGQLYKESLTKLMATLRNTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYRIGQSKIFFRAGVLAHLEEERDLKITDIIIFFQAVCRGYLARKAFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRVFTKVKPLLQVTRQEEELQAKDEELLKVKEKQTKVEGELEEMERKHQQLLEEKNILAEQLQAETELFAEAEEMRARLAAKKQELEEILHDLESRVEEEEERNQILQNEKKKMQAHIQDLEEQLDEEEGARQKLQLEKVTAEAKIKKMEEEVLLLEDQNSKFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRNKQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQVDELKVQLTKKEEELQGALARGDDETLHKNNALKVARELQAQIAELQEDFESEKASRNKAEKQKRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKALEDETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKRKKLDAQVQELHAKVSEGDRLRVELAEKANKLQNEL-DNVSTLLEEAEKKGIKFAKDAAGLESQLQDTQELLQEETRQKLNLSSRIRQLEEEKNSLQEQQEEEEEARKNLEKQVLALQSQLADTKKKVDDDLGTIESLEEAKKKLLKDVEALSQRLEEKVLAYDKLEKTKNRLQQELDDLTVDLDHQRQIVSNLEKKQKKFDQLLAEEKGISARYAEERDRAEAEAREKETKALSLARALEEALEAKEEFERQNKQLRADMEDLMSSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDELQATEDAKLRLEVNMQAMKAQFERDLQTRDEQNEEKKRLLLKQVRELEAELEDERKQRALAVASKKKMEIDLKDLEAQIEAANKARDEVIKQLRKLQAQMKDYQRELEEARASRDEIFAQSKESEKKLKSLEAEILQLQEELASSERARRHAEQERDELADEIANSASGKSALLDEKRRLEARIAQLEEELEEEQSNMELLNDRFRKTTLQVDTLNTELAAERSAAQKSDNARQQLERQNKELKAKLQELEGAVKSKFKATISALEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEIFMQVEDERRHADQYKEQMEKANARMKQLKRQLEEAEEEATRANASRRKLQRELDDATEANEGLSREVSTLKNRLRR 1961          
BLAST of Myosin heavy chain vs. Ensembl Mouse
Match: Myh11 (myosin, heavy polypeptide 11, smooth muscle [Source:MGI Symbol;Acc:MGI:102643])

HSP 1 Score: 1666.74 bits (4315), Expect = 0.000e+0
Identity = 937/1933 (48.47%), Postives = 1341/1933 (69.37%), Query Frame = 1
Query:   91 DLQYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDR-NRQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEK---PMGILSLLDEECFFPKATTKTFVEKLIKNQSTHPKL-KATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQ-ESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKIDR 5868
            D ++L VDK+ ++     +DW  KKLVW+P + +GF + S+ EEKGDE  V+L ENGK + +  +++QK+NPPKF K EDMA+LT LNEASVL+NL++RYFS LIYTYSGLFCVVVNPYK LPIY+  +++ YKG+KRHE PPHIYA+ D AYR+MLQD+E+QSILCTGESGAGKTENTKKVIQYLA VA+S K +K ++      F       GELE QLLQANP+LEAFGNAKT+KNDNSSRFGKFIRINFD +G+I  ANIETYLLEK+R IRQA +ER FH+FY LL GA +++K +L+LE+ ++Y  LSNG + +P   + +MF++T+EA+ IMG +++EQ +I +V+++VL +GNI FK+ER++DQA++PDNT AQKV HL+G+ VT+ T+A+L P++K+GR+VV KAQTKEQA+F++EA++K+TYER+FRW++ R+N+++D+ +RQ  +F+GILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W FIDFGLDLQP IELIE+   P G+L+LLDEEC+FPKAT K+FVEKL   Q  HPK  K    + K +F +IHYAGKVDY +  WL KNMDPLN+NV SLL  S++ FV  +WKD + I+GL       ES+   A  T+KGMFRTVGQLYKE L KLM  L NT PNFVRCIIPNHEK+SGK+D+ LV++QL+CNGVLEGIRICRQGFPNRI+FQEF+QRY IL  N I KGFMDG++A  LM+  L++D + YRIGQSKIFF+ GVLA LEE+RD+K+T++I+ FQ+  RGYLARK    R Q L A+K+IQRNC AYLKLRNW WW+LFT+VKPLL VTRQEE +  KEEE++K KE  +K   + +  ++ +  L EEK  +QE L+ E     + E  R  L  + +++E    E E+R  E +D+  +L+ E+ K+  ++  L + LE EE   QK Q +K++A+ +IK+LE  +  ++D+ +KL+KE+K LEER++D+ + LAEEEEK+K LTKLKS+HE+ I+ELE RL +E+ +RQ+LEK KR+LE + S+  + ++       E+++ L + E ++    A+LDEE   K+ A ++IR+ E  I++++EDL++E+ ++ +AEK KRDL EE+E+LK EL DT +++  QQ +  K+E E+   KK+ ++ET+  E ++QE+R+K    +E L  Q+E   ++K  ++K+K  L++E  D   EL  L  +K + E  KK  E+QL ++  + S+ E  + +   K+ K     + +   L E E K  +L K   S+ SQL D Q+  +EETR KLN  T LRQLE +   L+DQL+EE ++K+NLE HV  L  Q+ D KKK+++ A  +   +E +K++ +E E L  + EE     ++ EK K  +Q EL D    L++Q+   +  ++K KK +  + E  N++ KY  E+D  E E REKETK + L R +    +   ELE    +L  ++ +LVSSKDDVGKNV  LEK+K  LET +E  K  +EELE+E    +  K R+E+ + A K Q +R+L ++DE ++E+ R + ++L + E  LE+E+K +    + KKK+E +  DL  Q   + K +EE  +Q++K Q    + QRE+ +  A++++     KE EK+ ++ E+++ QL EDL+ +ERA++    E++E  EE+A+    R+T   +K+R+E+ I+ L  + EE Q  +  + D+ +K   Q EQ+ NEL  ER    + E+ +   ER NKEL  K++E+E     K K+TVAA ++KI  L+ Q++ +  E   A ++ K+ ++KLKE++  + DE K A+   EQ EK   + K+ +R L+  +E +  ++   R+LQR+L+E  E+ EA  +E+  LK+K+ R
Sbjct:   10 DEKFLFVDKNFMNSPMAQADWVAKKLVWVPSEKQGFEAASIKEEKGDEVVVELVENGKKVTVGKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLRERYFSGLIYTYSGLFCVVVNPYKYLPIYSEKIVDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKKDSSITQGPSFA-----YGELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQARDERTFHIFYYLLAGAKEKMKSDLLLESFNSYTFLSNGFVPIPAAQDDEMFQETLEAMSIMGFNEEEQLAILKVVSSVLQLGNIVFKKERNTDQASMPDNTAAQKVCHLVGINVTDFTRAILTPRIKVGRDVVQKAQTKEQADFAIEALAKATYERLFRWILSRVNKALDKTHRQGASFLGILDIAGFEIFEVNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPNNPPGVLALLDEECWFPKATDKSFVEKLCSEQGNHPKFQKPKQLKDKTEFSIIHYAGKVDYNASAWLTKNMDPLNDNVTSLLNASSDKFVADLWKDVDRIVGLDQMAKMTESSLPSASKTKKGMFRTVGQLYKEQLGKLMTTLRNTTPNFVRCIIPNHEKRSGKLDAFLVLEQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFFRTGVLAHLEEERDLKITDVIMAFQAMCRGYLARKAFTKRQQQLTAMKVIQRNCAAYLKLRNWQWWRLFTKVKPLLQVTRQEEEMQAKEEEMQKIKERQQKAETELKELEQKHTQLAEEKTLLQEQLQAETELYAEAEEMRVRLAAKKQELEEILHEMEARLEEEEDRGQQLQAERKKMAQQMLDLEEQLEEEEAARQKLQLEKVTAEAKIKKLEDDILVMDDQNSKLSKERKLLEERVSDLTTNLAEEEEKAKNLTKLKSKHESMISELEVRLKKEEKSRQELEKLKRKLEGDASDFHEQIADLQAQIAELKMQLAKKEEELQAALARLDEEIAQKNNALKKIRELEGHISDLQEDLDSERAARNKAEKQKRDLGEELEALKTELEDTLDSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHTQAVEELTEQLEQFKRAKANLDKSKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEVQLQDLQSKCSDGERARAELSDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASLGSQLQDTQELLQEETRQKLNVSTKLRQLEDERNSLQDQLDEEMEAKQNLERHVSTLNIQLSDSKKKLQDFASTIEVMEEGKKRLQKEMEGLSQQYEEKAAAYDKLEKTKNRLQQELDDLVVDLDNQRQLVSNLEKKQKKFDQLLAEEKNISSKYADERDRAEAEAREKETKALSLARALEEALEAKEELERTNKMLKAEMEDLVSSKDDVGKNVHELEKSKRALETQMEEMKTQLEELEDELQATEDAKLRLEVNMQALKGQFERDLQARDEQNEEKRRQLQRQLHEYETELEDERKQRALAAAAKKKLEGDLKDLELQADSAIKGREEAIKQLRKLQAQMKDFQRELDDARASRDEIFATSKENEKKAKSLEADLMQLQEDLAAAERARKQADLEKEELAEELASSLSGRNTLQDEKRRLEARIAQLEEELEEEQGNMEAMSDRVRKATLQAEQLSNELATERSTAQKNESARQQLERQNKELRSKLQEVEGAVKAKLKSTVAALEAKIAQLEEQVEQEAREKQAATKSLKQKDKKLKEVLLQVEDERKMAEQYKEQAEKGNTKVKQLKRQLEEAEEESQRINANRRKLQRELDEATESNEAMGREVNALKSKLRR 1937          
BLAST of Myosin heavy chain vs. UniProt/SwissProt
Match: sp|Q9JLT0|MYH10_RAT (Myosin-10 OS=Rattus norvegicus OX=10116 GN=Myh10 PE=1 SV=1)

HSP 1 Score: 1716.44 bits (4444), Expect = 0.000e+0
Identity = 957/1933 (49.51%), Postives = 1354/1933 (70.05%), Query Frame = 1
Query:   97 QYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNI-GELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPM---GILSLLDEECFFPKATTKTFVEKLIKNQSTHPKL-KATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQ-ESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLD-AESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKIDR 5868
            +YL VD++++ + A  +DW  KKLVWIP +  GF + S+ EE+GDE  V+L ENGK   +  +++QK+NPPKF K EDMA+LT LNEASVL+NLKDRY+S LIYTYSGLFCVV+NPYK LPIY+ N+IE Y+G+KRHE+PPHIYA+++ AYR MLQD+++QSILCTGESGAGKTENTKKVIQYLA VA+S K +K             D NI GELE QLLQANP+LE+FGNAKT+KNDNSSRFGKFIRINFD +G+I  ANIETYLLEK+R +RQA +ER FH+FYQLL GA + LK +L+LE  + Y+ LSNG I +P   +K  F++T+EA+ IMG S +E  S+ +V+++VL  GNI FK+ER++DQA++P+NTVAQK+ HLLG+ V E T+A+L P++K+GR+ V KAQTKEQA+F+VEA++K+TYER+FRWLV RIN+++DR  RQ T+FIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W FIDFGLDLQP I+LIE+P    G+L+LLDEEC+FPKAT KTFVEKL++ Q +H K  K    + KADF +IHYAGKVDY +D WL+KNMDPLN+NV +LL +S++ FV  +WKD + I+GL   T   E+AFG A  T+KGMFR VGQLYKESLTKLM  L NTNPNFVRCIIPNHEK++GK+D  LV+DQL+CNGVLEGIRICRQGFPNRI+FQEF+QRY ILTPN I KGFMDG++A E M+  L++D + YRIGQSKIFF+AGVLA LEE+RD+K+T+II+ FQ+  RGYLARK    + Q L+A+K++QRNC AYLKLR+W WW++FT+VKPLL VTRQEE +  K+EEL K KE   K+  + E  ++ ++ L+EEKN + E L+ E     + E  R  L  + +++E    + ESR    +++   L+ EK K+Q  I  L + L+ EE   QK Q +K++A+ +IK++E++V  LED+ +K  KEKK +E+R+A+  S LAEEEEK+K L K++++ E  I++LEERL +E+  RQ+LEK KR+L+ E ++  D ++      +E+++ L + E ++    A+ D+ET  K+ A +  R+ +  I E++ED E+EK S+ +AEK KRDL+EE+E+LK EL DT +T+  QQ +  K+E E+   KK+ EDETK  E ++Q++R++ A  +E L+ Q+E A + K  +EK K  L+ +  +   E+  L+  KA+SE  +K  + Q+ E+  ++SE +  +++ AE   K Q EL D ++  LEE E K  +  K    + SQL D Q+  +EETR KLN  + +RQLE +   L++Q EEE+++++NLE  V ALQSQ+ D KKKV++D   +   +E++KK++++ E L  RLEE +   ++ EK K  +Q EL D    L+ Q+   +  ++K KK +  + E   ++ +Y  E+D  E E REKETK + L R +    +   E E     L   + +L+SSKDDVGKNV  LEK+K  LE  +E  +  +EELE+E    +  K R+E+ + A KAQ +R+L ++DE ++E+ R++ K++R+ EA LE+E+K +   V+ KKK+E +  DL  Q+  + K ++E+ +Q++K Q    + QRE++E  A++++   Q KE EK+L++ E+ + QL E+L+ SERA+R    ERDE  +EIA     +   + +K+R+E+ I+ L  + EE Q  +  L D+ +K   Q++ +  EL  ER    + +N +   ER NKEL  K++ELE     K+KAT++A ++KI  L+ QL+ + +E   AN+  ++ E+KLKEI   + DE + AD   EQ+EKA  R K+ +R L+  +E  +  +   R+LQR+L++  E  E   +E+  LK ++ R
Sbjct:   12 RYLFVDRAVIYNPATQADWTAKKLVWIPSERHGFEAASIKEERGDEVMVELAENGKKAMVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEKPPHIYAISESAYRCMLQDRKDQSILCTGESGAGKTENTKKVIQYLAHVASSHKGRK-------------DHNIPGELERQLLQANPILESFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHIFYQLLSGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGFSHEEILSMLKVVSSVLQFGNISFKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQADFAVEALAKATYERLFRWLVHRINKALDRTKRQGTSFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPANPPGVLALLDEECWFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNVATLLHQSSDRFVAELWKDVDRIVGLDQVTGMTETAFGSAYKTKKGMFRNVGQLYKESLTKLMATLRNTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYRIGQSKIFFRAGVLAHLEEERDLKITDIIIFFQAVCRGYLARKAFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRVFTKVKPLLQVTRQEEELQAKDEELLKVKEKQTKVEGELEEMERKHQQLLEEKNILAEQLQAETELFAEAEEMRARLAAKKQELEEILHDLESRVEGEEERNQILQNEKKKMQAHIQDLEEQLDEEEGARQKLQLEKVTAEAKIKKMEEEVLLLEDQNSKFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRNKQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQVDELKVQLTKKEEELQGALARGDDETLHKNNALKVARELQAQIAELQEDFESEKASRNKAEKQKRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKALEDETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKRKKLDAQVQELHAKVSEGDRLRVELAEKANKLQNEL-DNVSTLLEEAEKKGMKFAKDAAGLESQLQDTQELLQEETRQKLNLSSRIRQLEEEKNSLQEQQEEEEEARKNLEKQVLALQSQLADTKKKVDDDLGTIEGLEEAKKKLLKDVEALSQRLEEKVLAYDKLEKTKNRLQQELDDLTVDLDHQRQIVSNLEKKQKKFDQLLAEEKGISARYAEERDRAEAEAREKETKALSLARALEEALEAKEEFERQNKQLRADMEDLMSSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDELQATEDAKLRLEVNMQAMKAQFERDLQTRDEQNEEKKRLLLKQVRELEAELEDERKQRALAVASKKKMEIDLKDLEAQIEAANKARDEVIKQLRKLQAQMKDYQRELEEARASRDEIFAQSKESEKKLKSLEAEILQLQEELASSERARRHAEQERDELADEIANSASGKSALLDEKRRLEARIAQLEEELEEEQSNMELLNDRFRKTTLQVDTLNTELAAERSAAQKSDNARQQLERQNKELKAKLQELEGAVKSKFKATISALEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEIFMQVEDERRHADQYKEQMEKANARMKQLKRQLEEAEEEATRANASRRKLQRELDDATEANEGLSREVSTLKNRLRR 1930          
BLAST of Myosin heavy chain vs. UniProt/SwissProt
Match: sp|Q61879|MYH10_MOUSE (Myosin-10 OS=Mus musculus OX=10090 GN=Myh10 PE=1 SV=2)

HSP 1 Score: 1716.44 bits (4444), Expect = 0.000e+0
Identity = 959/1933 (49.61%), Postives = 1354/1933 (70.05%), Query Frame = 1
Query:   97 QYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNI-GELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPM---GILSLLDEECFFPKATTKTFVEKLIKNQSTHPKL-KATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQ-ESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLD-AESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKIDR 5868
            +YL VD++++ + A  +DW  KKLVWIP +  GF + S+ EE+GDE  V+L ENGK   +  +++QK+NPPKF K EDMA+LT LNEASVL+NLKDRY+S LIYTYSGLFCVV+NPYK LPIY+ N+IE Y+G+KRHE PPHIYA+++ AYR MLQD+E+QSILCTGESGAGKTENTKKVIQYLA VA+S K +K             D NI GELE QLLQANP+LE+FGNAKT+KNDNSSRFGKFIRINFD +G+I  ANIETYLLEK+R +RQA +ER FH+FYQLL GA + LK +L+LE  + Y+ LSNG I +P   +K  F++T+EA+ IMG S +E  S+ +V+++VL  GNI FK+ER++DQA++P+NTVAQK+ HLLG+ V E T+A+L P++K+GR+ V KAQTKEQA+F+VEA++K+TYER+FRWLV RIN+++DR  RQ  +FIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W FIDFGLDLQP I+LIE+P    G+L+LLDEEC+FPKAT KTFVEKL++ Q +H K  K    + KADF +IHYAGKVDY +D WL+KNMDPLN+NV +LL +S++ FV  +WKD + I+GL   T   E+AFG A  T+KGMFRTVGQLYKESLTKLM  L NTNPNFVRCIIPNHEK++GK+D  LV+DQL+CNGVLEGIRICRQGFPNRI+FQEF+QRY ILTPN I KGFMDG++A E M+  L++D + YRIGQSKIFF+AGVLA LEE+RD+K+T+II+ FQ+  RGYLARK    + Q L+A+K++QRNC AYLKLR+W WW++FT+VKPLL VTRQEE +  K+EEL K KE   K+  + E  ++ ++ L+EEKN + E L+ E     + E  R  L  + +++E    + ESR  E +++   L+ EK K+Q  I  L + L+ EE   QK Q +K++A+ +IK++E++V  LED+ +K  KEKK +E+R+A+  S LAEEEEK+K L K++++ E  I++LEERL +E+  RQ+LEK KR+L+ E ++  D ++      +E+++ L + E ++    A+ D+ET  K+ A +  R+ +  I E++ED E+EK S+ +AEK KRDL+EE+E+LK EL DT +T+  QQ +  K+E E+   KK+ EDETK  E ++Q++R++ A  +E L+ Q+E A + K  +EK K  L+ +  +   E+  L+  KA+SE  +K  + Q+ E+  ++SE +  +++ AE   K Q EL D ++  LEE E K  +  K    + SQL D Q+  +EETR KLN  + +RQLE +   L++Q EEE+++++NLE  V ALQSQ+ D KKKV++D   +   +E++KK++++ E L  RLEE +   ++ EK K  +Q EL D    L+ Q+   +  ++K KK +  + E   ++ +Y  E+D  E E REKETK + L R +    +   E E     L   + +L+SSKDDVGKNV  LEK+K  LE  +E  +  +EELE+E    +  K R+E+ + A KAQ +R+L ++DE ++E+ R++ K++R+ EA LE+E+K +   V+ KKK+E +  DL  Q+  + K ++E+ +Q++K Q    + QRE++E  A++++   Q KE EK+L++ E+ + QL E+L+ SERA+R    ERDE  +EIA     +   + +K+R+E+ I+ L  + EE Q  +  L D+ +K   Q++ +  EL  ER    + +N +   ER NKEL  K++ELE     K+KAT++A ++KI  L+ QL+ + +E   AN+  ++ E+KLKEI   + DE + AD   EQ+EKA  R K+ +R L+  +E  +  +   R+LQR+L++  E  E   +E+  LK ++ R
Sbjct:   12 RYLFVDRAVIYNPATQADWTAKKLVWIPSERHGFEAASIKEERGDEVMVELAENGKKAMVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKGRK-------------DHNIPGELERQLLQANPILESFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHIFYQLLSGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGFSHEEILSMLKVVSSVLQFGNISFKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQADFAVEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPANPPGVLALLDEECWFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNVATLLHQSSDRFVAELWKDVDRIVGLDQVTGMTETAFGSAYKTKKGMFRTVGQLYKESLTKLMATLRNTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYRIGQSKIFFRAGVLAHLEEERDLKITDIIIFFQAVCRGYLARKAFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRVFTKVKPLLQVTRQEEELQAKDEELLKVKEKQTKVEGELEEMERKHQQLLEEKNILAEQLQAETELFAEAEEMRARLAAKKQELEEILHDLESRVEEEEERNQILQNEKKKMQAHIQDLEEQLDEEEGARQKLQLEKVTAEAKIKKMEEEVLLLEDQNSKFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRNKQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQVDELKVQLTKKEEELQGALARGDDETLHKNNALKVARELQAQIAELQEDFESEKASRNKAEKQKRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKALEDETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKRKKLDAQVQELHAKVSEGDRLRVELAEKANKLQNEL-DNVSTLLEEAEKKGIKFAKDAAGLESQLQDTQELLQEETRQKLNLSSRIRQLEEEKNSLQEQQEEEEEARKNLEKQVLALQSQLADTKKKVDDDLGTIESLEEAKKKLLKDVEALSQRLEEKVLAYDKLEKTKNRLQQELDDLTVDLDHQRQIVSNLEKKQKKFDQLLAEEKGISARYAEERDRAEAEAREKETKALSLARALEEALEAKEEFERQNKQLRADMEDLMSSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDELQATEDAKLRLEVNMQAMKAQFERDLQTRDEQNEEKKRLLLKQVRELEAELEDERKQRALAVASKKKMEIDLKDLEAQIEAANKARDEVIKQLRKLQAQMKDYQRELEEARASRDEIFAQSKESEKKLKSLEAEILQLQEELASSERARRHAEQERDELADEIANSASGKSALLDEKRRLEARIAQLEEELEEEQSNMELLNDRFRKTTLQVDTLNTELAAERSAAQKSDNARQQLERQNKELKAKLQELEGAVKSKFKATISALEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEIFMQVEDERRHADQYKEQMEKANARMKQLKRQLEEAEEEATRANASRRKLQRELDDATEANEGLSREVSTLKNRLRR 1930          
BLAST of Myosin heavy chain vs. UniProt/SwissProt
Match: sp|Q8VDD5|MYH9_MOUSE (Myosin-9 OS=Mus musculus OX=10090 GN=Myh9 PE=1 SV=4)

HSP 1 Score: 1715.28 bits (4441), Expect = 0.000e+0
Identity = 952/1932 (49.28%), Postives = 1343/1932 (69.51%), Query Frame = 1
Query:   97 QYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPMG---ILSLLDEECFFPKATTKTFVEKLIKNQSTHPKL-KATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTA-QESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKK-QTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKIDR 5868
            +YL VDK+ +++    +DWA KKLVW+P    GF   SL EE G+EA V+L ENGK +K+  +++QK+NPPKF K EDMA+LT LNEASVL+NLK+RY+S LIYTYSGLFCVV+NPYK LPIY+  ++E YKG+KRHE PPHIYA+TD AYR+M+QD+E+QSILCTGESGAGKTENTKKVIQYLA VA+S K++K               + GELE QLLQANP+LEAFGNAKT+KNDNSSRFGKFIRINFD +G+I  ANIETYLLEK+R IRQA  ER FH+FY LL GA + LK +L+LE  + Y+ LSNG + +P   +K MF++T+EA+ IMGI +DEQ  + RVI+ VL +GNI FK+ER++DQA++PDNT AQKV+HLLG+ VT+ T+ +L P++K+GR+ V KAQTKEQA+F++EA++K+TYERMFRWLV+RIN+++D+  RQ  +FIGILDIAGFEIF++NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W FIDFGLDLQP I+LIEKP G   IL+LLDEEC+FPKAT K+FVEK+++ Q THPK  K    + KADF +IHYAGKVDY +D WL+KNMDPLN+N+ +LL +S++ FV  +WKD + IIGL       E+A  GA  TRKGMFRTVGQLYKE L KLM  L NTNPNFVRCIIPNHEKK+GK+D  LV+DQL+CNGVLEGIRICRQGFPNR++FQEF+QRY ILTPN I KGFMDG++A  LM+  L++D++ YRIGQSK+FF+AGVLA LEE+RD+K+T++I+ FQ+  RGYLARK    R Q L A+K++QRNC AYL+LRNW WW+LFT+VKPLL+  R E+ +  KE EL K +E            +     LM EK ++QE L+ E     + E  R  L  + +++E    + E+R  E +++C  L+ EK K+Q  I +L + LE EE   QK Q +K++ + ++K+LE+    +ED+  KL KEKK LE+R+A+  + L EEEEKSK L KLK++HE  IT+LEERL RE+  RQ+LEKT+R+LE + ++ SD ++       E+++ L + E ++    A+++EE   K++A ++IR+ E  I+E++EDLE+E+ S+ +AEK KRDL EE+E+LK EL DT +++  QQ +  K+E E+   KK+ EDE K  E ++QE+R+K +  +E L +Q+E   + K  +EKAK  L+ E  +  NE+  L   K DSE  +K  E QL E+  + SE E  + +   K+ K Q EL D +   L + +SK S+LTK   ++ SQL D Q+  +EE R KL+  T L+Q+E +    ++QLEEE+++K NLE  +  L +Q+ D+KKK+E+    L   +E+++++ ++ E L  RLEE +   ++ EK K  +Q EL D    L+ Q+   +  ++K KK +  + E   ++ KY  E+D  E E REKETK + L R +    ++ +ELE        ++ +L+SSKDDVGK+V  LEK+K  LE  +E  K  +EELE+E    +  K R+E+ L A KAQ +R+L  +DE  +E+ + + +++R+ EA LE+E+K ++  ++ +KK+E +  DL   +  + K +EE  +Q++K Q    +  RE+ +  A++ + L Q KE EK+L++ E+ + QL E+L+ +ERAKR    ERDE  +EIA  +     A+ +K+R+E+ I+ L  + EE Q     + D+ KK   Q++Q+  +LN+ER +  + EN +   ER NKEL  K++E+E     KYKA++AA ++KI  L+ QLD + +E   A++  ++ E+KLK+++  + DE + A+   +Q +KA+ R K+ +R L+  +E     +   R+LQR+LE+  ET +A ++E+  LK K+ R
Sbjct:    8 KYLYVDKNFINNPLAQADWAAKKLVWVPSSKNGFEPASLKEEVGEEAIVELVENGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVVINPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKSKK---------------DQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKYRFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEDEQMGLLRVISGVLQLGNIAFKKERNTDQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKATYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDKSFVEKVVQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLLHQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMATLRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQRYEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKITDVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLRLRNWQWWRLFTKVKPLLNSIRHEDELLAKEAELTKVREKHLAAENRLTEMETMQSQLMAEKLQLQEQLQAETELCAEAEELRARLTAKKQELEEICHDLEARVEEEEERCQYLQAEKKKMQQNIQELEEQLEEEESARQKLQLEKVTTEAKLKKLEEDQIIMEDQNCKLAKEKKLLEDRVAEFTTNLMEEEEKSKSLAKLKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAKKEEELQAALARVEEEAAQKNMALKKIRELETQISELQEDLESERASRNKAEKQKRDLGEELEALKTELEDTLDSTAAQQELRSKREQEVSILKKTLEDEAKTHEAQIQEMRQKHSQAVEELADQLEQTKRVKATLEKAKQTLENERGELANEVKALLQGKGDSEHKRKKVEAQLQELQVKFSEGERVRTELADKVTKLQVEL-DSVTGLLSQSDSKSSKLTKDFSALESQLQDTQELLQEENRQKLSLSTKLKQMEDEKNSFREQLEEEEEAKRNLEKQIATLHAQVTDMKKKMEDGVGCLETAEEAKRRLQKDLEGLSQRLEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSVSNLEKKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERLNKQFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEVNLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSMAMAARKKLEMDLKDLEAHIDTANKNREEAIKQLRKLQAQMKDCMRELDDTRASREEILAQAKENEKKLKSMEAEMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEEEQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKAKLQEMESAVKSKYKASIAALEAKIAQLEEQLDNETKERQAASKQVRRTEKKLKDVLLQVEDERRNAEQFKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRR 1923          
BLAST of Myosin heavy chain vs. UniProt/SwissProt
Match: sp|P35580|MYH10_HUMAN (Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3)

HSP 1 Score: 1713.74 bits (4437), Expect = 0.000e+0
Identity = 957/1933 (49.51%), Postives = 1355/1933 (70.10%), Query Frame = 1
Query:   97 QYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNI-GELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPM---GILSLLDEECFFPKATTKTFVEKLIKNQSTHPKL-KATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQ-ESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLD-AESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKIDR 5868
            +YL VD++++ + A  +DW  KKLVWIP +  GF + S+ EE+GDE  V+L ENGK   +  +++QK+NPPKF K EDMA+LT LNEASVL+NLKDRY+S LIYTYSGLFCVV+NPYK LPIY+ N+IE Y+G+KRHE PPHIYA+++ AYR MLQD+E+QSILCTGESGAGKTENTKKVIQYLA VA+S K +K             D NI GELE QLLQANP+LE+FGNAKT+KNDNSSRFGKFIRINFD +G+I  ANIETYLLEK+R +RQA +ER FH+FYQLL GA + LK +L+LE  + Y+ LSNG I +P   +K  F++T+EA+ IMG S +E  S+ +V+++VL  GNI FK+ER++DQA++P+NTVAQK+ HLLG+ V E T+A+L P++K+GR+ V KAQTKEQA+F+VEA++K+TYER+FRWLV RIN+++DR  RQ  +FIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W FIDFGLDLQP I+LIE+P    G+L+LLDEEC+FPKAT KTFVEKL++ Q +H K  K    + KADF +IHYAGKVDY +D WL+KNMDPLN+NV +LL +S++ FV  +WKD + I+GL   T   E+AFG A  T+KGMFRTVGQLYKESLTKLM  L NTNPNFVRCIIPNHEK++GK+D  LV+DQL+CNGVLEGIRICRQGFPNRI+FQEF+QRY ILTPN I KGFMDG++A E M+  L++D + YRIGQSKIFF+AGVLA LEE+RD+K+T+II+ FQ+  RGYLARK    + Q L+A+K++QRNC AYLKLR+W WW++FT+VKPLL VTRQEE +  K+EEL K KE   K+  + E  ++ ++ L+EEKN + E L+ E     + E  R  L  + +++E    + ESR  E +++   L+ EK K+Q  I  L + L+ EE   QK Q +K++A+ +IK++E+++  LED+ +K  KEKK +E+R+A+  S LAEEEEK+K L K++++ E  I++LEERL +E+  RQ+LEK KR+L+ E ++  D ++      +E+++ L + E ++    A+ D+ET  K+ A + +R+ +  I E++ED E+EK S+ +AEK KRDL+EE+E+LK EL DT +T+  QQ +  K+E E+   KK+ E+ETK  E ++Q++R++ A  +E L+ Q+E A + K  +EK K  L+ +  +   E+  L+  KA+SE  +K  + Q+ E+  ++SE +  +++ AE   K Q EL D ++  LEE E K  +  K   S+ SQL D Q+  +EETR KLN  + +RQLE +   L++Q EEE+++++NLE  V ALQSQ+ D KKKV++D   +   +E++KK++++ E L  RLEE     ++ EK K  +Q EL D    L+ Q+   +  ++K KK +  + E  +++ +Y  E+D  E E REKETK + L R +    +   E E     L   + +L+SSKDDVGKNV  LEK+K  LE  +E  +  +EELE+E    +  K R+E+ + A KAQ +R+L ++DE ++E+ R++ K++R+ EA LE+E+K +   V+ KKK+E +  DL  Q+  + K ++E+ +Q++K Q    + QRE++E  A++++   Q KE EK+L++ E+ + QL E+L+ SERA+R    ERDE  +EI      +   + +K+R+E+ I+ L  + EE Q  +  L D+ +K   Q++ +  EL  ER    + +N +   ER NKEL  K++ELE     K+KAT++A ++KI  L+ QL+ + +E   AN+  ++ E+KLKEI   + DE + AD   EQ+EKA  R K+ +R L+  +E  +  +   R+LQR+L++  E  E   +E+  LK ++ R
Sbjct:   12 RYLFVDRAVIYNPATQADWTAKKLVWIPSERHGFEAASIKEERGDEVMVELAENGKKAMVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKGRK-------------DHNIPGELERQLLQANPILESFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHIFYQLLSGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGFSHEEILSMLKVVSSVLQFGNISFKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQADFAVEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPANPPGVLALLDEECWFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNVATLLHQSSDRFVAELWKDVDRIVGLDQVTGMTETAFGSAYKTKKGMFRTVGQLYKESLTKLMATLRNTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYRIGQSKIFFRAGVLAHLEEERDLKITDIIIFFQAVCRGYLARKAFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRVFTKVKPLLQVTRQEEELQAKDEELLKVKEKQTKVEGELEEMERKHQQLLEEKNILAEQLQAETELFAEAEEMRARLAAKKQELEEILHDLESRVEEEEERNQILQNEKKKMQAHIQDLEEQLDEEEGARQKLQLEKVTAEAKIKKMEEEILLLEDQNSKFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRNKQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKLQLAKKEEELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFESEKASRNKAEKQKRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKALEEETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKRKKLDAQVQELHAKVSEGDRLRVELAEKASKLQNEL-DNVSTLLEEAEKKGIKFAKDAASLESQLQDTQELLQEETRQKLNLSSRIRQLEEEKNSLQEQQEEEEEARKNLEKQVLALQSQLADTKKKVDDDLGTIESLEEAKKKLLKDAEALSQRLEEKALAYDKLEKTKNRLQQELDDLTVDLDHQRQVASNLEKKQKKFDQLLAEEKSISARYAEERDRAEAEAREKETKALSLARALEEALEAKEEFERQNKQLRADMEDLMSSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDELQATEDAKLRLEVNMQAMKAQFERDLQTRDEQNEEKKRLLIKQVRELEAELEDERKQRALAVASKKKMEIDLKDLEAQIEAANKARDEVIKQLRKLQAQMKDYQRELEEARASRDEIFAQSKESEKKLKSLEAEILQLQEELASSERARRHAEQERDELADEITNSASGKSALLDEKRRLEARIAQLEEELEEEQSNMELLNDRFRKTTLQVDTLNAELAAERSAAQKSDNARQQLERQNKELKAKLQELEGAVKSKFKATISALEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEIFMQVEDERRHADQYKEQMEKANARMKQLKRQLEEAEEEATRANASRRKLQRELDDATEANEGLSREVSTLKNRLRR 1930          
BLAST of Myosin heavy chain vs. UniProt/SwissProt
Match: sp|P35579|MYH9_HUMAN (Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4)

HSP 1 Score: 1712.58 bits (4434), Expect = 0.000e+0
Identity = 957/1935 (49.46%), Postives = 1346/1935 (69.56%), Query Frame = 1
Query:   97 QYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPMG---ILSLLDEECFFPKATTKTFVEKLIKNQSTHPKL-KATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTA-QESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXM---TADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKK-QTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKIDR 5868
            +YL VDK+ +++    +DWA KKLVW+P D  GF   SL EE G+EA V+L ENGK +K+  +++QK+NPPKF K EDMA+LT LNEASVL+NLK+RY+S LIYTYSGLFCVV+NPYK LPIY+  ++E YKG+KRHE PPHIYA+TD AYR+M+QD+E+QSILCTGESGAGKTENTKKVIQYLA VA+S K++K               + GELE QLLQANP+LEAFGNAKT+KNDNSSRFGKFIRINFD +G+I  ANIETYLLEK+R IRQA  ER FH+FY LL GA + LK +L+LE  + Y+ LSNG + +P   +K MF++T+EA+ IMGI ++EQ  + RVI+ VL +GNI FK+ER++DQA++PDNT AQKV+HLLG+ VT+ T+ +L P++K+GR+ V KAQTKEQA+F++EA++K+TYERMFRWLV+RIN+++D+  RQ  +FIGILDIAGFEIF++NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W FIDFGLDLQP I+LIEKP G   IL+LLDEEC+FPKAT K+FVEK+++ Q THPK  K    + KADF +IHYAGKVDY +D WL+KNMDPLN+N+ +LL +S++ FV  +WKD + IIGL       E+A  GA  TRKGMFRTVGQLYKE L KLM  L NTNPNFVRCIIPNHEKK+GK+D  LV+DQL+CNGVLEGIRICRQGFPNR++FQEF+QRY ILTPN I KGFMDG++A  LM+  L++D++ YRIGQSK+FF+AGVLA LEE+RD+K+T++I+ FQ+  RGYLARK    R Q L A+K++QRNC AYLKLRNW WW+LFT+VKPLL V+RQEE +  KEEEL K +E          + ET +     LM EK ++QE L+ E     + E  R  L  + +++E    + E+R  E +++C  L+ EK K+Q  I +L + LE EE   QK Q +K++ + ++K+LE++   LED+  KL KEKK LE+R+A+  + L EEEEKSK L KLK++HE  IT+LEERL RE+  RQ+LEKT+R+LE + ++ SD ++       E+++ L + E ++    A+++EE   K++A ++IR+ E+ I+E++EDLE+E+ S+ +AEK KRDL EE+E+LK EL DT +++  QQ +  K+E E+   KK+ E+E K  E ++QE+R+K +  +E L  Q+E   + K  +EKAK  L+ E  +  NE+  L   K DSE  +K  E QL E+  + +E E  + +   K+ K Q EL D +   L + +SK S+LTK   ++ SQL D Q+  +EE R KL+  T L+Q+E +    ++QLEEE+++K NLE  +  L +Q+ D+KKK+E+    L   +E ++K+ ++ E L  R EE +   ++ EK K  +Q EL D    L+ Q+      ++K KK +  + E   ++ KY  E+D  E E REKETK + L R +    ++ +ELE        ++ +L+SSKDDVGK+V  LEK+K  LE  +E  K  +EELE+E    +  K R+E+ L A KAQ +R+L  +DE  +E+ + + +++R+ EA LE+E+K ++  V+ +KK+E +  DL   +  + K ++E  +Q++K Q    +  RE+ +  A++ + L Q KE EK+L++ E+ + QL E+L+ +ERAKR    ERDE  +EIA  +     A+ +K+R+E+ I+ L  + EE Q     + D+ KK   Q++Q+  +LN+ER +  + EN +   ER NKEL  K++E+E     KYKA++ A ++KI  L+ QLD + +E   A +  ++ E+KLK+++  + DE + A+   +Q +KA+ R K+ +R L+  +E     +   R+LQR+LE+  ET +A ++E+  LK K+ R
Sbjct:    8 KYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVENGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVVINPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAYVASSHKSKK---------------DQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKYRFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGLLRVISGVLQLGNIVFKKERNTDQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKATYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDKSFVEKVMQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLLHQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMATLRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQRYEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKITDVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPLLQVSRQEEEMMAKEEELVKVREKQLAAENRLTEMETLQSQ---LMAEKLQLQEQLQAETELCAEAEELRARLTAKKQELEEICHDLEARVEEEEERCQHLQAEKKKMQQNIQELEEQLEEEESARQKLQLEKVTTEAKLKKLEEEQIILEDQNCKLAKEKKLLEDRIAEFTTNLTEEEEKSKSLAKLKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAKKEEELQAALARVEEEAAQKNMALKKIRELESQISELQEDLESERASRNKAEKQKRDLGEELEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLEEEAKTHEAQIQEMRQKHSQAVEELAEQLEQTKRVKANLEKAKQTLENERGELANEVKVLLQGKGDSEHKRKKVEAQLQELQVKFNEGERVRTELADKVTKLQVEL-DNVTGLLSQSDSKSSKLTKDFSALESQLQDTQELLQEENRQKLSLSTKLKQVEDEKNSFREQLEEEEEAKHNLEKQIATLHAQVADMKKKMEDSVGCLETAEEVKRKLQKDLEGLSQRHEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSACNLEKKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERLNKQFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEVNLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSMAVAARKKLEMDLKDLEAHIDSANKNRDEAIKQLRKLQAQMKDCMRELDDTRASREEILAQAKENEKKLKSMEAEMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEEEQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMEGTVKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRTEKKLKDVLLQVDDERRNAEQYKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRR 1923          
BLAST of Myosin heavy chain vs. TrEMBL
Match: A0A4E0RIV7 (Non-muscle myosin II heavy chain OS=Fasciola hepatica OX=6192 GN=D915_003271 PE=3 SV=1)

HSP 1 Score: 1984.53 bits (5140), Expect = 0.000e+0
Identity = 1020/1919 (53.15%), Postives = 1443/1919 (75.20%), Query Frame = 1
Query:   76 NIDAKDLQYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPMGILSLLDEECFFPKATTKTFVEKLIKNQSTHPKLKATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKKQTELADKLAMN--LEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETK 5820
            ++D ++++ L+VDK LV D+A  SDWA+KKLVWIPDD +GF++ +++  +G+E TV++ ++GK  KL  + VQK+NPPK+ K+EDMA+LTYLNEASVL+NL+ RYFS +IYTYSGLFCVVVNPYKRLPIY +++IEWYKGRKRHERPPHIY++ D AYRNMLQD+E+QSILCTGESGAGKTENTKKVIQYLASVATS K+QKTT +N +S+F++ ++NIGELE QLL+ANP+LEAFGNAKTIKNDNSSRFGKFIRINFDTSGFI+ ANIETYLLEKARVIRQA +ERCFH+FYQLL  A  ++++EL+L+  ++Y+ L NG++ +P  DE+Q +++T EA++IMGIS ++Q +IFR+I+AVLH+GN++F+QER+SDQA LPD + AQKVAHLLG+P+ +M K+ LKP++K+G+++V K QTK Q EF+VEAISK+ YER+F WLV RIN+++DR  R   +F+GILDIAGFEIF++NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY +E IKWEFIDFGLDLQPTI+LIEKP+GIL+LLDEECFFPKAT K+FVEKL+K Q +HPK+   +FR  ADFGV+HYAG+VDY+S  WL KNMDPLN+NVV+L Q SN+S VQ IWKDAE I+ ++ T A ++AFG  +  RKGM RTV QLYKESL +LM VL NT+P+FVRCIIPNHEK+ G+ID+ LV+DQLKCNGVLEGIRICRQGFP+R+LFQEF+QRY ILTPN+I KGFMDGRKA   ML  L++++  YRIG SKIFFKAGVLA+LEEDRDI LT+II++FQ+ ARGYL+R+  + R Q+L AI +IQRNC AYLKLRNW WW+LFT+V+PLL+VTRQEE+VA KE+EL+K +E LEK+T +    ++ YE L +EKN++  +L++E  + Q+M+ ER  L+++L+ +E +  + E+R +E K K    E+E+ +LQ  I+ LS  LE EEQ  QK Q +K + ++R+ +L      +EDK NKL K KK LE+R+AD+ S L EEEE++KQL KLK++HE+S+ +LEERL REQ ARQDL++ KRRLE E +EK++  +    T EE++  + R E ++ Q+QA+LDEE  A+++A +++R++E +I E+KED+E+E++++++AE+AKRDL EE+E++++EL+D+G+ S  Q   LRK E EL N ++  + +T   E  +QE+RK  +V +E LN Q+E   K+K+ +E++K Q    + +   +L +L+SSK D ++ ++  E QL+E   ++ + E  + D E++L K   LAD  A N  +E++ESKL+++T+SE S  S+L +L+   +EETR+KL  Q+ +RQ+E +    KD L+ E+Q K  LE HV  LQ QMQD KKK EED QQ+ + +E RKK+ RE +    R EE   Q E+SEK+++ IQAEL+D  HA+ SQ+ DQ  ++R++KK+E+   E +N      AEK+T ++E R+++T+++  + E++   ++L E E  ++ L R+L +L S++DD GK++  LE+A  QL   L+  +  +EELE+E +T+ M K+R E+QL A + QL+RELA +DEM +EQ R   K+LR+ EA L++E+K +     ++KK+E++  D   +L  + + KEE  +Q+KKYQG S  +QRE++E V A+   ++ +++LEK+ R  E+  N L E+L  +ER  R + SE DE L+E++ +T A++ AI DK+R+E+ +       EE Q  +   E++ K+ ++QLEQ+Q + ++ER N  R E+Q+S+ E+  KEL D++ E E E G++ KA +A  ++++ + D QL+ + ++     +N K+LE+++KE++  M +E + A+   E  EKA    K+ +R L++ +E N+ L TQ RRLQRDLEE  E +
Sbjct:    8 SMDPQNVELLRVDKGLVDDTAAQSDWASKKLVWIPDDKQGFVAAAVLASEGEELTVQITDSGKKCKLHRDVVQKMNPPKYEKAEDMANLTYLNEASVLHNLRSRYFSGMIYTYSGLFCVVVNPYKRLPIYNDDIIEWYKGRKRHERPPHIYSIADSAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVATSAKSQKTTTANVISKFHSKEINIGELEAQLLKANPILEAFGNAKTIKNDNSSRFGKFIRINFDTSGFIAGANIETYLLEKARVIRQAPDERCFHIFYQLLANATPQMQEELLLDQANSYRFLPNGLLEIPGSDERQSYRETTEAMNIMGISPEDQNAIFRIISAVLHLGNLDFRQERNSDQATLPDTSAAQKVAHLLGIPMADMIKSFLKPRIKVGKDLVLKTQTKAQVEFAVEAISKAIYERLFLWLVARINKTLDRTKRPGASFVGILDIAGFEIFQVNSFEQLCINYTNEKLQQLFNHTMFILEQEEYNREGIKWEFIDFGLDLQPTIDLIEKPLGILALLDEECFFPKATDKSFVEKLLKTQESHPKMCKPEFRCSADFGVVHYAGRVDYISAGWLTKNMDPLNDNVVALFQASNDSLVQDIWKDAE-IVSMAATAATDTAFGAVRGVRKGMLRTVSQLYKESLVRLMGVLKNTSPSFVRCIIPNHEKRPGRIDAPLVLDQLKCNGVLEGIRICRQGFPSRVLFQEFRQRYEILTPNIISKGFMDGRKAVMKMLEVLELNSGLYRIGHSKIFFKAGVLAQLEEDRDIHLTDIIIRFQARARGYLSRRAREQRIQHLQAITVIQRNCVAYLKLRNWPWWRLFTKVRPLLTVTRQEEIVAAKEDELRKVREALEKITGEHGEVQRAYEKLTKEKNQLHAELQQEHESNQNMQTERVRLLEKLQALEEEYADVENRSLEDKAKLQTFELEQKRLQERITDLSDQLELEEQQRQKIQVEKSAVEQRMTQLNTDFVNVEDKQNKLAKAKKVLEDRVADLTSQLTEEEERNKQLLKLKAKHESSLQDLEERLVREQKARQDLDRAKRRLEAEAAEKTEQSAENQRTVEELQAQVSRLEAELTQLQARLDEEIIARTIAVKKVRESETLIQELKEDVESERKARDKAEEAKRDLTEELEAMRLELIDSGSNSVAQTEALRKYEGELSNLRRQLDAQTASHETAVQELRKNHSVALEALNEQLEQFKKAKIALERSKGQQDTAMEEIQKQLQSLQSSKNDLDRRRRQGEQQLNEAHMKMQDLEIQRGDFENRLNKA--LADLEASNNMIEDLESKLTRVTRSETSATSELTELRSRLDEETRMKLALQSQIRQIEDEREGAKDALDAEEQVKMALEKHVLTLQQQMQDAKKKAEEDVQQMEQLEEVRKKLARELDAAFNRNEELTAQLEKSEKSRKKIQAELEDTTHAMASQRYDQANNERRVKKLEAANAEAMNQLNHLQAEKETFDREMRDRDTRLLMYRNEIDNLKERLEETELQRASLARELEDLGSNRDDAGKSMIDLEQANYQLNQQLKEARQQLEELEDEVSTVTMEKQRTEVQLNALRTQLERELAGRDEMLEEQRRQTMKQLRELEAELDDEKKQRGVHFGVRKKLESDLADANQRLEMATRQKEEALKQLKKYQGVSGGMQRELEEAVRAREQAVEAMRDLEKKYRGMEAEKNHLQEELHGTERTSRALRSELDETLQEMSALTTAKNAAIEDKRRLEARLVGFEDQLEEAQSAMDAAEERYKRSLAQLEQLQADYSMERTNGMRAESQRSSLEKQVKELRDRLTEAEKEGGRRSKAQLATLEARLAAFDEQLEIEKQDKMTVTKNCKRLEKRMKELVIQMEEEKRSAEMIKESYEKAQASVKRIKRDLELLEEENAQLKTQRRRLQRDLEEATEAR 1923          
BLAST of Myosin heavy chain vs. TrEMBL
Match: A0A504Y9W6 (Non-muscle myosin II heavy chain OS=Fasciola gigantica OX=46835 GN=FGIG_08997 PE=3 SV=1)

HSP 1 Score: 1982.99 bits (5136), Expect = 0.000e+0
Identity = 1019/1919 (53.10%), Postives = 1442/1919 (75.14%), Query Frame = 1
Query:   76 NIDAKDLQYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPMGILSLLDEECFFPKATTKTFVEKLIKNQSTHPKLKATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKKQTELADKLAMN--LEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETK 5820
            ++D ++++ L+VDK LV D+A  SDWA+KKLVWIPDD +GF++ +++  +G+E TV++ ++GK  KL  + VQK+NPPK+ K+EDMA+LTYLNEASVL+NL+ RYFS +IYTYSGLFCVVVNPYKRLPIY +++IEWYKGRKRHERPPHIY++ D AYRNMLQD+E+QSILCTGESGAGKTENTKKVIQYLASVATS K+QKTT +N +S+F++ ++NIGELE QLL+ANP+LEAFGNAKTIKNDNSSRFGKFIRINFDTSGFI+ ANIETYLLEKARVIRQA +ERCFH+FYQLL  A  ++++EL+L+  ++Y+ L NG++ +P  DE+Q +++T EA++IMGIS ++Q +IFR+I+AVLH+GN++F+QER+SDQA LPD + AQKVAHLLG+P+ +M K+ LKP++K+G+++V K QTK Q EF+VEAISK+ YER+F WLV RIN+++DR  R   +F+GILDIAGFEIF++NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY +E IKWEFIDFGLDLQPTI+LIEKP+GIL+LLDEECFFPKAT K+FVEKL+K Q +HPK+   +FR  ADFGV+HYAG+VDY+S  WL KNMDPLN+NVV+L Q SN+S VQ IWKDAE I+ ++ T A ++AFG  +  RKGM RTV QLYKESL +LM VL NT+P+FVRCIIPNHEK+ G+ID+ LV+DQLKCNGVLEGIRICRQGFP+R+LFQEF+QRY ILTPN+I KGFMDGRKA   ML  L++++  YRIG SKIFFKAGVLA+LEEDRDI LT+II++FQ+ ARGYL+R+  + R Q+L AI +IQRNC AYLKLRNW WW+LFT+V+PLL+VTRQEE+VA KE+EL+K +E LEK+T +    ++ YE L +EKN++  +L++E  + Q+M+ ER  L+++L+ +E +  + E+R +E K K    E+E+ +LQ  I+ LS  LE EEQ  QK Q +K + ++R+ +L      +EDK NKL K KK LE+R+AD+ S L EEEE++KQL KLK++HE+S+ +LEERL REQ ARQDL++ KRRLE E +EK++  +    T EE++  + R E ++ Q+QA+LDEE  A+++A +++R++E +I E+KED+E+E++++++AE+AKRDL EE+E++++EL+D+G+ S  Q   LRK E EL N ++  + +T   E  +QE+RK  +V +E LN Q+E   K+K+ +E++K Q    + +   +L +L+SSK D ++ ++  E QL+E   ++ + E  + D E++L K   LAD  A N  +E++ESKL+++T+SE S  S+L +L+   +EETR+KL  Q+ +RQ+E +    KD L+ E+Q K  LE HV  LQ QMQD KKK EED QQ+ + +E RKK+ RE +    R EE   Q E+SEK+++ IQAEL+D  HA+ SQ+ DQ  ++R++KK+E+   E +N      AEK+T ++E R+++T+++  + E++   ++L E E  ++ L R+L +L S++DD GK++  LE+   QL   L+  +  +EELE+E +T+ M K+R E+QL A + QL+RELA +DEM +EQ R   K+LR+ EA L++E+K +     ++KK+E++  D   +L  + + KEE  +Q+KKYQG S  +QRE++E V A+   ++ +++LEK+ R  E+  N L E+L  +ER  R + SE DE L+E++ +T A++ AI DK+R+E+ +       EE Q  +   E++ K+ ++QLEQ+Q + ++ER N  R E+Q+S+ E+  KEL D++ E E E G++ KA +A  ++++ + D QL+ + ++     +N K+LE+++KE++  M +E + A+   E  EKA    K+ +R L++ +E N+ L TQ RRLQRDLEE  E +
Sbjct:    8 SMDPQNVELLRVDKGLVDDTAAQSDWASKKLVWIPDDKQGFVAAAVLASEGEELTVQITDSGKKCKLHRDVVQKMNPPKYEKAEDMANLTYLNEASVLHNLRSRYFSGMIYTYSGLFCVVVNPYKRLPIYNDDIIEWYKGRKRHERPPHIYSIADSAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVATSAKSQKTTTANVISKFHSKEINIGELEAQLLKANPILEAFGNAKTIKNDNSSRFGKFIRINFDTSGFIAGANIETYLLEKARVIRQAPDERCFHIFYQLLANATPQMQEELLLDQANSYRFLPNGLLEIPGSDERQSYRETTEAMNIMGISPEDQNAIFRIISAVLHLGNLDFRQERNSDQATLPDTSAAQKVAHLLGIPMADMIKSFLKPRIKVGKDLVLKTQTKAQVEFAVEAISKAIYERLFLWLVARINKTLDRTKRPGASFVGILDIAGFEIFQVNSFEQLCINYTNEKLQQLFNHTMFILEQEEYNREGIKWEFIDFGLDLQPTIDLIEKPLGILALLDEECFFPKATDKSFVEKLLKTQESHPKMCKPEFRCSADFGVVHYAGRVDYISAGWLTKNMDPLNDNVVALFQASNDSLVQDIWKDAE-IVSMAATAATDTAFGAVRGVRKGMLRTVSQLYKESLVRLMGVLKNTSPSFVRCIIPNHEKRPGRIDAPLVLDQLKCNGVLEGIRICRQGFPSRVLFQEFRQRYEILTPNIISKGFMDGRKAVMKMLEVLELNSGLYRIGHSKIFFKAGVLAQLEEDRDIHLTDIIIRFQARARGYLSRRAREQRIQHLQAITVIQRNCVAYLKLRNWPWWRLFTKVRPLLTVTRQEEIVAAKEDELRKVREALEKITGEHGEVQRAYEKLTKEKNQLHAELQQEHESNQNMQTERVRLLEKLQALEEEYADVENRSLEDKAKLQTFELEQKRLQERITDLSDQLELEEQQRQKIQVEKSAVEQRMTQLNTDFVNVEDKQNKLAKAKKVLEDRVADLTSQLTEEEERNKQLLKLKAKHESSLQDLEERLVREQKARQDLDRAKRRLEAEAAEKTEQSAENQRTVEELQAQVSRLEAELTQLQARLDEEIIARTIAVKKVRESETLIQELKEDVESERKARDKAEEAKRDLTEELEAMRLELIDSGSNSVAQTEALRKYEGELSNLRRQLDAQTASHETAVQELRKNHSVALEALNEQLEQFKKAKIALERSKGQQDTAMEEIQKQLQSLQSSKNDLDRRRRQGEQQLNEAHMKMQDLEIQRGDFENRLNKA--LADLEASNNMIEDLESKLTRVTRSETSATSELTELRSRLDEETRMKLALQSQIRQIEDEREGAKDALDAEEQVKMALEKHVLTLQQQMQDAKKKAEEDVQQMEQLEEVRKKLTRELDAAFNRNEELTAQLEKSEKSRKKIQAELEDTTHAMASQRYDQANNERRVKKLEAANAEAMNQLNHLQAEKETFDREMRDRDTRLLMYRNEIDNLKERLEETELQRASLARELEDLGSNRDDAGKSMIDLEQTNYQLNQQLKEARQQLEELEDEVSTVTMEKQRTEVQLNALRTQLERELAGRDEMLEEQRRQTMKQLRELEAELDDEKKQRGVHFGIRKKLESDLADANQRLEMATRQKEEALKQLKKYQGVSGGMQRELEEAVRAREQAVEAMRDLEKKYRGMEAEKNHLQEELHGTERTSRALRSELDETLQEMSALTTAKNAAIEDKRRLEARLVGFEDQLEEAQSAMDAAEERYKRSLAQLEQLQADYSMERTNGMRAESQRSSLEKQVKELRDRLTEAEKEGGRRSKAQLATLEARLAAFDEQLEIEKQDKMTVTKNCKRLEKRMKELVIQMEEEKRSAEMIKESYEKAQASVKRIKRDLELLEEENAQLKTQRRRLQRDLEEATEAR 1923          
BLAST of Myosin heavy chain vs. TrEMBL
Match: A0A4S2LML2 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006176 PE=3 SV=1)

HSP 1 Score: 1939.47 bits (5023), Expect = 0.000e+0
Identity = 1003/1930 (51.97%), Postives = 1437/1930 (74.46%), Query Frame = 1
Query:   82 DAKDLQYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPMGILSLLDEECFFPKATTKTFVEKLIKNQSTHPKLKATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKKQTELADKLAMN--LEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNE-TLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADN-AIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILK 5853
            D ++++ L+V K  + D+A  SDWA+KKLVW+PD+++GF+  +L++  G+E  V++ ++GK      + VQ++NPPKF K+EDMA+LT+LNEASVL+NLK RY+S +IYTYSGLFCVV+NPYKRLPIY + +IEWYKG++RHERPPHIYA+ D AYRNMLQD+E+QSILCTGESGAGKTENTKKVIQYLASVATS K QKTT +N +S+ ++ D+NIGELE QLL+ANP+LEAFGNAKTIKNDNSSRFGKFIRINFDTSGFI+ ANIETYLLEKARVIRQA +ERCFH+FYQLL  A   +K++L+L+  + Y+ LSNGM+ +P  DE Q +++T EA+DIMGI+K++Q +IFRVI+AVLH+GN++F+QER+SDQA LPD++VAQK  HLLG+P+ +MTKA LKP++K+G+++V+KAQTK Q EF+VEAISKS YER+F WLV RIN+++DR  R   +F+GILDIAGFEIF++NSFEQLCINYTNEKLQQLFNHTMFVLEQ+EY +E I W+FIDFGLDLQPTI+LIEKP+GIL+LLDEECFFPKAT K+FVEKL+K Q  HPK+   DFR+ ADFGV+HYAG+VDYVS  WL KNMDPLN+N+V+L   S++  VQ I+KDAE II +S T A ++AFG A+  RKGM RTVGQLYKESL +LM VL NT+P+FVRCIIPNHEK+ G+ID  LV+DQLKCNGVLEGIRICRQGFP+R+LFQEF+QRY ILTPN+I KGFMDGR A   ML  L+++A  YRIG SKIFFKAGVLA+LEEDRDI LT++I++FQ+ ARGYLAR+  + R Q+  AI +IQRNC AYLKLRNW WW+LFT+V+PLL+VTRQEEVVA KE+EL+K +E LEK+T D    +++YE L +EK ++Q +LE+E  + Q+++ ER  L++R++++E +  E E++ +E K K    ++E  +L+ +++ LS  LE+EEQ  QK Q +K S ++R+ ++  +   LEDK NKL K+KK L +R+AD+ S LAEEEE+SKQL KLK++HE+SI +LEERL+REQ +RQDL+++KRRLE E +E+SD    Q    EE+   + + E ++ Q Q++LDEE  AK++A ++IR+ E++I E+KEDLE+E++++++AE+AKRDL EE+E++++EL+D+G+ +  Q   L K E E+ N ++  + ++   E  + E+RK  AV+++ +  Q+E A K+K  +EK K Q    + +   ++ +L+  K+D +K ++  E QL+E+  RL + E  + D +++L K   LAD  A N  LEE+E+KL+++ +SE +  ++L +++   ++ET+ KL+ Q+ +RQLE +    KD LE E+Q K  LE HV  LQ QMQD KKKVEED   + + +++RKK++RE +    R EE + Q E+ EK+++ +Q EL+DA HA+ SQ++DQ  ++R++KK+E+   E T  LN +  AEK+  ++E R+++T+++  + E     ++L E E  + +L R+L +L S++DD GK++  L++A  QL+  L   +  +EELE+E +T+ M K+R E+QL A K QL+R+LAS+DE+ +EQ R   K+LRD EA LE+E+K + + + ++KK+E++  +   +L  + + K+E  +Q+KK+Q    ++QR+M+E + +++  L+ ++++EK+ RT+E+  N   EDL  SER  R I SE DEALEE+A+ T  ++ A+ +KKR+E+ I +     EE Q  +   E++ K+ ++QLEQ+Q +L+ ER N  R ++Q+ + E+  KEL D++ E E ++G++ KA +A  +++I + D QL+ +  E   A   + +   K  + MAL  +E KR+   + +  EKA    K+ +R ++  +E N+ L TQ RRLQRDLEE  E +   +++++ L+
Sbjct:   10 DPQNVELLRVGKGPLEDTAAQSDWASKKLVWVPDEHQGFVMATLLDTVGEECKVQIVDSGKKCSFHHDLVQRMNPPKFEKAEDMANLTFLNEASVLHNLKSRYYSGMIYTYSGLFCVVINPYKRLPIYNDEIIEWYKGKRRHERPPHIYAIADAAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVATSAKTQKTTTANVISKLHSQDINIGELEAQLLKANPILEAFGNAKTIKNDNSSRFGKFIRINFDTSGFIAGANIETYLLEKARVIRQAPDERCFHIFYQLLATATSEMKEKLLLDQAAAYRFLSNGMLEIPGSDEHQAYRETSEAMDIMGITKEDQMAIFRVISAVLHLGNLDFRQERNSDQATLPDHSVAQKACHLLGIPLVDMTKAFLKPRIKVGKDLVSKAQTKAQVEFAVEAISKSIYERLFLWLVDRINKTLDRTKRPGASFVGILDIAGFEIFQVNSFEQLCINYTNEKLQQLFNHTMFVLEQDEYSREGIPWDFIDFGLDLQPTIDLIEKPLGILALLDEECFFPKATDKSFVEKLLKTQEAHPKICKPDFRSSADFGVLHYAGRVDYVSAQWLTKNMDPLNDNIVALFLASSDPLVQDIYKDAE-IISMSATAANDTAFGTARGVRKGMLRTVGQLYKESLVRLMAVLKNTSPSFVRCIIPNHEKRPGRIDPPLVLDQLKCNGVLEGIRICRQGFPSRVLFQEFRQRYEILTPNIIPKGFMDGRNAVMKMLEALELNAGLYRIGHSKIFFKAGVLAQLEEDRDIHLTDVIIRFQARARGYLARRARELRIQHQQAITVIQRNCVAYLKLRNWPWWRLFTKVRPLLTVTRQEEVVAAKEDELRKVREALEKITNDLAELQRSYEKLTKEKTQLQAELEQEHESNQNIQAERLRLLERIQNLEDEFLEMENKGVEEKVKLQNADLEIKRLKEQVADLSDQLEAEEQQRQKLQVEKGSIEQRMTQVNTENVNLEDKYNKLVKDKKVLTDRVADLSSQLAEEEERSKQLLKLKAKHESSIQDLEERLAREQKSRQDLDRSKRRLEAEAAERSDLTVEQQRNLEELNALVSKLEAELSQQQSRLDEEIVAKTIAAKKIREDESLIQELKEDLESERKARDKAEEAKRDLTEEVEAMRLELIDSGSNTVAQTEALHKYEAEVSNLRRQLDAQSSAHEAAIMELRKNHAVSLDAVTEQLEQAKKAKAALEKTKSQQDASIEELQKQVQSLQMGKSDLDKRRRQGEQQLNEVQIRLQDLEIQRNDFDNRLTKA--LADLEAANSTLEELEAKLTRVARSESAAVAELNEVRVRLDDETKAKLSLQSQVRQLEDEREGAKDALEAEEQVKAALEKHVHTLQQQMQDAKKKVEEDVHHMEQLEDARKKLIRELDASNNRNEELVAQVEKLEKSRKKLQGELEDANHAMASQRSDQANNERRVKKLEAANAELTAQLN-QLQAEKEAFDREMRDRDTRLLMHRNENEDLKERLEEAERQRGMLARELEDLGSNRDDAGKSMIELQQANYQLDQQLREARQQLEELEDEVSTVIMEKQRTEVQLNALKTQLERDLASRDELLEEQRRQTLKQLRDLEAELEDERKQRGSHLEVRKKLESDLSEATQRLELASRQKDEALKQLKKFQSVGGSMQRDMEEAIRSRDQALESLRDIEKKWRTAEAERNHFQEDLQASERTCRAIRSELDEALEELASTTSTKNAAVEEKKRLEARIVSFEDQLEEAQNGMDAAEERFKRSLAQLEQLQTDLSTERNNAMRADSQRLSLEKQVKELRDRLAEAEKDSGRRSKAQIATLEARIAAFDEQLETEKSE-KMAATKSCRRLEKRIKEMALQIEEEKRSSQLSKDSYEKAQNSLKRIKREIETLEEENAQLKTQRRRLQRDLEEAAEARRIAERDLQNLR 1934          
BLAST of Myosin heavy chain vs. TrEMBL
Match: A0A4S2LP74 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006176 PE=3 SV=1)

HSP 1 Score: 1938.7 bits (5021), Expect = 0.000e+0
Identity = 1003/1930 (51.97%), Postives = 1437/1930 (74.46%), Query Frame = 1
Query:   82 DAKDLQYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPMGILSLLDEECFFPKATTKTFVEKLIKNQSTHPKLKATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKKQTELADKLAMN--LEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNE-TLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADN-AIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILK 5853
            D ++++ L+V K  + D+A  SDWA+KKLVW+PD+++GF+  +L++  G+E  V++ ++GK      + VQ++NPPKF K+EDMA+LT+LNEASVL+NLK RY+S +IYTYSGLFCVV+NPYKRLPIY + +IEWYKG++RHERPPHIYA+ D AYRNMLQD+E+QSILCTGESGAGKTENTKKVIQYLASVATS K QKTT +N +S+ ++ D+NIGELE QLL+ANP+LEAFGNAKTIKNDNSSRFGKFIRINFDTSGFI+ ANIETYLLEKARVIRQA +ERCFH+FYQLL  A   +K++L+L+  + Y+ LSNGM+ +P  DE Q +++T EA+DIMGI+K++Q +IFRVI+AVLH+GN++F+QER+SDQA LPD++VAQK  HLLG+P+ +MTKA LKP++K+G+++V+KAQTK Q EF+VEAISKS YER+F WLV RIN+++DR  R   +F+GILDIAGFEIF++NSFEQLCINYTNEKLQQLFNHTMFVLEQ+EY +E I W+FIDFGLDLQPTI+LIEKP+GIL+LLDEECFFPKAT K+FVEKL+K Q  HPK+   DFR+ ADFGV+HYAG+VDYVS  WL KNMDPLN+N+V+L   S++  VQ I+KDAE II +S T A ++AFG A+  RKGM RTVGQLYKESL +LM VL NT+P+FVRCIIPNHEK+ G+ID  LV+DQLKCNGVLEGIRICRQGFP+R+LFQEF+QRY ILTPN+I KGFMDGR A   ML  L+++A  YRIG SKIFFKAGVLA+LEEDRDI LT++I++FQ+ ARGYLAR+  + R Q+  AI +IQRNC AYLKLRNW WW+LFT+V+PLL+VTRQEEVVA KE+EL+K +E LEK+T D    +++YE L +EK ++Q +LE+E  + Q+++ ER  L++R++++E +  E E++ +E K K    ++E  +L+ +++ LS  LE+EEQ  QK Q +K S ++R+ ++  +   LEDK NKL K+KK L +R+AD+ S LAEEEE+SKQL KLK++HE+SI +LEERL+REQ +RQDL+++KRRLE E +E+SD    Q    EE+   + + E ++ Q Q++LDEE  AK++A ++IR+ E++I E+KEDLE+E++++++AE+AKRDL EE+E++++EL+D+G+ +  Q   L K E E+ N ++  + ++   E  + E+RK  AV+++ +  Q+E A K+K  +EK K Q    + +   ++ +L+  K+D +K ++  E QL+E+  RL + E  + D +++L K   LAD  A N  LEE+E+KL+++ +SE +  ++L +++   ++ET+ KL+ Q+ +RQLE +    KD LE E+Q K  LE HV  LQ QMQD KKKVEED   + + +++RKK++RE +    R EE + Q E+ EK+++ +Q EL+DA HA+ SQ++DQ  ++R++KK+E+   E T  LN +  AEK+  ++E R+++T+++  + E     ++L E E  + +L R+L +L S++DD GK++  L++A  QL+  L   +  +EELE+E +T+ M K+R E+QL A K QL+R+LAS+DE+ +EQ R   K+LRD EA LE+E+K + + + ++KK+E++  +   +L  + + K+E  +Q+KK+Q    ++QR+M+E + +++  L+ ++++EK+ RT+E+  N   EDL  SER  R I SE DEALEE+A+ T  ++ A+ +KKR+E+ I +     EE Q  +   E++ K+ ++QLEQ+Q +L+ ER N  R ++Q+ + E+  KEL D++ E E ++G++ KA +A  +++I + D QL+ +  E   A   + +   K  + MAL  +E KR+   + +  EKA    K+ +R ++  +E N+ L TQ RRLQRDLEE  E +   +++++ L+
Sbjct:   10 DPQNVELLRVGKGPLEDTAAQSDWASKKLVWVPDEHQGFVMATLLDTVGEECKVQIVDSGKKCSFHHDLVQRMNPPKFEKAEDMANLTFLNEASVLHNLKSRYYSGMIYTYSGLFCVVINPYKRLPIYNDEIIEWYKGKRRHERPPHIYAIADAAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVATSAKTQKTTTANVISKLHSQDINIGELEAQLLKANPILEAFGNAKTIKNDNSSRFGKFIRINFDTSGFIAGANIETYLLEKARVIRQAPDERCFHIFYQLLATATSEMKEKLLLDQAAAYRFLSNGMLEIPGSDEHQAYRETSEAMDIMGITKEDQMAIFRVISAVLHLGNLDFRQERNSDQATLPDHSVAQKACHLLGIPLVDMTKAFLKPRIKVGKDLVSKAQTKAQVEFAVEAISKSIYERLFLWLVDRINKTLDRTKRPGASFVGILDIAGFEIFQVNSFEQLCINYTNEKLQQLFNHTMFVLEQDEYSREGIPWDFIDFGLDLQPTIDLIEKPLGILALLDEECFFPKATDKSFVEKLLKTQEAHPKICKPDFRSSADFGVLHYAGRVDYVSAQWLTKNMDPLNDNIVALFLASSDPLVQDIYKDAE-IISMSATAANDTAFGTARGVRKGMLRTVGQLYKESLVRLMAVLKNTSPSFVRCIIPNHEKRPGRIDPPLVLDQLKCNGVLEGIRICRQGFPSRVLFQEFRQRYEILTPNIIPKGFMDGRNAVMKMLEALELNAGLYRIGHSKIFFKAGVLAQLEEDRDIHLTDVIIRFQARARGYLARRARELRIQHQQAITVIQRNCVAYLKLRNWPWWRLFTKVRPLLTVTRQEEVVAAKEDELRKVREALEKITNDLAELQRSYEKLTKEKTQLQAELEQEHESNQNIQAERLRLLERIQNLEDEFLEMENKGVEEKVKLQNADLEIKRLKEQVADLSDQLEAEEQQRQKLQVEKGSIEQRMTQVNTENVNLEDKYNKLVKDKKVLTDRVADLSSQLAEEEERSKQLLKLKAKHESSIQDLEERLAREQKSRQDLDRSKRRLEAEAAERSDLTVEQQRNLEELNALVSKLEAELSQQQSRLDEEIVAKTIAAKKIREDESLIQELKEDLESERKARDKAEEAKRDLTEEVEAMRLELIDSGSNTVAQTEALHKYEAEVSNLRRQLDAQSSAHEAAIMELRKNHAVSLDAVTEQLEQAKKAKAALEKTKSQQDASIEELQKQVQSLQMGKSDLDKRRRQGEQQLNEVQIRLQDLEIQRNDFDNRLTKA--LADLEAANSTLEELEAKLTRVARSESAAVAELNEVRVRLDDETKAKLSLQSQVRQLEDEREGAKDALEAEEQVKAALEKHVHTLQQQMQDAKKKVEEDVHHMEQLEDARKKLIRELDASNNRNEELVAQVEKLEKSRKKLQGELEDANHAMASQRSDQANNERRVKKLEAANAELTAQLN-QLQAEKEAFDREMRDRDTRLLMHRNENEDLKERLEEAERQRGMLARELEDLGSNRDDAGKSMIELQQANYQLDQQLREARQQLEELEDEVSTVIMEKQRTEVQLNALKTQLERDLASRDELLEEQRRQTLKQLRDLEAELEDERKQRGSHLEVRKKLESDLSEATQRLELASRQKDEALKQLKKFQSVGGSMQRDMEEAIRSRDQALESLRDIEKKWRTAEAERNHFQEDLQASERTCRAIRSELDEALEELASTTSTKNAAVEEKKRLEARIVSFEDQLEEAQNGMDAAEERFKRSLAQLEQLQTDLSTERNNAMRADSQRLSLEKQVKELRDRLAEAEKDSGRRSKAQIATLEARIAAFDEQLETEKSE-KMAATKSCRRLEKRIKEMALQIEEEKRSSQLSKDSYEKAQNSLKRIKREIETLEEENAQLKTQRRRLQRDLEEAAEARRIAERDLQNLR 1934          
BLAST of Myosin heavy chain vs. TrEMBL
Match: A0A4S2LML1 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006176 PE=3 SV=1)

HSP 1 Score: 1937.54 bits (5018), Expect = 0.000e+0
Identity = 1003/1930 (51.97%), Postives = 1437/1930 (74.46%), Query Frame = 1
Query:   82 DAKDLQYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPMGILSLLDEECFFPKATTKTFVEKLIKNQSTHPKLKATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKKQTELADKLAMN--LEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNE-TLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADN-AIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILK 5853
            D ++++ L+V K  + D+A  SDWA+KKLVW+PD+++GF+  +L++  G+E  V++ ++GK      + VQ++NPPKF K+EDMA+LT+LNEASVL+NLK RY+S +IYTYSGLFCVV+NPYKRLPIY + +IEWYKG++RHERPPHIYA+ D AYRNMLQD+E+QSILCTGESGAGKTENTKKVIQYLASVATS K QKTT +N +S+ ++ D+NIGELE QLL+ANP+LEAFGNAKTIKNDNSSRFGKFIRINFDTSGFI+ ANIETYLLEKARVIRQA +ERCFH+FYQLL  A   +K++L+L+  + Y+ LSNGM+ +P  DE Q +++T EA+DIMGI+K++Q +IFRVI+AVLH+GN++F+QER+SDQA LPD++VAQK  HLLG+P+ +MTKA LKP++K+G+++V+KAQTK Q EF+VEAISKS YER+F WLV RIN+++DR  R   +F+GILDIAGFEIF++NSFEQLCINYTNEKLQQLFNHTMFVLEQ+EY +E I W+FIDFGLDLQPTI+LIEKP+GIL+LLDEECFFPKAT K+FVEKL+K Q  HPK+   DFR+ ADFGV+HYAG+VDYVS  WL KNMDPLN+N+V+L   S++  VQ I+KDAE II +S T A ++AFG A+  RKGM RTVGQLYKESL +LM VL NT+P+FVRCIIPNHEK+ G+ID  LV+DQLKCNGVLEGIRICRQGFP+R+LFQEF+QRY ILTPN+I KGFMDGR A   ML  L+++A  YRIG SKIFFKAGVLA+LEEDRDI LT++I++FQ+ ARGYLAR+  + R Q+  AI +IQRNC AYLKLRNW WW+LFT+V+PLL+VTRQEEVVA KE+EL+K +E LEK+T D    +++YE L +EK ++Q +LE+E  + Q+++ ER  L++R++++E +  E E++ +E K K    ++E  +L+ +++ LS  LE+EEQ  QK Q +K S ++R+ ++  +   LEDK NKL K+KK L +R+AD+ S LAEEEE+SKQL KLK++HE+SI +LEERL+REQ +RQDL+++KRRLE E +E+SD    Q    EE+   + + E ++ Q Q++LDEE  AK++A ++IR+ E++I E+KEDLE+E++++++AE+AKRDL EE+E++++EL+D+G+ +  Q   L K E E+ N ++  + ++   E  + E+RK  AV+++ +  Q+E A K+K  +EK K Q    + +   ++ +L+  K+D +K ++  E QL+E+  RL + E  + D +++L K   LAD  A N  LEE+E+KL+++ +SE +  ++L +++   ++ET+ KL+ Q+ +RQLE +    KD LE E+Q K  LE HV  LQ QMQD KKKVEED   + + +++RKK++RE +    R EE + Q E+ EK+++ +Q EL+DA HA+ SQ++DQ  ++R++KK+E+   E T  LN +  AEK+  ++E R+++T+++  + E     ++L E E  + +L R+L +L S++DD GK++  L++A  QL+  L   +  +EELE+E +T+ M K+R E+QL A K QL+R+LAS+DE+ +EQ R   K+LRD EA LE+E+K + + + ++KK+E++  +   +L  + + K+E  +Q+KK+Q    ++QR+M+E + +++  L+ ++++EK+ RT+E+  N   EDL  SER  R I SE DEALEE+A+ T  ++ A+ +KKR+E+ I +     EE Q  +   E++ K+ ++QLEQ+Q +L+ ER N  R ++Q+ + E+  KEL D++ E E ++G++ KA +A  +++I + D QL+ +  E   A   + +   K  + MAL  +E KR+   + +  EKA    K+ +R ++  +E N+ L TQ RRLQRDLEE  E +   +++++ L+
Sbjct:   10 DPQNVELLRVGKGPLEDTAAQSDWASKKLVWVPDEHQGFVMATLLDTVGEECKVQIVDSGKKCSFHHDLVQRMNPPKFEKAEDMANLTFLNEASVLHNLKSRYYSGMIYTYSGLFCVVINPYKRLPIYNDEIIEWYKGKRRHERPPHIYAIADAAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVATSAKTQKTTTANVISKLHSQDINIGELEAQLLKANPILEAFGNAKTIKNDNSSRFGKFIRINFDTSGFIAGANIETYLLEKARVIRQAPDERCFHIFYQLLATATSEMKEKLLLDQAAAYRFLSNGMLEIPGSDEHQAYRETSEAMDIMGITKEDQMAIFRVISAVLHLGNLDFRQERNSDQATLPDHSVAQKACHLLGIPLVDMTKAFLKPRIKVGKDLVSKAQTKAQVEFAVEAISKSIYERLFLWLVDRINKTLDRTKRPGASFVGILDIAGFEIFQVNSFEQLCINYTNEKLQQLFNHTMFVLEQDEYSREGIPWDFIDFGLDLQPTIDLIEKPLGILALLDEECFFPKATDKSFVEKLLKTQEAHPKICKPDFRSSADFGVLHYAGRVDYVSAQWLTKNMDPLNDNIVALFLASSDPLVQDIYKDAE-IISMSATAANDTAFGTARGVRKGMLRTVGQLYKESLVRLMAVLKNTSPSFVRCIIPNHEKRPGRIDPPLVLDQLKCNGVLEGIRICRQGFPSRVLFQEFRQRYEILTPNIIPKGFMDGRNAVMKMLEALELNAGLYRIGHSKIFFKAGVLAQLEEDRDIHLTDVIIRFQARARGYLARRARELRIQHQQAITVIQRNCVAYLKLRNWPWWRLFTKVRPLLTVTRQEEVVAAKEDELRKVREALEKITNDLAELQRSYEKLTKEKTQLQAELEQEHESNQNIQAERLRLLERIQNLEDEFLEMENKGVEEKVKLQNADLEIKRLKEQVADLSDQLEAEEQQRQKLQVEKGSIEQRMTQVNTENVNLEDKYNKLVKDKKVLTDRVADLSSQLAEEEERSKQLLKLKAKHESSIQDLEERLAREQKSRQDLDRSKRRLEAEAAERSDLTVEQQRNLEELNALVSKLEAELSQQQSRLDEEIVAKTIAAKKIREDESLIQELKEDLESERKARDKAEEAKRDLTEEVEAMRLELIDSGSNTVAQTEALHKYEAEVSNLRRQLDAQSSAHEAAIMELRKNHAVSLDAVTEQLEQAKKAKAALEKTKSQQDASIEELQKQVQSLQMGKSDLDKRRRQGEQQLNEVQIRLQDLEIQRNDFDNRLTKA--LADLEAANSTLEELEAKLTRVARSESAAVAELNEVRVRLDDETKAKLSLQSQVRQLEDEREGAKDALEAEEQVKAALEKHVHTLQQQMQDAKKKVEEDVHHMEQLEDARKKLIRELDASNNRNEELVAQVEKLEKSRKKLQGELEDANHAMASQRSDQANNERRVKKLEAANAELTAQLN-QLQAEKEAFDREMRDRDTRLLMHRNENEDLKERLEEAERQRGMLARELEDLGSNRDDAGKSMIELQQANYQLDQQLREARQQLEELEDEVSTVIMEKQRTEVQLNALKTQLERDLASRDELLEEQRRQTLKQLRDLEAELEDERKQRGSHLEVRKKLESDLSEATQRLELASRQKDEALKQLKKFQSVGGSMQRDMEEAIRSRDQALESLRDIEKKWRTAEAERNHFQEDLQASERTCRAIRSELDEALEELASTTSTKNAAVEEKKRLEARIVSFEDQLEEAQNGMDAAEERFKRSLAQLEQLQTDLSTERNNAMRADSQRLSLEKQVKELRDRLAEAEKDSGRRSKAQIATLEARIAAFDEQLETEKSE-KMAATKSCRRLEKRIKEMALQIEEEKRSSQLSKDSYEKAQNSLKRIKREIETLEEENAQLKTQRRRLQRDLEEAAEARRIAERDLQNLR 1934          
BLAST of Myosin heavy chain vs. Ensembl Cavefish
Match: myh11a (myosin-11-like [Source:NCBI gene;Acc:103025732])

HSP 1 Score: 1650.95 bits (4274), Expect = 0.000e+0
Identity = 929/1935 (48.01%), Postives = 1340/1935 (69.25%), Query Frame = 1
Query:   85 AKDLQYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEK---PMGILSLLDEECFFPKATTKTFVEKLIKNQSTHPKL-KATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGL-STTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKIDR 5868
            ++D ++L  DK   +     +DWA KKLVWIP +  GF S S+ EEKGDE  V+L +NGK + +  +++QK+NPPKF K EDMA+LT LNEASVL+NL++RYFS LIYTYSGLFCVVVNPYK LPIY+  +I+ YKG+KRHE PPHIY++TD AYRNM+QD+E+QSILCTGESGAGKTENTKKVIQYLA VA+S K +K T++    Q  A+    GELE QLLQANP+LEAFGNAKTIKNDNSSRFGKFIRINFD +G+I  ANIETYLLEK+R IRQA  ER FH+FY ++ GA D+L++EL+LE+ + Y+ L  G + +P   + +M+++T+EA++IMG+S +E+  I +V++ VL +GNIEFK+ER+ +QA +PDNT AQKV HL G+ VT+ T+A+L P++K+GREVV KAQTKEQA+F++EA++K+TYER+FRW++ R+N+++D+  RQ  +F+GILDIAGFEIFE NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W FIDFGLDLQP IELIE+   P GIL+LLDEEC+FPKAT  +FVEKL      H K  K    + K +F V+HYAG+VDY +  WL KNMDPLN+NV +LL  S+  FVQ +WKD + ++GL       +S+   +  T+KGMFRTVGQLYKESL KLM  L+NT PNFVRCIIPNHEK++GK+D+ LV++QL+CNGVLEGIRICRQGFPNRI+FQEF+QRY IL  + I KGFMDG++A  LM+  LD+D + YRIGQSKIFF+ GVLA+LEE+RD+K+T II+ FQ+ ARG+LARK    R Q L A+++IQRNC AYLKLRNW WW+LFT+VKPLL VTRQEE ++LKE+EL K+KE+  K   + +     +  ++EE+N +QE L+ E     + E  R  L  + +++E    E E+R  E +D+   ++++K K+Q +I +L ++LE EE   QK Q +K++ + +IK+LE  +  +ED+ NKL KE+K LEER+AD  + LAEEEEKSK LTKLK++HE+ I+ELE RL +E+  RQ+L+K KR+LE E ++  + ++       E++  L + E ++    A+L++E   K+ A ++IR+ E VI++++EDLE+E+ ++ +AEK KRDL EE+E+LK EL DT +T+  QQ +  K+E E+   K++ E+E++  E ++QE+R+K    +E L  Q+E + + K  +EKAK  L++E ++   E+ +L  +K D E  +K  E QL+++  R ++SE+ K +   ++ K T   + +   L E E K  +L K   S+ SQ+ D Q+   EETR KL   T LRQ+E +   L++QLEEE ++K N+E HV  L  Q+ D KKK+EE A  +   +E +K++ R+ E    + EE     ++ EK K  +Q EL+D    L++Q+   +  ++K KK +  + E  +++ KY  E+D  E E REKETK + L R +    D   ELE A   L  ++ +LVSSKDDVGKNV  LEK+K  LE  +E  K  +EELE+E    +  K R+E+ + A KAQ +R+L  +DE  +E+ + + K++R+ E  LE+E+K + A+ + KKK+E +  DL  Q+  + K ++E  +Q++K Q    + QRE+ E   A+ + +   KE E++ +  E+ + QL EDL+ +ERAK+   +ERDE  +E+A+    +     +K+R+E+ IS L  + EE Q  +  L D+ +K   Q++Q+ NEL  ER    + E+ +   ER NK+L  K++E+E +   K+K+++ A ++K+  L+ QL+ +  +   + +  ++ E+KLK+++  + DE K+A+   +Q +KA  R K+ +R L+  +E +  ++   R+LQR+L+E  E  +A  +E+  LK+K+ R
Sbjct:    7 SEDEKFLYTDKDFFNSPVAQADWALKKLVWIPSEKHGFESASVKEEKGDEVLVELVDNGKKVTVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLRERYFSGLIYTYSGLFCVVVNPYKMLPIYSEKIIDMYKGKKRHEVPPHIYSITDNAYRNMMQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKKDTSAQHSGQQLAY----GELEKQLLQANPILEAFGNAKTIKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRCIRQAKTERAFHIFYYMVAGAKDKLREELLLESFNNYRFLMAGHVQIPGNQDDEMYEETMEAMNIMGLSDEERIGILKVVSTVLQLGNIEFKKERNQEQATMPDNTAAQKVCHLSGINVTDFTRAILTPRIKVGREVVQKAQTKEQADFAIEALAKATYERLFRWILGRVNKALDKTKRQGASFLGILDIAGFEIFEDNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPNNPPGILALLDEECWFPKATDISFVEKLTNTHVNHIKFAKPKQLKDKTEFSVLHYAGRVDYNAVAWLTKNMDPLNDNVTALLNNSSSLFVQDLWKDVDRVVGLEQIAKMSDSSMPSSSKTKKGMFRTVGQLYKESLAKLMTTLHNTQPNFVRCIIPNHEKRAGKLDAHLVLEQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILAASSIPKGFMDGKQACILMIKHLDLDPNLYRIGQSKIFFRTGVLAQLEEERDLKITVIIIAFQAQARGFLARKAFAKRQQQLTAMRVIQRNCAAYLKLRNWQWWRLFTKVKPLLQVTRQEEELSLKEDELNKAKESAIKFETELKDITLKHTQMVEERNALQEQLQAETELYAEAEEMRVRLAAKKQELEEILHEMEARLEEEEDRSAAMQVDKKKMQQQIQELEEHLEEEEDARQKLQLEKVTCEGKIKKLEDDILVMEDQNNKLLKERKLLEERVADYSANLAEEEEKSKNLTKLKNKHESMISELEVRLKKEEKTRQELDKAKRKLEAESNDLQEQIADLQAQIAELKAQLAKKEEELQAALARLEDEMAQKNNALKKIRELEGVISDLQEDLESERAARNKAEKTKRDLGEELEALKSELEDTLDTTATQQELRAKREQEVTLLKRAMEEESRTHEAQVQEMRQKHTQAVEELTEQLEQSKRVKTNLEKAKQALEKETSELTVEIRSLTQAKQDVEHKRKKVEGQLTDLQARFNDSEKQKAELGDRVSKITVELESVTNLLNEAEGKNIKLNKDVASLTSQVQDTQELLAEETRQKLQFSTKLRQMEDERNSLQEQLEEEAEAKRNVERHVSTLNIQLSDFKKKLEEMAGNVELLEEGKKRLQRDLEASNTQFEEKAAAYDKLEKTKNRLQQELEDILMDLDNQRQLVSNLEKKQKKFDQMLAEEKSISAKYADERDRAEAEAREKETKALSLARALEEAQDSREELERANKALRAEMEDLVSSKDDVGKNVHELEKSKRGLEAQVEEMKTQLEELEDELQAAEDAKLRLEVNMQALKAQFERDLLGRDEQGEEKRKQLFKQVRELETELEDERKQRAALAASKKKMEGDMKDLEGQIDTANKGRDEAIKQLRKLQAQMKDFQRELDEARTAREEVMSTAKENERKAKNLEAELMQLQEDLAAAERAKKQAEAERDELADELASNASGKSALSDEKRRLEAKISQLEEELEEEQGNMEVLNDRLRKSAQQVDQLTNELQAERSTSQKNESARQQLERQNKDLKSKLQEMENQVKSKFKSSITALEAKVAQLEEQLEQENRDKQASAKTMRQKEKKLKDLIIQVEDERKQAEQYKDQADKANARVKQLKRQLEESEEESQRITAARRKLQRELDEATEANDAMSREVNSLKSKLRR 1937          
BLAST of Myosin heavy chain vs. Ensembl Cavefish
Match: myh11a (myosin-11-like [Source:NCBI gene;Acc:103025732])

HSP 1 Score: 1649.41 bits (4270), Expect = 0.000e+0
Identity = 928/1933 (48.01%), Postives = 1339/1933 (69.27%), Query Frame = 1
Query:   85 AKDLQYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEK---PMGILSLLDEECFFPKATTKTFVEKLIKNQSTHPKL-KATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGL-STTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKI 5862
            ++D ++L  DK   +     +DWA KKLVWIP +  GF S S+ EEKGDE  V+L +NGK + +  +++QK+NPPKF K EDMA+LT LNEASVL+NL++RYFS LIYTYSGLFCVVVNPYK LPIY+  +I+ YKG+KRHE PPHIY++TD AYRNM+QD+E+QSILCTGESGAGKTENTKKVIQYLA VA+S K +K T++    Q  A+    GELE QLLQANP+LEAFGNAKTIKNDNSSRFGKFIRINFD +G+I  ANIETYLLEK+R IRQA  ER FH+FY ++ GA D+L++EL+LE+ + Y+ L  G + +P   + +M+++T+EA++IMG+S +E+  I +V++ VL +GNIEFK+ER+ +QA +PDNT AQKV HL G+ VT+ T+A+L P++K+GREVV KAQTKEQA+F++EA++K+TYER+FRW++ R+N+++D+  RQ  +F+GILDIAGFEIFE NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W FIDFGLDLQP IELIE+   P GIL+LLDEEC+FPKAT  +FVEKL      H K  K    + K +F V+HYAG+VDY +  WL KNMDPLN+NV +LL  S+  FVQ +WKD + ++GL       +S+   +  T+KGMFRTVGQLYKESL KLM  L+NT PNFVRCIIPNHEK++GK+D+ LV++QL+CNGVLEGIRICRQGFPNRI+FQEF+QRY IL  + I KGFMDG++A  LM+  LD+D + YRIGQSKIFF+ GVLA+LEE+RD+K+T II+ FQ+ ARG+LARK    R Q L A+++IQRNC AYLKLRNW WW+LFT+VKPLL VTRQEE ++LKE+EL K+KE+  K   + +     +  ++EE+N +QE L+ E     + E  R  L  + +++E    E E+R  E +D+   ++++K K+Q +I +L ++LE EE   QK Q +K++ + +IK+LE  +  +ED+ NKL KE+K LEER+AD  + LAEEEEKSK LTKLK++HE+ I+ELE RL +E+  RQ+L+K KR+LE E ++  + ++       E++  L + E ++    A+L++E   K+ A ++IR+ E VI++++EDLE+E+ ++ +AEK KRDL EE+E+LK EL DT +T+  QQ +  K+E E+   K++ E+E++  E ++QE+R+K    +E L  Q+E + + K  +EKAK  L++E ++   E+ +L  +K D E  +K  E QL+++  R ++SE+ K +   ++ K T   + +   L E E K  +L K   S+ SQ+ D Q+   EETR KL   T LRQ+E +   L++QLEEE ++K N+E HV  L  Q+ D KKK+EE A  +   +E +K++ R+ E    + EE     ++ EK K  +Q EL+D    L++Q+   +  ++K KK +  + E  +++ KY  E+D  E E REKETK + L R +    D   ELE A   L  ++ +LVSSKDDVGKNV  LEK+K  LE  +E  K  +EELE+E    +  K R+E+ + A KAQ +R+L  +DE  +E+ + + K++R+ E  LE+E+K + A+ + KKK+E +  DL  Q+  + K ++E  +Q++K Q    + QRE+ E   A+ + +   KE E++ +  E+ + QL EDL+ +ERAK+   +ERDE  +E+A+    +     +K+R+E+ IS L  + EE Q  +  L D+ +K   Q++Q+ NEL  ER    + E+ +   ER NK+L  K++E+E +   K+K+++ A ++K+  L+ QL+ +  +   + +  ++ E+KLK+++  + DE K+A+   +Q +KA  R K+ +R L+  +E +  ++   R+LQR+L+E  E  +A  +E+  LK+K+
Sbjct:    7 SEDEKFLYTDKDFFNSPVAQADWALKKLVWIPSEKHGFESASVKEEKGDEVLVELVDNGKKVTVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLRERYFSGLIYTYSGLFCVVVNPYKMLPIYSEKIIDMYKGKKRHEVPPHIYSITDNAYRNMMQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKKDTSAQHSGQQLAY----GELEKQLLQANPILEAFGNAKTIKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRCIRQAKTERAFHIFYYMVAGAKDKLREELLLESFNNYRFLMAGHVQIPGNQDDEMYEETMEAMNIMGLSDEERIGILKVVSTVLQLGNIEFKKERNQEQATMPDNTAAQKVCHLSGINVTDFTRAILTPRIKVGREVVQKAQTKEQADFAIEALAKATYERLFRWILGRVNKALDKTKRQGASFLGILDIAGFEIFEDNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPNNPPGILALLDEECWFPKATDISFVEKLTNTHVNHIKFAKPKQLKDKTEFSVLHYAGRVDYNAVAWLTKNMDPLNDNVTALLNNSSSLFVQDLWKDVDRVVGLEQIAKMSDSSMPSSSKTKKGMFRTVGQLYKESLAKLMTTLHNTQPNFVRCIIPNHEKRAGKLDAHLVLEQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILAASSIPKGFMDGKQACILMIKHLDLDPNLYRIGQSKIFFRTGVLAQLEEERDLKITVIIIAFQAQARGFLARKAFAKRQQQLTAMRVIQRNCAAYLKLRNWQWWRLFTKVKPLLQVTRQEEELSLKEDELNKAKESAIKFETELKDITLKHTQMVEERNALQEQLQAETELYAEAEEMRVRLAAKKQELEEILHEMEARLEEEEDRSAAMQVDKKKMQQQIQELEEHLEEEEDARQKLQLEKVTCEGKIKKLEDDILVMEDQNNKLLKERKLLEERVADYSANLAEEEEKSKNLTKLKNKHESMISELEVRLKKEEKTRQELDKAKRKLEAESNDLQEQIADLQAQIAELKAQLAKKEEELQAALARLEDEMAQKNNALKKIRELEGVISDLQEDLESERAARNKAEKTKRDLGEELEALKSELEDTLDTTATQQELRAKREQEVTLLKRAMEEESRTHEAQVQEMRQKHTQAVEELTEQLEQSKRVKTNLEKAKQALEKETSELTVEIRSLTQAKQDVEHKRKKVEGQLTDLQARFNDSEKQKAELGDRVSKITVELESVTNLLNEAEGKNIKLNKDVASLTSQVQDTQELLAEETRQKLQFSTKLRQMEDERNSLQEQLEEEAEAKRNVERHVSTLNIQLSDFKKKLEEMAGNVELLEEGKKRLQRDLEASNTQFEEKAAAYDKLEKTKNRLQQELEDILMDLDNQRQLVSNLEKKQKKFDQMLAEEKSISAKYADERDRAEAEAREKETKALSLARALEEAQDSREELERANKALRAEMEDLVSSKDDVGKNVHELEKSKRGLEAQVEEMKTQLEELEDELQAAEDAKLRLEVNMQALKAQFERDLLGRDEQGEEKRKQLFKQVRELETELEDERKQRAALAASKKKMEGDMKDLEGQIDTANKGRDEAIKQLRKLQAQMKDFQRELDEARTAREEVMSTAKENERKAKNLEAELMQLQEDLAAAERAKKQAEAERDELADELASNASGKSALSDEKRRLEAKISQLEEELEEEQGNMEVLNDRLRKSAQQVDQLTNELQAERSTSQKNESARQQLERQNKDLKSKLQEMENQVKSKFKSSITALEAKVAQLEEQLEQENRDKQASAKTMRQKEKKLKDLIIQVEDERKQAEQYKDQADKANARVKQLKRQLEESEEESQRITAARRKLQRELDEATEANDAMSREVNSLKSKL 1935          
BLAST of Myosin heavy chain vs. Ensembl Cavefish
Match: myh11a (myosin-11-like [Source:NCBI gene;Acc:103025732])

HSP 1 Score: 1645.56 bits (4260), Expect = 0.000e+0
Identity = 926/1933 (47.90%), Postives = 1336/1933 (69.12%), Query Frame = 1
Query:   85 AKDLQYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEK---PMGILSLLDEECFFPKATTKTFVEKLIKNQSTHPKL-KATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGL-STTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKI 5862
            ++D ++L  DK   +     +DWA KKLVWIP +  GF S S+ EEKGDE  V+L +NGK + +  +++QK+NPPKF K EDMA+LT LNEASVL+NL++RYFS LIYTYSGLFCVVVNPYK LPIY+  +I+ YKG+KRHE PPHIY++TD AYRNM+QD+E+QSILCTGESGAGKTENTKKVIQYLA VA+S K +K T++             GELE QLLQANP+LEAFGNAKTIKNDNSSRFGKFIRINFD +G+I  ANIETYLLEK+R IRQA  ER FH+FY ++ GA D+L++EL+LE+ + Y+ L  G + +P   + +M+++T+EA++IMG+S +E+  I +V++ VL +GNIEFK+ER+ +QA +PDNT AQKV HL G+ VT+ T+A+L P++K+GREVV KAQTKEQA+F++EA++K+TYER+FRW++ R+N+++D+  RQ  +F+GILDIAGFEIFE NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W FIDFGLDLQP IELIE+   P GIL+LLDEEC+FPKAT  +FVEKL      H K  K    + K +F V+HYAG+VDY +  WL KNMDPLN+NV +LL  S+  FVQ +WKD + ++GL       +S+   +  T+KGMFRTVGQLYKESL KLM  L+NT PNFVRCIIPNHEK++GK+D+ LV++QL+CNGVLEGIRICRQGFPNRI+FQEF+QRY IL  + I KGFMDG++A  LM+  LD+D + YRIGQSKIFF+ GVLA+LEE+RD+K+T II+ FQ+ ARG+LARK    R Q L A+++IQRNC AYLKLRNW WW+LFT+VKPLL VTRQEE ++LKE+EL K+KE+  K   + +     +  ++EE+N +QE L+ E     + E  R  L  + +++E    E E+R  E +D+   ++++K K+Q +I +L ++LE EE   QK Q +K++ + +IK+LE  +  +ED+ NKL KE+K LEER+AD  + LAEEEEKSK LTKLK++HE+ I+ELE RL +E+  RQ+L+K KR+LE E ++  + ++       E++  L + E ++    A+L++E   K+ A ++IR+ E VI++++EDLE+E+ ++ +AEK KRDL EE+E+LK EL DT +T+  QQ +  K+E E+   K++ E+E++  E ++QE+R+K    +E L  Q+E + + K  +EKAK  L++E ++   E+ +L  +K D E  +K  E QL+++  R ++SE+ K +   ++ K T   + +   L E E K  +L K   S+ SQ+ D Q+   EETR KL   T LRQ+E +   L++QLEEE ++K N+E HV  L  Q+ D KKK+EE A  +   +E +K++ R+ E    + EE     ++ EK K  +Q EL+D    L++Q+   +  ++K KK +  + E  +++ KY  E+D  E E REKETK + L R +    D   ELE A   L  ++ +LVSSKDDVGKNV  LEK+K  LE  +E  K  +EELE+E    +  K R+E+ + A KAQ +R+L  +DE  +E+ + + K++R+ E  LE+E+K + A+ + KKK+E +  DL  Q+  + K ++E  +Q++K Q    + QRE+ E   A+ + +   KE E++ +  E+ + QL EDL+ +ERAK+   +ERDE  +E+A+    +     +K+R+E+ IS L  + EE Q  +  L D+ +K   Q++Q+ NEL  ER    + E+ +   ER NK+L  K++E+E +   K+K+++ A ++K+  L+ QL+ +  +   + +  ++ E+KLK+++  + DE K+A+   +Q +KA  R K+ +R L+  +E +  ++   R+LQR+L+E  E  +A  +E+  LK+K+
Sbjct:    7 SEDEKFLYTDKDFFNSPVAQADWALKKLVWIPSEKHGFESASVKEEKGDEVLVELVDNGKKVTVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLRERYFSGLIYTYSGLFCVVVNPYKMLPIYSEKIIDMYKGKKRHEVPPHIYSITDNAYRNMMQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKKDTSA-------------GELEKQLLQANPILEAFGNAKTIKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRCIRQAKTERAFHIFYYMVAGAKDKLREELLLESFNNYRFLMAGHVQIPGNQDDEMYEETMEAMNIMGLSDEERIGILKVVSTVLQLGNIEFKKERNQEQATMPDNTAAQKVCHLSGINVTDFTRAILTPRIKVGREVVQKAQTKEQADFAIEALAKATYERLFRWILGRVNKALDKTKRQGASFLGILDIAGFEIFEDNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPNNPPGILALLDEECWFPKATDISFVEKLTNTHVNHIKFAKPKQLKDKTEFSVLHYAGRVDYNAVAWLTKNMDPLNDNVTALLNNSSSLFVQDLWKDVDRVVGLEQIAKMSDSSMPSSSKTKKGMFRTVGQLYKESLAKLMTTLHNTQPNFVRCIIPNHEKRAGKLDAHLVLEQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILAASSIPKGFMDGKQACILMIKHLDLDPNLYRIGQSKIFFRTGVLAQLEEERDLKITVIIIAFQAQARGFLARKAFAKRQQQLTAMRVIQRNCAAYLKLRNWQWWRLFTKVKPLLQVTRQEEELSLKEDELNKAKESAIKFETELKDITLKHTQMVEERNALQEQLQAETELYAEAEEMRVRLAAKKQELEEILHEMEARLEEEEDRSAAMQVDKKKMQQQIQELEEHLEEEEDARQKLQLEKVTCEGKIKKLEDDILVMEDQNNKLLKERKLLEERVADYSANLAEEEEKSKNLTKLKNKHESMISELEVRLKKEEKTRQELDKAKRKLEAESNDLQEQIADLQAQIAELKAQLAKKEEELQAALARLEDEMAQKNNALKKIRELEGVISDLQEDLESERAARNKAEKTKRDLGEELEALKSELEDTLDTTATQQELRAKREQEVTLLKRAMEEESRTHEAQVQEMRQKHTQAVEELTEQLEQSKRVKTNLEKAKQALEKETSELTVEIRSLTQAKQDVEHKRKKVEGQLTDLQARFNDSEKQKAELGDRVSKITVELESVTNLLNEAEGKNIKLNKDVASLTSQVQDTQELLAEETRQKLQFSTKLRQMEDERNSLQEQLEEEAEAKRNVERHVSTLNIQLSDFKKKLEEMAGNVELLEEGKKRLQRDLEASNTQFEEKAAAYDKLEKTKNRLQQELEDILMDLDNQRQLVSNLEKKQKKFDQMLAEEKSISAKYADERDRAEAEAREKETKALSLARALEEAQDSREELERANKALRAEMEDLVSSKDDVGKNVHELEKSKRGLEAQVEEMKTQLEELEDELQAAEDAKLRLEVNMQALKAQFERDLLGRDEQGEEKRKQLFKQVRELETELEDERKQRAALAASKKKMEGDMKDLEGQIDTANKGRDEAIKQLRKLQAQMKDFQRELDEARTAREEVMSTAKENERKAKNLEAELMQLQEDLAAAERAKKQAEAERDELADELASNASGKSALSDEKRRLEAKISQLEEELEEEQGNMEVLNDRLRKSAQQVDQLTNELQAERSTSQKNESARQQLERQNKDLKSKLQEMENQVKSKFKSSITALEAKVAQLEEQLEQENRDKQASAKTMRQKEKKLKDLIIQVEDERKQAEQYKDQADKANARVKQLKRQLEESEEESQRITAARRKLQRELDEATEANDAMSREVNSLKSKL 1926          
BLAST of Myosin heavy chain vs. Ensembl Cavefish
Match: myh11b (myosin, heavy chain 11b, smooth muscle [Source:ZFIN;Acc:ZDB-GENE-101124-2])

HSP 1 Score: 1632.46 bits (4226), Expect = 0.000e+0
Identity = 911/1940 (46.96%), Postives = 1327/1940 (68.40%), Query Frame = 1
Query:   67 KMENIDAKDLQYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKLENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKP---MGILSLLDEECFFPKATTKTFVEKLIKNQSTHPKL-KATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTA---QESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKI 5862
            K EN D+   ++L +D    +     +DW+ KK+VW+P + +GF S S+ EEKGDE  V+L+NG  + +  +N+QK+NPPKF K+EDMA LT LNEASVL+NL++RYFS LIYTYSGLFCVVVNPYK LPIY+  +IE YKG+KRHE PPHIY+VTD AYRNM+Q++E+QSILCTGESGAGKTENTKKVIQYLA VA+S K +K T S+  S      +N GELE QLLQANP+LEAFGNAKTIKNDNSSRFGKFI+INFD +G+I  ANIETYLLEK+R IRQA  ER FH+FY ++ GA D++K EL+LE    Y+ L  G + V    + +MF +T+EA++++G +++E+  + +V + VL +GNIEFK+E++ +QA++PD T AQKV HL G+ +T+ TKA+L P++K+GRE+V KAQTKEQA+F+VEA++K+ Y+R+FRW++ R+N+++D++ RQ  +FIGILDIAGFEIFE NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W FIDFGLDLQP IELIE+P    GIL+LLDEEC+FPKAT  +FV+KL    S+H K  K  + + K  F V HYAGKVDY +  WL KNMDPLN+N+ +LL  S   FVQ +WKDAE ++GL T       +++   +  ++KGMFRTVGQLYKESL KLM  L+NT PNFVRCIIPNHEK++GK+D+ LV++QL+CNGVLEGIRICRQGFPNRI+F EF+QRY IL  + I KGFMDG++A  LM+  LD+D + YRIGQSK+FF+ GVLA+LEE+RD+KLT II+ FQ+  RG+LARK    R Q L A+K+IQRNC AYLKL+NW WW+LFT+VKPLL VTRQEE ++ KEEEL+K+KE  +K   D +   + +  L+EE+N +QE L+ E     + E  R  L  + +++E    + E+R  E +++   L+ EK  +Q ++  +   L   E +  K   +K + D +IK++E +   +ED+ NKL KEK+ LEERLAD+ S LAEEEEKSK LTKLK++HE+ I+ELE R+ +E+  RQD+EK KR+LE E ++  D L++      E++  L   E ++  + A+L++E+  K+ A ++IR+ E +ITE+++DL+AE+  + + EKA+ +L  E+E+L+ EL D+ + +  QQ +  K+E E+   KKS ED  +  E ++Q++R+K    +E L+ Q+E + ++K  +EKAK  L++E    N EL +L SSK + E  +K  E QL+++  R ++ E  + +   K+ K T   D +   L E E K  +L+K   ++ SQL D Q+   EETR KLN  T LRQ++ +   L +QLEEE +++ N+E HV +L +Q+ D KKK++E +  +   +ES+K+V RE E +    EE  +  ++ EK+K  +Q EL+D    L++Q+   +  ++K +K +  + E   ++ KY  E+D  E E REKE++ + L R +        ELE     L  ++ +L+SSKDDVGKNV  LEKAK  LE  ++  +  +EELE+E  + +  K R+E+   A KAQ DREL  +DE  +E+ R + K+LRD EA LE+E+K + ++ + KKK+E +  D+ +Q+    + ++E  +Q++K Q    + QRE+++   A  + L   +E ++R +T E+++  L E+L+ +ERA++   +ERDE  EE++  +  +  +  +K+R+E+ I+ L  + EE Q  +  L ++ ++ I Q++Q+  EL  ER    R E+ +   ER NKEL  K++E E +A  K K ++ + ++K+  ++ QL+ +  E   A +N ++ ++KLK++   M DE K+A+   +Q EKA  R K+ +R  +  +E +   +   R+LQR+L+E +E  +A  +E+  LK+K+
Sbjct:    4 KSENDDSS--KFLFLDNDFKNTGVAQADWSAKKMVWVPSEKDGFQSASIKEEKGDEVVVELDNGSKITVHKDNIQKMNPPKFSKAEDMAALTCLNEASVLHNLRERYFSGLIYTYSGLFCVVVNPYKMLPIYSEKIIEMYKGKKRHEVPPHIYSVTDNAYRNMMQEREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKKDTGSDPASA-----LNKGELEKQLLQANPILEAFGNAKTIKNDNSSRFGKFIKINFDLAGYIVGANIETYLLEKSRCIRQAKIERSFHIFYYMVAGAKDKMKDELLLEGFGGYRFLVAGHVQVQGQQDDEMFDETLEAMEVLGFNEEERLGMMKVCSTVLQLGNIEFKKEKNQEQASMPDTTAAQKVCHLQGINITDFTKAILTPRIKVGREMVQKAQTKEQADFAVEALAKAMYDRLFRWILARVNKALDKSKRQGASFIGILDIAGFEIFEDNSFEQLCINYTNEKLQQLFNHTMFILEQEEYKREGIEWNFIDFGLDLQPCIELIERPNNPPGILALLDEECWFPKATDVSFVDKLTNTHSSHCKFSKPKNLKEKTFFSVQHYAGKVDYNASAWLTKNMDPLNDNITALLNNSTSPFVQDLWKDAERVVGLETMAKMAKSDTSMPSSTKSKKGMFRTVGQLYKESLGKLMTTLHNTQPNFVRCIIPNHEKRAGKLDASLVLEQLRCNGVLEGIRICRQGFPNRIVFHEFRQRYEILAASAIPKGFMDGKQACTLMIKHLDLDPNLYRIGQSKMFFRTGVLAQLEEERDLKLTVIIIAFQAQGRGFLARKAFSKRQQQLTAMKVIQRNCAAYLKLKNWQWWRLFTKVKPLLQVTRQEEEMSHKEEELQKAKEVAQKAETDLKEITQKHSQLVEERNALQEKLQTEAELYAEAEEMRIRLEAKKQELEEVLHDMEARLEEEEERGQALQEEKKNMQKQLQDMEARLAEHEDSRHKLTQEKAATDGKIKKMEDEFLIMEDQNNKLHKEKQMLEERLADLSSNLAEEEEKSKNLTKLKAKHESMISELEVRMKKEEKGRQDVEKAKRKLEAEFNDLQDQLAALQAEIAELKAQLAAREDELQALLARLEQESAQKNNALKKIREMEGLITELQDDLDAERDIRAKTEKARHELGVELEALRTELEDSLDITAAQQELRAKREQEVAMLKKSMEDAGRSHEAQVQDLRQKHTQAVEELSEQLEQSKRAKATLEKAKQTLEKEATALNAELHSLASSKQEVEHKRKKVESQLADVQARYNDGERQRAEMGDKVSKLTMELDSVTALLNEAEGKNIKLSKDVSTLNSQLHDAQELLAEETRQKLNVSTRLRQVDEERNGLLEQLEEESEARRNVERHVSSLNTQLTDAKKKLDEFSSGMELLEESKKRVQRELEAVNSEFEEKASAYDKLEKSKNRLQQELEDVLMDLDNQRQLVSNLEKKQRKFDQLLAEEKAISIKYAEERDRAEAEVREKESRGLALARALEEMQLSREELEKVNKALRTEMEDLISSKDDVGKNVHELEKAKRLLEAHVQEMRTQMEELEDELQSAEDAKLRLEVNTQALKAQFDRELQGRDEQGEEKRRQVLKQLRDMEAELEDERKQRNSLAASKKKLEGDVKDMEDQIDALSRSRDEAVKQLRKTQAQMKDSQRELEDARNAHKEALSSSREADRRAKTMEADIIHLQEELAAAERARKQAETERDELAEELSNNS-GKSLSSEEKRRLEARITHLEEELEEEQGNIESLNERLRRSIQQVDQLNGELQAERAAAQRSESTRQQLERQNKELKTKLQEAEGQAKSKLKTSITSLEAKLHQMEEQLEQESRERQAAVKNLRQKDKKLKDLTIQMEDERKQAEQFKDQAEKANARMKQLKRQAEESEEESQRAAAARRKLQRELDEASEANDALSREVSSLKSKL 1935          
BLAST of Myosin heavy chain vs. Ensembl Cavefish
Match: myh10 (myosin, heavy chain 10, non-muscle [Source:ZFIN;Acc:ZDB-GENE-030616-162])

HSP 1 Score: 1632.08 bits (4225), Expect = 0.000e+0
Identity = 909/1932 (47.05%), Postives = 1300/1932 (67.29%), Query Frame = 1
Query:   97 QYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNI-GELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPM---GILSLLDEECFFPKATTKTFVEKLIKNQSTHPKL-KATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQ-ESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKIDR 5868
            +YL VD+++V + A  +DW  KKLVW+P +  GF + S+ EE+GDE  V+L ENGK   +  +++QK+NPPKF K EDMA+LT LNEASVL+NLKDRY+S LIYTYSGLFCVV+NPYK LPIY+ N+IE Y+G+KRHE PPHIYA+++ AYR MLQD+E+QSILCTGESGAGKTENTKKVIQYLA VA+S K +K             D NI GELE QLLQANP+LE+FGNAKT+KNDNSSRFGKFIRINFD +G+I  ANIETYLLEK+R IRQA +ER FH+FYQLL GA + L+ +L+LE  + Y+ LSNG I +P   +K  F++T+EA+ IM  S DE  S+ +V++AV+  GNI FK+ER++DQA++P+NT AQK+ HLLG+ V E T+A+L P++K+GR+ V KAQTKEQA+F+VEA++K+TYER+FRWLV RIN+++DR  RQ  +FIGILDIAGFEIF++NSFEQLCINYTNEKLQQLFNHTMFVLEQEEY++E I+W FIDFGLDLQP I+LIE+P    G+L+LLDEEC+FPKAT KTFV+KL++ Q +H K  K    + KADF +IHYAG+VDY +D WL+KNMDPLN+NV +LL +S + FV  +WKD + I+GL       E+AFG    T+KGMFRTVGQLYKESLTKLM  L NTNPNFVRCIIPNHEK++GK++  LV+DQL+CNGVLEGIRICRQGFPNRI+FQEF+QRY ILTPN I KGFMDG++A E M+  L++D + YRIGQSKIFF+ GVLA LEE+RD+K+T+II+ FQ+  RGYLARK    + Q L+A+K++QRNC AYLKLR+W WW+LFT+VKPLL VTRQEE +  K+EEL K KE   K+  +    ++ ++ L+EEKN + E L+ E     + E  R  L+ + +++E    + ESR  E +++   L+ EK K+Q+ I  L + L+ EE   QK Q +K++A+ +IK++E+ +  LED+ +K  KEKK LEER++++ S LAEEEEK+K L K+K++ E  + +LEERL +E+  RQ+LEK KR+L+ E ++  + ++      +E++I L + E ++  + A+ DEE   K+ A +Q+R+ +  + E++EDLE+EK ++ +AEK KRDL+EE+E+LK EL DT +T+  QQ +  K+E E+   KK+ ++ET+  E ++QE+R++    +E L+ Q+E A + K  +EK+K  L+ +  +   E+  L+ SK DSE  +K  E QL E+  R++E E  K           ELAD L+  L  + S+          V  QL +++K  E+++ +    +   R+L+        +LEE+  + + LE     LQ ++ D+          +++ D  R+ V                                              +  ++K KK +  + E  +++ +Y  E+D  E E REKETK + + R ++   +   E E     L  ++ +L+SSKDDVGKNV  LEK+K  LE  +E  +  +EELE+E    +  K R+E+ + A KAQ +R+L ++DE +DE+ R++ K++R+ EA LE+E+K +   V+ KKK+E +  D+  Q+  + K ++E  +Q++K Q    + QRE++E  +++++   Q KE EK+L++ E+ + QL EDL+ SERA+R    ERDE  +EI+     +   + +K+R+E+ I+ L  + EE Q  +  L D+ +K   Q++ +  EL  ER    + EN +   ER NK+L  K++ELE     K+KAT++A ++KI  L+ QL+ + +E   AN+  ++ E+KLKE+   + DE + AD   EQ+EKA  R K+ +R L+  +E  +  +   R+LQR+L++  E  E   +E+  LK ++ R
Sbjct:   12 RYLFVDRAVVYNPATQADWTAKKLVWVPSERHGFEAASIREERGDEVVVELAENGKKAMVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKGRK-------------DHNIPGELEKQLLQANPILESFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQAKDERTFHIFYQLLAGAGEHLRSDLLLEGFNNYRFLSNGNIPIPGQQDKDNFQETMEAMHIMSFSHDEILSMLKVVSAVMQFGNIIFKKERNTDQASMPENTAAQKLCHLLGMSVMEFTRAILTPRIKVGRDYVQKAQTKEQADFAVEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFQLNSFEQLCINYTNEKLQQLFNHTMFVLEQEEYQREGIEWSFIDFGLDLQPCIDLIERPANPPGVLALLDEECWFPKATDKTFVDKLVQEQGSHGKFQKPRQLKDKADFCIIHYAGRVDYKADEWLMKNMDPLNDNVATLLHQSTDKFVAELWKDVDRIVGLDQVAGMNETAFGATYKTKKGMFRTVGQLYKESLTKLMATLRNTNPNFVRCIIPNHEKRAGKLEPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERMIQALELDPNLYRIGQSKIFFRTGVLAHLEEERDLKITDIIIYFQAVCRGYLARKAFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRLFTKVKPLLQVTRQEEEMQAKDEELVKVKERQVKVENELVEMERKHQQLVEEKNILAEQLQAETELFAEAEEMRARLVAKKQELEEILHDLESRVEEEEERNQSLQNEKKKMQSHIQDLEEQLDEEEAARQKLQLEKVTAEAKIKKMEEDLLLLEDQNSKFLKEKKLLEERVSEMTSMLAEEEEKAKNLGKVKNKQEMMMVDLEERLKKEEKTRQELEKAKRKLDAETTDLQEQIAELQAQIDELKIQLAKKEEELQAVLARGDEEVAQKNNALKQVREMQAQLAELQEDLESEKAARNKAEKLKRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKAIDEETRNHESQIQEMRQRHGTALEELSEQLEQAKRFKANLEKSKQTLEGDNKELVTEVKALQQSKLDSEHKRKKLEAQLQEVLARVTEGERTK----------GELADMLSCILHLMSSR----------VFLQLCEMKKKLEDDSGVVEGLEEVKRKLQKDVEATNQRLEEKAMAFDKLEKTKTRLQQELDDL----------MVDLDHQRQIV----------------------------------------------SNLEKKQKKFDQMLAEEKSVSARYAEERDRAEAEAREKETKALSMARALDEALEAKEEFERLNKQLRAEMEDLMSSKDDVGKNVHELEKSKRTLEQQVEEMRTQLEELEDELQATEDAKLRLEVNMQAMKAQFERDLQARDEQNDEKKRLLVKQVREMEAELEDERKQRALAVAAKKKLEMDLKDVEAQIEAANKARDEAIKQLRKLQAQMKDYQRELEEARSSRDEIFAQSKENEKKLKSLEAEILQLQEDLAASERARRHAEQERDELADEISNSASGKSALLDEKRRLEARIAQLEEELEEEQSNMELLNDRFRKTSMQVDTLTTELAGERSTAQKSENARQQLERQNKDLKAKLQELEGSVKSKFKATISALEAKILQLEEQLEQEAKERAAANKIVRRTEKKLKEVFMQVEDERRHADQYKEQMEKANSRMKQLKRQLEEAEEEATRANASRRKLQRELDDATEASEGLSREVNALKNRLRR 1854          
BLAST of Myosin heavy chain vs. Ensembl Sea Lamprey
Match: myh10 (myosin, heavy chain 10, non-muscle [Source:ZFIN;Acc:ZDB-GENE-030616-162])

HSP 1 Score: 1273.07 bits (3293), Expect = 0.000e+0
Identity = 618/1041 (59.37%), Postives = 802/1041 (77.04%), Query Frame = 1
Query:   97 QYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPMG---ILSLLDEECFFPKATTKTFVEKLIKNQSTHPKL-KATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQ-ESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELE 3198
            +YL V+++  S  A  +DW+ ++LVW+P +  GF + S+ EE+GDE  V+L EN K + +  ++VQK+NPPKF K EDMA+LT LNEASVL+NLKDRY+S LIYTYSGLFCVVVNPYK LPIY+  +IE Y+G+KRHE PPHIYAVTD AYR+MLQD+E+QSILCTGESGAGKTENTKKVIQYLA VA+S K +K   +             GELE QLLQANP+LEAFGNAKT+KNDNSSRFGKFIRINFD +G+I  ANIETYLLEK+R IRQA +ER FH+FYQLL GA + LK +L+LE  + Y+ LSNG + +P   +K  F++T  +++IMG + +EQ S+ RV+++VLH GNI FK+ER++DQA++PDNT AQK+ HLLG+ VT+ T+A+L P++K+GR+ V KAQTKEQA+F++EA++K+TYER+FRWLV R+N+++DR  RQ  +FIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W FIDFGLDLQP IELIEKP G   IL+LLDEEC+FPKAT K+F EKL++ Q THPK  K    + KADF VIHYAGKVDY +D WL+KNMDPLN+NV +LL +S++ FV  +WKD + I+GL T +   ++AFG    TRKGMFRTVGQLYKE LTKLM  L NTNPNFVRCIIPNHEKK+GK++  LV+DQL+CNGVLEGIRICRQGFPNRI+FQEF+QRY ILTPN I KGFMDG++A E M+  L++D + YRIGQSKIFF+AGVLA LEE+RD+K+T+II+ FQ+  RGYLAR+    R Q L+A+++IQRNC+AYLKLRNW WW+LFT+VKPLL V+RQ+EV+  K EEL+K KE   +   D    +  +   ++EK  + E L+ E     + E  R  L  + +++E    + E+R  E +++   L  EK K+Q  +  L   LE EE   QK Q +K+  + ++K++E+ +  LED+ +K  KEKK +EER++++ + L++EEE +K L K+K++ E+ I +LE
Sbjct:   18 KYLYVERNTYSIPAAQADWSARRLVWVPSEKHGFEAASIKEERGDEVLVELAENQKKVTVNKDDVQKMNPPKFAKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVVNPYKNLPIYSEEIIEMYRGKKRHEVPPHIYAVTDTAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKGRKDHGAP------------GELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVAGYIVGANIETYLLEKSRAIRQAKDERTFHIFYQLLSGAGEHLKTDLLLEGYNNYRFLSNGNVVIPGQQDKDNFQETTSSMNIMGFTHEEQISLLRVVSSVLHYGNIVFKKERNTDQASMPDNTAAQKLCHLLGIAVTDFTRAILTPRIKVGRDYVQKAQTKEQADFAIEALAKATYERLFRWLVQRLNKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIEKPAGPPGILALLDEECWFPKATDKSFCEKLVQEQGTHPKFQKPKQLKDKADFSVIHYAGKVDYKADEWLMKNMDPLNDNVATLLHQSSDKFVAELWKDVDRIVGLDTVSGMTDTAFGSTYKTRKGMFRTVGQLYKEQLTKLMATLRNTNPNFVRCIIPNHEKKAGKLEPHLVLDQLRCNGVLEGIRICRQGFPNRIIFQEFRQRYEILTPNAIPKGFMDGKQACERMIKGLELDPNLYRIGQSKIFFRAGVLAHLEEERDLKITDIIIAFQATCRGYLARRAFGKRQQQLSALRVIQRNCSAYLKLRNWQWWRLFTKVKPLLQVSRQDEVLLAKAEELQKVKERQVQAETDLVELEHKHNQAIKEKQMMAEQLQAEIELCAEAEEMRSRLEAKKQELEDILHDLEARVEEEEERAQALNQEKKKMQQHVQDLEDQLEEEETARQKLQLEKVQTESKLKKMEEDLIILEDQNSKFIKEKKLIEERVSELATNLSKEEENNKNLLKVKNKQESIIADLE 1046          
BLAST of Myosin heavy chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003821.1 (pep scaffold:Pmarinus_7.0:GL477325:10535:35195:1 gene:ENSPMAG00000003267.1 transcript:ENSPMAT00000003821.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 987.638 bits (2552), Expect = 0.000e+0
Identity = 680/1947 (34.93%), Postives = 1095/1947 (56.24%), Query Frame = 1
Query:  160 KKLVWIPDDNEGFISGSLIEEKGDEATVKLENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVAT--SLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQL-LLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQ--MFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRNRQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPMGILSLLDEECFFPKATTKTFVEKLI-----KNQSTHPKLKATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESAFGGA---------KTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKG-FMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDA-QQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAK----------SLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEI---ATITMARDTAIADKKR-IESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETK---RADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKIDRLEKRTR 5886
            KK  ++ D    F+   +   +G + TV  ENG+T+ +    V ++NPPKF K EDMA LT+LNE SVL+NLK+RY + +IYTYSGLFCV +NPYK LP+Y   V+  Y+G+KR E PPHI++++D AY+ ML D+ENQSIL TGESGAGKT NTK+VIQY A++A    +  +K  +              G LE Q+++ANP++EAFGNAKT++NDNSSRFGKFIRI+F  +G +SSA+IETYLLEK+RV  Q   ER +H+FYQ+      + L+  LI  N   Y  +S G I VP  D+    M  D   A+DI+G + DE+ SI++V  A++H GN++FKQ++  +QA    N  A K A+L+GL   ++ K L  P++K+G E V K QT +Q   SV A+++S +E+MF W+V+RIN ++     + +FIG+LDIAGFEIF+ N+FEQLCIN+TNEKLQQ FNH MFVLEQEEY+KE I W FIDFG+DLQ  I+LIEKPMGI+S+L+E+C FPKA  +TF EKL      KNQ    K K +  + +A F + HYAG VDY    WL KN DPLN++VV L Q+S+   +  ++                + + GA         K  +   F+TV  L++E+L KLM  L  T+P+FVRCIIPN  K  G +D+ LV+ QL+CNGVLEGIRICR+GFPNRI++ +FKQRY +L PN I +G FMD +KA E ++  L++D + Y+ G +K+FF+AG+L  LEE RD +L+ ++ + Q+ ARGYL+R   +   +   ++ IIQ N  A++ ++NW W  L+ ++KPLL     E+ +A  +EE  K+KE LEK  A  +  ++    ++++KN +   ++     L D E   + LIK    +E   +E + R  E ++   ++  +K KL++E S+L ++++  E  L K + +K + + ++K L +++A L++ ++KLTKEKK+L+E     +  L  EE+K   LTK K++ E  + +LE  L +E+  R D+E+TKR++E +L                                           LAQ  + D EN   ++ E L+               L+  +  +   L + G  +     + +K+E E +  ++  E+ T + E     +RKK A ++  L  QI+   + K  +EK K + + E++D ++ L  +  +K + EKL +  E QL+E+  +  E      D  ++  +      +L+  LEE E  + QL++ +LS   Q+ DL++  EEE + K      ++       LL++Q +EEQ++K  L+  +    +++   + K E DA Q+  E +E++KK+    +E + ++E + ++    EK K+ +  E++D    +E   +     D+K K     ++E     ++  +E +  +KE+R   T++ +L+   NA ++ L  LE  K          S LT QL E   +  +V K+   LE+ K++++  LE  + ++E   EE   L     R++++L   KA +DR++A KDE  D+  R   + +   +A+L+ E KS+   + LKKK+E +  ++  QL  +        RQ  + Q +  N+Q ++++ +  +  +L   K   +   T    V   ++ L+       TI       L      A I   ++T++ + KR +E  I  L  + EE        ++K KK I+    +  EL  E+   + LE  K   E+  K+L ++++E E  A K  K  +   +++++ L+S+LD++   I +  +  +K ER++KE+     ++ K   R  + +++++     +K+  +S + E++ N+ LS + R+LQ +LEE +E  +       I ++++++L  R+R
Sbjct:   32 KKECYVDDPKVEFVKAIIKSSEGGKVTVDTENGQTVTVKESQVHQMNPPKFDKIEDMAMLTFLNEPSVLFNLKERYAAWMIYTYSGLFCVTINPYKWLPVYDPIVVAGYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIAALGDVTKKKEESKK------------GTLEDQIVEANPLMEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLSSADIETYLLEKSRVTFQLPTERNYHIFYQIESQKKPELLEMLLITNNPYDYVFISQGEITVPSIDDGDELMATDVQSAIDILGFTNDEKLSIYKVTGALMHYGNMKFKQKQREEQAEPDGNEDADKAAYLMGLNSADLLKGLCYPRVKVGNEYVTKGQTVQQVHNSVGALARSVFEKMFLWMVIRINETLATKLARQHFIGVLDIAGFEIFDFNTFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIDWVFIDFGMDLQACIDLIEKPMGIMSILEEQCMFPKANDQTFKEKLYDQHLGKNQFFQ-KPKPSKGKHEAHFSLGHYAGNVDYNISGWLEKNKDPLNDSVVQLYQKSSLKMLAAVY----------------ATYAGADSDSGSKGGKKKKGSSFQTVSALHRENLNKLMTNLKTTHPHFVRCIIPNETKTPGTMDNNLVMHQLRCNGVLEGIRICRKGFPNRIVYGDFKQRYRVLNPNAIPEGQFMDSKKACEKLMASLELDDTQYKFGHTKVFFRAGLLGTLEEMRDDRLSLLLTRTQALARGYLSRVEFKKMLERRESLIIIQYNIRAFMGVKNWPWMNLYFKIKPLLKSAESEKEMANMKEEFIKTKEALEKSEARRKELEEKMISVVQDKNDLLIQVQSSEETLNDAEERCDQLIKTKIQLEGKIKEIQERVEEEEEMNAEITAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAVLDENVSKLTKEKKALQEAHQQTLDDLQAEEDKVNSLTKAKAKLEQQVDDLEGSLEQEKKVRMDVERTKRKMEGDL------------------------------------------KLAQESLMDLENDKQQLDEKLKKCVL-----------LSHLVPQISERLEEAGGATSAHIEMNKKREAEFK-LRRDLEEATLQHEATAAALRKKQADSVAELGEQIDNLQRVKQKLEKEKSEFKMEVDDLSSNLEQVTKAKVNLEKLCRTIEDQLAEVKTKEEEQIRSINDINTQRARLLAENGELSRKLEEKEVLVVQLSRGKLSYTQQVEDLKRQLEEEIKAKNALAHAVQSARHDCDLLREQFDEEQEAKGELQRAMSKANAEVAQWRTKYETDAIQKTEELEEAKKKLAVRLQEAEEQVEASNSKCASLEKTKQRLLGEVEDLMIDVERAHSAAAALDKKQKAFGKVLSEWKQKYEESQSELEASQKESRSLSTEVFKLK---NAYEETLDHLETLKRENKNLQEEISDLTEQLGESGKALHEVEKSRKQLEQEKLEIQAALEEAEASLE--HEEGKIL-----RIQLELNQVKADIDRKIAEKDEELDQLKRSNQRTVESMQASLDAETKSRNEALRLKKKMEGDLNEMEIQLNHAN-------RQAAESQKHLRNVQGQIKKYLEVRTQHLAHAKSTSRNTVT----VYCCAKGLNLRPLRALTIIPCVCNMLYHCSVWAYIYSRQNTSLINTKRKLEGDIVQLQNECEEAIQESRNADEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQNRLDEAEQIAMKGGKKQIQKLETRVRELESELDSEQRRIAETIKGARKYERRVKELTYQAEEDRKNNLRLQDLVDKLQLKVKTYKR--QSEEAEEQANTNLS-KYRKLQHELEEADERAD-------IAESQVNKLRARSR 1864          
BLAST of Myosin heavy chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002731.1 (pep scaffold:Pmarinus_7.0:GL478284:11062:40470:1 gene:ENSPMAG00000002428.1 transcript:ENSPMAT00000002731.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 972.615 bits (2513), Expect = 0.000e+0
Identity = 650/1852 (35.10%), Postives = 1044/1852 (56.37%), Query Frame = 1
Query:  160 KKLVWIPDDNEGFISGSLIEEKGDEATVKLENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLG-ADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRNRQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPMGILSLLDEECFFPKATTKTFVEKLIKNQ----STHPKLKATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQR-YGILTPNVILKG-FMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYE--------------FLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKAD-----SEKLKKNTELQLSEISHRLSE---SEEHKLDAESKLKKQT---ELADKLAMNLEE---IESKLSQ--LTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDA-QQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAK------SLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKE---RVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDA 5574
            KK V++      FI   +    G + TV+   G+T+ +   +V ++NPPKF K EDMA LT+LNE SVL+NLK+RY + +IYTYSGLFCV VNPYK LP+Y++  +  Y+G+KR E PPHI++++D AY+ ML D+ENQS+L TGESGAGKT NTK+VIQY AS+A +   +              D + G LE Q++ ANP LEAFGNAKT++NDNSSRF  ++   F  S    S ++  +LLEK+RV  Q   ER +H+FYQ+L     + L+  L+  N   Y  +S G + V   D+      T  A DI+G + +E+ S++++  A++H GN+ FKQ++  +QA       A K ++L+GL   ++ K L  P++K+G E V K Q  +Q  +S+ A++KS YE+MF W+V+RIN+S++    + +FIG+LDIAGFEIF+ NSFEQ+CIN+TNEKLQQ FNH MFVLEQEEY+KE I+W FIDFG+DLQ  IELIEKPMGI+S+L+EEC FPKA+ ++F  KL  N     +   K +    R +A F ++HYAG VDY    WL+KN DPLNE VV L Q+S+   +  ++ +       +         G +       F+TV  L++E+L KLM  L +T+P+FVRCIIPN EKK G +D+ LV+ QL+CNGVLEGIRICR+GFPNRIL+ +FKQR Y IL PN + +G FMD RK+ E +L  LDID + Y+ G +K+FFKAG+L  LEE RD +L++II   QS  RG+L+RK      +  +A+ +IQ N  A++ ++NW W KLF ++KPLL                 ++++ ++ M  DF   K+ Y                L++EKN +   ++ E+  + D E   E LIK     E   +E   R  E ++   ++  +K KL++E S+L ++++  E  L K + +K + + ++K L +++A L+D + KLTKEKK+L+E     +  L  EE+K   LTK K++ E  + +LE  L +E+  R DLE+ KR+LE +L    + +    +  +++    +  +     + +++++E    +  Q++I++ +  I E++E+LEAE+ ++ + EK + D+A E+E +   L + G  +  Q    +K+E E Q  ++  E+ T + E     +RKK A ++  L  Q++   + K  +EK K +L+ EL+D  + + ++  +K       S+  + +  L LS    RL     +++ KL  E+     T   + A +  + +     IE +LSQ  +  +E+  +S LA                   ++       LL++Q EEEQ++K  L+  +    +++   + K E DA Q+  E +E++KK+++  +E +  +E A  +    EK K+ +Q EL+D    +E         D+K +  +  ++E     ++  AE +  +KE R   T++ +L+   NA ++ L  LE  K         T ++++L     +  K V  LEK + QLE +  + +  +EE E   A+L+  +    R +++L   KA ++R+L+ KDE  ++  R   + +   + ALE E +S+   + +KKK+E +  ++  QL+ + +   E  +Q+K  Q      Q ++ + +   ++Y +Q    E+R     + V +L   L Q+ERA++    E  EA E +  +     + I  KK++E  +  L  + EE        E+K KK I+    +  EL  E+   + LE  K   E+  K+L  +++E E  A K  K  +   +++++ L+++L+A
Sbjct:   32 KKNVYVNHPKCEFIKALVQSVDGGKYTVETAEGETIVVKDVDVMQMNPPKFDKIEDMAMLTFLNEPSVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYSSQCVNAYRGKKRQEAPPHIFSISDNAYQYMLSDRENQSVLITGESGAGKTVNTKRVIQYFASIAAAGTKR--------------DASKGTLEDQIVSANPALEAFGNAKTLRNDNSSRFTTYV---FVLSNVCLSVHLSLHLLEKSRVTFQLKAERNYHIFYQILSQRKPELLEMLLVTTNPYDYSFISQGQVTVAGMDDGDELMATDSAFDILGFTAEEKASVYKLTGAIMHFGNMHFKQKQREEQAEADGTEDADKASYLMGLNSADLIKGLCHPRVKVGNEYVTKGQDVQQVSYSIGALAKSVYEKMFNWMVVRINQSLETKAPRQHFIGVLDIAGFEIFDFNSFEQICINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWVFIDFGMDLQACIELIEKPMGIMSILEEECMFPKASDQSFKAKLYDNHLGKSNNFQKPRIVKGRPEAHFALMHYAGVVDYNISGWLIKNKDPLNETVVGLYQKSSLKLLSVLFANYAAADADAAKKGGAKKKGSS-------FQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNEEKKPGAMDNALVMHQLRCNGVLEGIRICRKGFPNRILYGDFKQRQYRILNPNAVPEGQFMDSRKSAEKLLSTLDIDHTQYKFGHTKVFFKAGLLGTLEELRDDRLSKIITLMQSQCRGFLSRKEFAKIIERRDALLVIQYNIRAFMGVKNWPWMKLFFKIKPLLK--------------SAETEKEMQNMKEDFLKLKEAYAKSEARRKELEEKSVSLLQEKNDLAMQVQAEQDNIADAEERCEQLIKSKISQEGKIKELTERLEEEEEMNAEVTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAALDDIIAKLTKEKKALQEAHQQTLDDLQAEEDKVNSLTKSKAKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQETIMDLENDKQQLEEKSKNRDFMTNTLNSRIEDEQALAAQLQKKIKELQARIEELEEELEAERAARAKVEKQRADVARELEEISERLEEAGGATAAQVEFNKKREAEFQKLRRDLEESTLQHEATASALRKKHADSVAELGEQLDNLQRVKQKLEKEKSELKMELDDVLSNMESVVKTKVSAWRDASDAARAHRHLHLS--CQRLISDFTAQKAKLQTENGAPSSTHTPQYAIETIITMHTGTFIEQRLSQRHIKHNEVKAKSALAH-----------------AVQAARHDCDLLREQYEEEQEAKAELQRALSRANAEVAQWRTKYETDAIQRTEELEEAKKKLVQRLQEAEESVEAANAKCSSLEKTKQRLQNELEDMMVDVERANAAAAALDKKQRTFDKVLSEWKQKFEESQAELEGAQKEARSLSTELFKLK---NAYEESLDHLETMKRENKNLQACTEEISDLTEQMSEGAKTVHELEKLRKQLEQEKVDLQAALEEAE---ASLEHEESKILRAQLELNQMKADIERKLSEKDEELEQAKRNNQRAVETLQTALEAETRSRNEALRIKKKMEGDLNEMEIQLSHANRSASEAQKQLKMVQSQFKEAQLQLDDALRLGDEYKEQAAMAERRSTLMLAEVEELRSALEQTERARKLAEQELIEASERVQLLHSQNTSLINQKKKLEGDMGVLQNEVEESVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEA 1820          
BLAST of Myosin heavy chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005582.1 (pep scaffold:Pmarinus_7.0:GL481917:38212:72095:-1 gene:ENSPMAG00000004862.1 transcript:ENSPMAT00000005582.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 966.066 bits (2496), Expect = 0.000e+0
Identity = 615/1658 (37.09%), Postives = 968/1658 (58.38%), Query Frame = 1
Query:  160 KKLVWIPDDNEGFISGSLIEEKGDEATVKLENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLG-ADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRNRQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPMGILSLLDEECFFPKATTKTFVEKLIKNQ----STHPKLKATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQR-YGILTPNVILKG-FMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYE--------------FLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESK--LKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDA-QQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAK------SLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKE---RVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQG 5034
            KK V++      FI   +   +G + TV+   G+T+ +   +V ++NPPKF K EDMA LT+LNE SVL+NLK+RY + +IYTYSGLFCV VNPYK LP+Y++  +  Y+G+KR E PPHI++++D AY+ ML D+ENQSIL TGESGAGKT NTK+VIQY AS+A +   + T+               G LE Q++ ANP LEAFGNAKT++NDNSSRFGKFIRI+F T+G ++SA+IET  LEK+RV  Q   ER +H+FYQ+L     + L   L+  N   Y  +S G + V   D+      T  A DI+G + +E+ S++++  A++H GN+ FKQ++  +QA       A K ++L+GL   ++ K L  P++K+G E V K Q  +Q  +S+ A++KS YE+MF W+V+RIN S++    + +FIG+LDIAGFEIF+ NSFEQLCIN+TNEKLQQ FNH MFVLEQEEY+KE I+W FIDFG+DLQ  IELIEKPMGI+S+L+EEC FPKA+ ++F  KL  N     +   K +    + +ADF ++HYAG VDY    WLVKN DPLNE VV L Q+S+   +        N   +   T ++         +   F+TV  L++E+L KLM  L +T+P+FVRCIIPN EKK G +D+ LV+ QL+CNGVLEGIRICR+GFPNRIL+ +FKQR Y IL PN + +G FMD RK+ E +L  LDID + Y+ G +K+FFKAG+L  LEE RD +L++II   Q+  RG L+RK      +  +A+ +IQ N  A++ ++NW W KLF ++KPLL                 ++++ ++ M  DF   K+ Y                L++EKN +   ++ E+  + D E   E LIK     E   +E   R  E ++   ++  +K KL++E S+L ++++  E  L K + +K + + ++K L +++A L+D + KLTKEKK+L+E     +  L  EE+K   LTK K++ E  + +LE  L +E+  R DLE+ KR+LE +L    + +    +  +++    ++ + ++  + +++++E    +  Q++I++ +  I E++E+LEAE+ ++ + EK + D+A E+E +   L + G  +  Q    +K+E E Q  ++  E+ T + E     +RKK A ++  L  Q++   + K  +EK K +L+ EL+D  + + ++  +K  S+K  +  +  + E    L ES+E  +D+ ++  LK QTE       + +       ++ +  +    Q A L    +   + K      ++       LL++Q EEEQ++K  L+  +    +++   + K E DA Q+  E +E++KK+++  ++ +  +E A  +    EK K+ +Q EL+D    +E         D+K +  +  + E     ++  AE +  +KE R   T++ +L+   NA ++ L  LE  K         T ++++L     +  K V  LEK + QLE +  + +  +EE E   A+L+  +    R +++L   KA +DR+L+ KDE  ++  R   + +   + ALE E +S+   + +KKK+E +  ++  QL+ + +   E  +Q+K  Q 
Sbjct:   32 KKNVYVNHPKCEFIKALVQSVEGGKYTVETAEGQTVVVKDVDVMQMNPPKFDKIEDMAMLTFLNEPSVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYSSQCVNAYRGKKRQEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFASIAAAGTKRDTSK--------------GTLEDQIVSANPALEAFGNAKTLRNDNSSRFGKFIRIHFGTTGKLASADIET--LEKSRVTFQLKAERNYHIFYQILSQRKPELLDMLLVTTNPYDYSFISQGQVTVAGLDDGDELMATDSAYDILGFTGEEKASVYKLTGAIMHFGNMHFKQKQREEQAEADGTEDADKASYLMGLNSADLIKGLCHPRVKVGNEYVTKGQNVQQVSYSIGALAKSVYEKMFNWMVVRIN-SLETKAPRQHFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIELIEKPMGIMSILEEECMFPKASDQSFKAKLYDNHLGKSNNFQKPRIVKGKLEADFALVHYAGVVDYNISGWLVKNKDPLNETVVGLYQKSSLKLLAL---LFANYAAVDADTTKKGT-----KKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNEEKKPGAMDNALVMHQLRCNGVLEGIRICRKGFPNRILYGDFKQRQYRILNPNAVPEGQFMDSRKSAEKLLSTLDIDHTQYKFGHTKVFFKAGLLGTLEEMRDDRLSKIITLLQARLRGLLSRKEFAKIIERRDALLVIQYNIRAFMGVKNWPWMKLFFKIKPLLK--------------SAETEKEMQNMKEDFLKLKEAYAKSEARRKELEEKSVSLLQEKNDLAMQVQAEQDNIADAEERCEQLIKSKISQEGKIKELTERLEEEEEMNAEVTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAALDDIIAKLTKEKKALQEAHQQTLDDLQAEEDKVNSLTKSKAKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQETIMDLENDKQQLEEKSKKFDFEMNTLNSRIEDEQALAAQLQKKIKELQARIEELEEELEAERAARAKVEKQRADVARELEEISERLEEAGGATAAQIEFNKKREAEFQKLRRDLEESTLQHEATASALRKKHADSVAELGEQLDNLQRVKQKLEKEKSELKMELDDIVSNMESVVKTKEISQKRLRVLDFCVIESRMSLIESQE-SVDSWNRVALKLQTENGAPSGTHTDTGALIQQRVQQRHIKNNEQFAHLPHPVQASAKAKSALAHAVQAARHDCDLLREQYEEEQEAKAELQRALSRANAEVAQWRTKYETDAIQRTEELEEAKKKLVQRLQDAEESVEAANAKCSSLEKTKQRLQNELEDMMVDVERANAAAAALDKKQRTFDKVLAEWKQKYEESQAELEGAQKEARSLSTELFKLK---NAYEESLDHLETMKRENKNLQACTEEISDLTEQMSEGAKTVHELEKLRKQLEQEKVDLQAALEEAE---ASLEHEESKILRAQLELNQMKADIDRKLSEKDEELEQAKRNNLRAVETLQTALEAETRSRNEALRIKKKMEGDLNEMEIQLSHANRSASEAQKQLKIVQA 1643          
BLAST of Myosin heavy chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004078.1 (pep scaffold:Pmarinus_7.0:GL478761:5289:25008:-1 gene:ENSPMAG00000003722.1 transcript:ENSPMAT00000004078.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 881.322 bits (2276), Expect = 0.000e+0
Identity = 462/1057 (43.71%), Postives = 669/1057 (63.29%), Query Frame = 1
Query:  160 KKLVWIPDDNEGFISGSLIEEKGDEATVKLENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLG-ADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRNRQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPMGILSLLDEECFFPKATTKTFVEKLIKNQ----STHPKLKATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKG-FMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYE--------------FLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETEL 3270
            KK V++      F+   +   +G + TV+ E G+T+ +   +V ++NPPKF K EDMA LT+LNE SVL+NLK+RY + +IYTYSGLFCV VNPYK LP+Y++  +  Y+G+KR E PPHI++++         D+ENQSIL TGESGAGKT NTK+VIQY AS+A +   +              D + G LE Q++ ANP LEAFGNAKT++NDNSSRFGKFIRI+F T+G ++SA+IET  LEK+RV  Q   ER +H+FYQ+L     + L+  L+  N   Y  +S G + V   D+      T  A DI+G   +E+ S++++  A++H GN+ FKQ++  +QA       A K ++L+GL   ++ K L  P++K+G E V K Q  +Q  +S+ A++KS YE+MF W+V+RIN+S++    + +FIG+LDIAGFEIF+ NSFEQLCIN+TNEKLQQ FNH MFVLEQEEY+KE I+W FIDFG+DLQ  IELIEKPMGI+S+L+EEC FPKA+ ++F  KL  N     +   K +    + +A F ++HYAG VDY    WLVKN DPLNE VV L Q+S+   + +++ +       + T+ + +        +   F+TV  L++E+L KLM  L +T+P+FVRCIIPN EKK G +D+ LV+ QL+CNGVLEGIRICR+GFP+RIL+ +F  RY IL PN + +G FMD RK+ E +L  LDID + Y+ G +K+FFKAG+L  LEE RD +L++II   Q+  RG L+RK      +  +A+ +IQ N  A++ ++NW W KLF ++KPLL                 ++++ ++ M  DF   K+ Y                L++EKN +   ++ E+  + D E   E LIK     E   +E   R  E ++   ++  +K KL++E S+L ++++  E  L K + +K + + ++K L +++A L+D + KLTKEKK+L+E     +  L  EE+K   LTK K++ E  + +LE  L +E+  R DLE+ KR+LE +L
Sbjct:   32 KKNVYVTHPKCEFVKALVQSVEGGKYTVETEEGETVTVKDADVMQMNPPKFDKIEDMAMLTFLNEPSVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYSSQCVNAYRGKKRQEAPPHIFSISLYISDLHSADRENQSILITGESGAGKTVNTKRVIQYFASIAAAGTKR--------------DASKGTLEDQIVSANPALEAFGNAKTLRNDNSSRFGKFIRIHFGTTGKLASADIET--LEKSRVTFQLKAERNYHIFYQILSQRKPELLEMLLVTSNPYDYAFISQGQVTVAGLDDGDELMATDSAYDILGFVPEEKASVYKLTGAIMHFGNMHFKQKQREEQAEADGTEDADKASYLMGLNSADLIKGLCHPRVKVGNEYVTKGQNVQQVSYSIGALAKSVYEKMFNWMVVRINQSLETKAPRQHFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIELIEKPMGIMSILEEECMFPKASDQSFKAKLYDNHLGKSNNFQKPRIVKGKPEAHFALVHYAGVVDYNISGWLVKNKDPLNETVVGLYQKSSLKLLASLFANYAGADSAADTSKKGA------KKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNEEKKPGAMDNALVMHQLRCNGVLEGIRICRKGFPSRILYGDFTHRYRILNPNAVPEGQFMDSRKSAEKLLSTLDIDHTQYKFGHTKVFFKAGLLGTLEEMRDDRLSKIITLLQARCRGLLSRKEFAKIIERRDALLVIQYNIRAFMGVKNWPWMKLFFKIKPLLK--------------SAETEKEMQNMKEDFLKLKEAYAKSEARRKELEEKSVSLLQEKNDLAMQVQAEQDNIADAEERCEQLIKSKISQEGKIKELTERLEEEEEMNAEVTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAALDDIIAKLTKEKKALQEAHQQTLDDLQAEEDKVNSLTKSKAKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDL 1052          
BLAST of Myosin heavy chain vs. Ensembl Yeast
Match: MYO1 (Type II myosin heavy chain; required for wild-type cytokinesis and cell separation; localizes to the actomyosin ring; binds to myosin light chains Mlc1p and Mlc2p through its IQ1 and IQ2 motifs respectively [Source:SGD;Acc:S000001065])

HSP 1 Score: 728.013 bits (1878), Expect = 0.000e+0
Identity = 432/1086 (39.78%), Postives = 646/1086 (59.48%), Query Frame = 1
Query:  166 LVWIPDDNEGFISGSLIEE-------KGDEATVKL-------ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKR-----------HER-PPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVAT-SLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILE--NVSTYKLLSNG-MIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRNRQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIE---KPMGILSLLDEECFFPKATTKTFVEKLIKN-QSTHPKLKATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTP-NVILKGFMDGRKAT-----ELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKL-RNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQ 3300
            +VWIPD+ E F+ G L+          G E  + +       E    +++ I +V  VNP  F K E+M++LT+LNE SVLYNL+ RY  DLIYTYSGLF V +NPY  L +Y+ + I  Y  +             HE+ PPHI+A+ + AY N+L + ++QSIL TGESGAGKTENTKK++QYLAS+ + S  N    + +++         +   E ++LQ+NP+LE+FGNA+T++N+NSSRFGKFI+I F+  G I+ A+IE YLLEK+R++ Q + ER +H+FYQLL G DD   K L L+  NV  YK+LSN     +P  ++ + FK+ + AL+I+G SKD+   IF+V+A +L +GNIEF  +R+ +QA+  ++  A  +   LG+   +   A+L+P+ K G+E V++++  +QA+F + A+S++ YER+F ++V  IN+++D      N+IG+LDIAGFEIFE NSFEQLCINYTNEKLQQ FN+ MFVLEQ EY KENI+W++ID+G DLQ TI+LIE    P G+L LLDEE   PK+T ++F  KLI        K K +  R K  F + HYAG V+Y  + WL KN DPLN+N++SLL  S    +  +++        +   A  S     K+ R   F+T    ++E    L++ L +T+P+FVRCIIPN+ KK    + +L++DQL+CNGVLEGIR+ R+G+PNRI FQEF QRY IL P N     F    KA+     E +L  L +D   Y+IG +K+FFKAGVLA LE+ +D+KL  I++K  +  RGY  RK +    Q L   ++I      Y +L +   W+ LF R+KPLL+ +                         D   TKK      E+ NK++ D       LQ+ME ++       K +E   Q+  +    T+D  N+   EK  L+   S L++ +++  + LQK Q D L ++K   E+ ++  E+   L +  ++ + L+E + +  +TL +   K+ +L K        I++L   +S+EQ+++  ++++K +LE E+    D ++S+
Sbjct:   12 IVWIPDEKEVFVKGELMSTDINKNKFTGQEEQIGIVHPLDSTEVSNLVQVRISDVFPVNPSTFDKVENMSELTHLNEPSVLYNLEKRYDCDLIYTYSGLFLVAINPYHNLNLYSEDHINLYHNKHNRLSKSRLDENSHEKLPPHIFAIAEEAYENLLSEGKDQSILVTGESGAGKTENTKKILQYLASITSGSPSNIAPVSGSSI---------VESFEMKILQSNPILESFGNAQTVRNNNSSRFGKFIKIEFNEHGMINGAHIEWYLLEKSRIVHQNSKERNYHIFYQLLSGLDDSELKNLRLKSRNVKDYKILSNSNQDIIPGINDVENFKELLSALNIIGFSKDQIRWIFQVVAIILLIGNIEFVSDRA-EQASFKNDVSA--ICSNLGVDEKDFQTAILRPRSKAGKEWVSQSKNSQQAKFILNALSRNLYERLFGYIVDMINKNLDHGSATLNYIGLLDIAGFEIFENNSFEQLCINYTNEKLQQFFNNHMFVLEQSEYLKENIQWDYIDYGKDLQLTIDLIESKGPPTGVLPLLDEEAVLPKSTDESFYSKLISTWDQNSSKFKRS--RLKNGFILKHYAGDVEYTVEGWLSKNKDPLNDNLLSLLSSSQNDIISKLFQPEGEKSSSAGVEANISNQEVKKSARTSTFKTTSSRHREQQITLLNQLASTHPHFVRCIIPNNVKKVKTFNRRLILDQLRCNGVLEGIRLAREGYPNRIAFQEFFQRYRILYPENSTTTTFSSKLKASTKQNCEFLLTSLQLDTKVYKIGNTKLFFKAGVLADLEKQKDVKLNNIMIKLTATIRGYTVRKEITYHLQKLKKTRVIGNTFRLYNRLVKEDPWFNLFIRIKPLLTSSN------------------------DMTRTKK----FNEQINKLKND-------LQEMESKK-------KFLEEKNQKTVNELENTQDLLNQ---EKENLRKNESLLNR-VKTSSETLQK-QFDDLVSEK--DEISREKLEVAQNLEEAHQKIQGLQETIREREATLEKLHSKNNELIK-------QISDLNCDISKEQSSQSLIKESKLKLENEIKRLKDVINSK 1027          
BLAST of Myosin heavy chain vs. Ensembl Yeast
Match: MYO2 (Type V myosin motor involved in actin-based transport of cargos; required for the polarized delivery of secretory vesicles, the vacuole, late Golgi elements, peroxisomes, and the mitotic spindle; MYO2 has a paralog, MYO4, that arose from the whole genome duplication [Source:SGD;Acc:S000005853])

HSP 1 Score: 529.25 bits (1362), Expect = 2.010e-158
Identity = 322/841 (38.29%), Postives = 474/841 (56.36%), Query Frame = 1
Query:  172 WIPDDNEGFISGSLIEEKGDEATVKLE-----------------NGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLP-IYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGM-IAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDR---NRQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPMGILSLLDEECFFPKATTKTFVEKLIKNQSTHP--KLKATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQES-NESFVQTIWKDAENII-GLSTTT-----AQESAFGGAKTTRKGMFRTV------GQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATE--------LMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYL 2559
            W P    G+I   +I+ + ++    LE                 N K   LP+      NPP    +ED+  L+YLNE +VL+ +K RY    IYTYSG+  +  NP+ R+  +YT ++I+ Y G++R E  PH++A+ + AYR M  DK+NQ+I+ +GESGAGKT + K +++Y ASV    +N  T           H V + E E ++L  NP++EAFGNAKT +NDNSSRFGK++ I FD    I  A I TYLLE++R++ Q   ER +H+FYQL+ G   + K+EL L + S Y  ++ G    +   D+ + +K TV+AL ++GI+K+ Q  IF+++AA+LH+GNIE K+ R +D +   D    +    LLG+      K + K ++    E +       QA  + ++++K  Y  +F WLV  IN  +     N Q ++FIG+LDI GFE FE NSFEQ CINY NEKLQQ FN  +F LEQEEY KE I+W FI+F  D QP I+LIE  +GILSLLDEE   P  + +++ +KL +     P  K+ +     +  F V HYA  V Y  + ++ KN D +++  + +L+ S NE+ +        NI+ GL         A++     A + + G  RTV      G ++K+SL +LM+ +N+TN +++RCI PN +K++ + D+ +V+ QL+  GVLE IRI   GFP+R  F+EF  RY IL P+         ++ TE        ++L     D S Y+IG +KIFFKAG+LA LE+ R  K+   IV  Q   R    RK     SQ   AIK +Q N   ++
Sbjct:   10 WYPHKELGWIGAEVIKNEFNDGKYHLELQLEDDEIVSVDTKDLNNDKDQSLPLLR----NPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLYTQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEE--ENSATVQ---------HQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDTSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDASDYFYMNQGGDTKINGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTR-NDASLSADEPNLKLACELLGIDAYNFAKWVTKKQIITRSEKIVSNLNYSQALVAKDSVAKFIYSALFDWLVENINTVLCNPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEFN-DNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQKLYQTLDKSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNETLI--------NILEGLEKAAKKLEEAKKLELEQAGSKKPGPIRTVNRKPTLGSMFKQSLIELMNTINSTNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFVLRYYILIPHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAGMLAYLEKLRSNKMHNSIVMIQKKIRAKYYRKQYLQISQ---AIKYLQNNIKGFI 822          
BLAST of Myosin heavy chain vs. Ensembl Yeast
Match: MYO4 (Type V myosin motor involved in actin-based transport of cargos; required for mRNA transport, including ASH1 mRNA, and facilitating the growth and movement of ER tubules into the growing bud along with She3p; MYO4 has a paralog, MYO2, that arose from the whole genome duplication [Source:SGD;Acc:S000000027])

HSP 1 Score: 502.671 bits (1293), Expect = 5.554e-150
Identity = 304/815 (37.30%), Postives = 463/815 (56.81%), Query Frame = 1
Query:  172 WIPDDNEGFISGSLIEEKGDEAT----VKLENGKTMKL-----------PIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLP-IYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLS-NGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRS-----IDRNRQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPMGILSLLDEECFFPKATTKTFVEKLIKNQSTHPKLKATDFRAKADFG-----VIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRKGMF--------RTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFM---DGRKAT-----ELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLAR 2487
            W P   +G+I G + +    E T    +KLE+G+T+ +           P   V + NPP    ++D+  L+YLNE +VL+ +K RY +  IYTYSG+  +  NP+ ++  +Y+  +I+ Y  +++ E  PH++A+ + AYR M+ +K NQ+++ +GESGAGKT + K +++Y ASV  S   +              +V + ++E+Q+L  NP++EAFGNAKT +NDNSSRFGK+++I FD +  I  + I TYLLEK+R++ Q   ER +H+FYQ+L G  + +K+EL L +   Y   +  G   +   DE + +K T +AL ++GI+ + Q  IF+++A +LH+GNIE K  R +D +   +    Q    LLG+      K ++K ++    E +       QA  + ++++K  Y  +F WLV  IN++     +D+     +FIGILDI GFE FE NSFEQ CINY NEKLQQ FN  +F LEQEEY KE I+W FI+F  D QP I+LIE  +GILSLLDEE   P  + +++  KL    S   K  + +  +K  FG     V HYA  V+Y  + ++ KN D ++   + + + +     + I  + E    L +  A E       T +K M          T+G ++K+SL +LM ++N+TN +++RCI PN EKK  + D+ +V+ QL+  GVLE IRI   GFP+R  F EF QRY +LT   +  G +   D  K       + +L     D++ Y+IG +KIFFKAG+LA LE+ R  K+ EI +  Q   R    R
Sbjct:   10 WYPHKEQGWIGGEVTKNDFFEGTFHLELKLEDGETVSIETNSFENDDDHPTLPVLR-NPPILESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHLYSREMIQNYSSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMRYFASVQESNNREG-------------EVEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQILFDENTTIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYHYTNQGGQPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTR-NDASLSSEEQNLQIACELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQALIARDSVAKFIYSTLFDWLVDNINKTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEFS-DNQPCIDLIENKLGILSLLDEESRLPSGSDESWASKLY---SAFNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFKATTNPIFKQILDNRE----LRSDDAPEE----QNTEKKIMIPARLSQKKPTLGSMFKKSLGELMAIINSTNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQRYFLLTDYSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAFLEKLRTNKMNEICIIIQKKIRARYYR 797          
BLAST of Myosin heavy chain vs. Ensembl Yeast
Match: MYO5 (One of two type I myosin motors; contains proline-rich tail homology 2 (TH2) and SH3 domains; MYO5 deletion has little effect on growth, but myo3 myo5 double deletion causes severe defects in growth and actin cytoskeleton organization; MYO5 has a paralog, MYO3, that arose from the whole genome duplication [Source:SGD;Acc:S000004715])

HSP 1 Score: 400.593 bits (1028), Expect = 7.889e-117
Identity = 258/774 (33.33%), Postives = 412/774 (53.23%), Query Frame = 1
Query:  325 DMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTY-KLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGR-----EVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRNRQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIE--KPMGILSLLDEECFFPKATT----KTFVEKLIKNQSTHPKLKATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFM----DGRKATELMLGELDIDASNYRIGQSKIFFKAG-VLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNC------NAYLKLRNWA 2577
            D+  L+ +++ ++  NLK R+ +  IYTY G   + VNP++ L IYT+ V+  YKG+ R E PPH++A+ +  Y NM    ENQ ++ +GESGAGKTE  K+++QY+A+ +++                 H  +IG+++  +L  NP+LE+FG AKT++N+NSSR GK++ I F+      + NI  YLLEK RV+ Q  NER FH+FYQ   GA D  ++   ++    Y    + G I+    D+ Q +++T++A+ ++G+ ++EQ+ IFR++AA+L +GN+ F  E     A + D +V   VA+LL +    + K+L++  ++         V        QA+   +A++K+ Y  +F W+V R+N+S+         IGILDI GFEIFE NSFEQ+CINY NEKLQQ+F       EQE Y +E I+W  I +  D +   +LIE  +P GI + +++      A +    + F ++L    +T+P     D R+   F + HYAG V Y  D    KN D L +++V L+  +  +F+ TI+ D         T  +ES         K    T G    +S   L++ L+   P+++R I PN  K     D + V+ Q+K  G+ E +RI R GF  R +F++F +R+ +L+P+    G      D   A + +L +  I    Y++G + +F K    L  LE  RD     +  + Q   R +L R+        ++A   IQR        N Y KLR++ 
Sbjct:   40 DLTLLSKISDEAINENLKKRFLNATIYTYIGHVLISVNPFRDLGIYTDAVMNEYKGKNRLEVPPHVFAIAESMYYNMKSYNENQCVIISGESGAGKTEAAKRIMQYIAAASST-----------------HTESIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNNQFEPCAGNITNYLLEKQRVVSQIKNERNFHIFYQFTKGASDAYRQTFGVQKPEQYVYTAAAGCISAETIDDLQDYQETLKAMRVIGLGQEEQDQIFRMLAAILWIGNVSFI-ENEEGNAQVRDTSVTDFVAYLLQIDSQLLIKSLVERIMETNHGMKRGSVYHVPLNIVQADAVRDALAKAIYNNLFDWIVSRVNKSLQAFPGAEKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQETYEREKIQWTPIKY-FDNKVVCDLIEARRPPGIFAAMNDSVATAHADSNAADQAFAQRL-NLFTTNPHF---DLRSN-KFVIKHYAGDVTYDIDGITDKNKDQLQKDLVELIGTTTNTFLATIFPD---------TVDRES---------KRRPPTAGDKIIKSANDLVETLSKAQPSYIRTIKPNETKSPNDYDDRQVLHQIKYLGLQENVRIRRAGFAYRQVFEKFVERFYLLSPHCSYAGDYTWQGDTLDAVKYILQDSSIPQQEYQLGVTSVFIKTPETLFALEHMRDRYWHNMAARIQRAWRRFLQRR--------IDAATKIQRTIRERKEGNKYEKLRDYG 763          
BLAST of Myosin heavy chain vs. Ensembl Yeast
Match: MYO3 (One of two type I myosins; localizes to actin cortical patches; deletion of MYO3 has little effect on growth, but myo3 myo5 double deletion causes severe defects in growth and actin cytoskeleton organization; MYO3 has a paralog, MYO5, that arose from the whole genome duplication [Source:SGD;Acc:S000001612])

HSP 1 Score: 397.127 bits (1019), Expect = 2.874e-115
Identity = 259/775 (33.42%), Postives = 408/775 (52.65%), Query Frame = 1
Query:  325 DMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTY-KLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGR-----EVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRNRQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIE--KPMGILSLLDEECFFPKATT----KTFVEKL-IKNQSTHPKLKATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFM----DGRKATELMLGELDIDASNYRIGQSKIFFKAG-VLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNC------NAYLKLRNWA 2577
            D+  L+ +++ S+  NLK R+ + +IYTY G   + VNP++ L IYTN V+E YKG+ R E PPH++A+ +  Y N+    ENQ ++ +GESGAGKTE  K+++QY+A+ + S                 H  +IG+++  +L  NP+LE+FG AKT++N+NSSR GK++ I F++     + NI  YLLEK RV+ Q  NER FH+FYQ   GA D  K+   ++    Y    + G       D+ + ++ T+EA+  +G+ ++EQ+ IFR++AA+L +GNI F  E     A + D +V   VA+LL +  + + K L++  ++         V        QA    +A++K+ Y  +F W+V R+N S+         IGILDI GFEIFE NSFEQ+CINY NEKLQQ+F       EQE Y +E IKW  I +  D +   +LIE   P GIL+ +++      A +    + F ++L + N + + +L+A  F  K      HYAG V Y  +    KN D L ++++ L+  +  +F+ TI+ D                        K    T G    +S  +L++ L+   P+++R I PN  K     D   V+ Q+K  G+ E +RI R GF  R  F++F +R+ +L+P+    G      D  +A +L+L +  I    +++G + +F K    L  LE+ RD     +  + Q   R +L R+        ++A   IQR        N Y+KLR++ 
Sbjct:   40 DLTLLSKISDESINENLKKRFKNGIIYTYIGHVLISVNPFRDLGIYTNAVLESYKGKNRLEVPPHVFAIAESMYYNLKSYNENQCVIISGESGAGKTEAAKRIMQYIAAASNS-----------------HSESIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNSQFEPCAGNITNYLLEKQRVVGQIKNERNFHIFYQFTKGASDTYKQMFGVQMPEQYIYTAAAGCTTADTIDDVKDYEGTLEAMRTIGLVQEEQDQIFRMLAAILWIGNISF-IENEEGNAQVGDTSVTDFVAYLLQVDASLLVKCLVERIMQTSHGMKRGSVYHVPLNPVQATAVRDALAKAIYNNLFDWIVDRVNVSLQAFPGADKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKAEQETYEREKIKWTPIKY-FDNKVVCDLIEAKNPPGILAAMNDSIATAHADSNAADQAFAQRLNLFNSNPYFELRANKFVIK------HYAGDVTYDINGITDKNKDQLQKDLIELIGTTTNTFLSTIFPD------------------DVDKDSKRRPPTAGDKIIKSANELVETLSKAEPSYIRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVERFYLLSPDCSYAGDYTWDGDTLEAVKLILRDAMIPEKEFQLGVTSVFIKTPESLFALEDMRDKYWYNMAARIQRAWRRFLQRR--------IDAAIKIQRTIREKKGGNKYVKLRDYG 763          
BLAST of Myosin heavy chain vs. Ensembl Nematostella
Match: MYHC-ST (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUG0])

HSP 1 Score: 538.11 bits (1385), Expect = 2.881e-173
Identity = 263/524 (50.19%), Postives = 364/524 (69.47%), Query Frame = 1
Query:   94 LQYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKLENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVST--YKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRNRQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELI 1659
            L  L++DKS +   A   ++ +KK VWIPD  EG+ +  +   KGD   V+  +G+ +++   + +++NPPK+ K+EDM++LTYLNEASV++NLK RYFS LIYTYSGLFCV +NPY+RLPIYT+ ++  Y+G+++ E PPH++ + D AY+NMLQD+ENQS+L TGESGAGKTENTKKVIQYLA V+  +                     G LE Q++Q NP+LEA+GNAKTI+N+NSSRFGKFIR +F   G ++ A+IE+YLLEK+RVI Q   ER +H+FYQ+L GA   L  +L+LE+  T  Y   + G       D+ + + +T  A D +G S +E+ S++++ AA LH GN +FKQ    +QA + D     K + L+ LP  +  K ++KP++K+GRE V + +  +Q  +S+ A++KS YERMF WLV R N+++    ++  FIG+LDIAGFEIF+ NSFEQLCIN TNEKLQQ FNH MF+LEQEEY++E I WEFIDFG DL+PTI LI
Sbjct:    9 LAILRIDKSQIM--AQAKEFESKKWVWIPDPKEGYKAAEVKSTKGDNFLVETNDGQEVEINKNDTEQMNPPKYEKTEDMSNLTYLNEASVVHNLKQRYFSGLIYTYSGLFCVAINPYRRLPIYTDKIVFAYRGKRKTEAPPHVFCICDNAYQNMLQDRENQSMLITGESGAGKTENTKKVIQYLAHVSGGISKADEEHKKQTG---------GSLEDQVIQTNPILEAYGNAKTIRNNNSSRFGKFIRCHFGPQGKLAGADIESYLLEKSRVIYQQEIERNYHIFYQILYGAPKDLHDQLLLESNKTADYAYTAKGCERADGIDDVEEWANTELAADTLGFSAEEKLSMYKICAACLHWGNSKFKQRPREEQAEVADPKDLDKTSFLMKLPGADFVKNIVKPRIKVGREYVNQGRNLQQVNYSIGALTKSLYERMFLWLVDRANQTLMTKDRRAFFIGVLDIAGFEIFQFNSFEQLCINVTNEKLQQFFNHHMFILEQEEYKREGIHWEFIDFGHDLEPTINLI 521          
BLAST of Myosin heavy chain vs. Ensembl Nematostella
Match: EDO41819 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3A8])

HSP 1 Score: 513.072 bits (1320), Expect = 1.562e-155
Identity = 297/785 (37.83%), Postives = 453/785 (57.71%), Query Frame = 1
Query:  169 VWIPDDNEGFISGSLIEEKGDEAT-VKLENGKTM-------KLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYF-SDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPD-YDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVA-QKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRNRQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPMGILSLLDEECFFPKATTKTFVEKLIKNQSTHPKLKATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARK 2490
            VWIP  +  +I G L ++  D+   + LE+G+ +       +LP       NP       D+  L+YL+E +VL+NL  R+  S+ IYTY G+  V +NPY+ LP+Y  +++  Y+GR   +  PHI+AV + A+++M++D+ NQS++ +GESGAGKT + K  ++Y ++V  +     +T +              ++E +++  NP++EA GNAKTI+NDNSSRFGK++ I+FD +  I  A++ TYLLEK+RV+ QAA ER +HVFYQ+    +    K+  L +   +  L+ G   V D  D+   F++  EAL ++GI+ DEQ  +FR+++A+LH+GN+E  Q    D+  + +N    +  A LLG+   ++ K L   K+    EV+ K  +  +A +  EAISK  Y ++F+W+V  IN ++    +  +FIG+LDI GFE FEINSFEQ CINY NEKLQQ F   +F LEQ+EY +E I+W FI+F  D QP I+LIE  +GIL LLDEEC  PK +   + +KL K      K  +    +   F + H+A  V+Y    ++ KN D +N+  ++LL+ S +  V  ++   EN    +      S  G        MF++VG  +  SL+KLM+ LN+T P++VRCI PN  K   +   K  I QL+  GVLE IRI   G+P+R  ++EF  RY +L P+  +      R+  +L+L     D   +++G++KIFF+AG +A LE+ R  KL    V  Q   R Y   K
Sbjct:    3 VWIPHPDLVWIGGELTKDIEDKILEILLEDGREIIIDTRKSRLPPLR----NPEILVGENDLTTLSYLHEPAVLHNLNVRFIQSNAIYTYCGIVLVAINPYEELPLYGPDIVAAYRGRSMGDMDPHIFAVAEDAFQSMIRDERNQSVIVSGESGAGKTVSAKYAMRYFSAVGGA-----STET--------------QIEKKVIATNPIMEAIGNAKTIRNDNSSRFGKYLEISFDRNHHIIGAHMRTYLLEKSRVVFQAAEERNYHVFYQMCAACELPEMKDFRLAHPDNFSYLNQGDAPVVDSIDDADCFEELREALSMVGINDDEQLMLFRILSAILHLGNVEILQA-GDDECTVEENDFHLEMTAVLLGIDKNQLRKWLCNRKIVTVGEVLIKPLSITEANYGREAISKRIYSQLFKWVVNTINCTLTSTSKPHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFTQHVFKLEQDEYVREEIQWSFINF-YDNQPCIDLIEAKLGILDLLDEECKMPKGSDSQWAQKLYKQHLQKSKHFSKPRMSNLAFVIHHFADHVEYFVSGFVEKNRDTVNDEHLALLRASEDEMVGEMF--TENDAHSAPRKRAASRAGKQGGKGGKMFKSVGSQFSVSLSKLMETLNSTTPHYVRCIKPNDTKAPFEFHPKRSIQQLRACGVLETIRISAAGYPSRWTYREFFARYIMLLPSKKINR-KKPRETIKLILETFIKDEDMFQMGKTKIFFRAGQVAYLEKLRGDKLRRSCVMIQKNYRCYREHK 759          
BLAST of Myosin heavy chain vs. Ensembl Nematostella
Match: EDO45563 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSH2])

HSP 1 Score: 440.269 bits (1131), Expect = 3.921e-134
Identity = 275/780 (35.26%), Postives = 427/780 (54.74%), Query Frame = 1
Query:  169 VWIP---DDNEGFISGSLIEEKGDEATVKLENGKTMKLP---IENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWY-KGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNG-MIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEF--KQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRNRQKTNF-----IGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELI-EKPMGILSLLDEECFFPKATTKTFVEKLIKNQSTHPKLKATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQ 2460
            VW+     +N+  I   + E +G    +  + GK + +     E+++ ++P      E+M +L  L+EA +L NL  RY ++ IYTY G   V VNPY   PIY    I  Y K     + PPHIYA  ++++  M ++K NQ ++ +GESGAGKTE+TK ++QYL    T++  + +T                 +E Q+L ANP+LEAFGNAKTI+NDNSSRFGK+I ++F+ S  I  A I+ YLLE++R++ Q  NER +H+FY++L G   + KK L L +   Y  LS G  +     D+   +    +A+  +  +++E + IFR IAAVLH+GNI F  K E + +   + +       A LL +P   M +A  +       E++    + E+A    +A  K  Y ++F W+V +IN SI + R K +      IG+LDI GFE F++NSFEQLCINY NE LQQ F   +F  EQEEY +E I+W F+ F +D Q  ++++ EKPM  ++L+DEE  FP+ T ++F++KL  N   +        R ++ FGV+H+AG V Y +  +L KN +  + ++V L+  S  +F   ++    ++              G +T ++    T+G  ++ SL  LM  L +    FVRC+ PN+ KK  + D +L   QL+ +G+LE +RI + G+  R  F+EF  RY +L  + +    M  R A+ L+   L +   N+++G  +IF K      LEE R   L+  I+  Q
Sbjct:   10 VWLEAGDGENDVAIGACVKEVQGASVILVDDEGKEVVIDRSVAESLKHMHPSSVEGVENMIELGDLDEAGILRNLLIRYRANKIYTYVGSVLVAVNPYCSFPIYGTAYISRYQKAVNATDLPPHIYATGEMSFAMMKREKHNQCVVISGESGAGKTESTKFILQYL----TAVSGRHST-----------------IEEQILDANPILEAFGNAKTIRNDNSSRFGKYIDVHFNDSWVIEGAKIDHYLLEQSRIVAQMPNERNYHIFYRMLAGMSPQEKKSLHLTHAQDYYYLSQGNCLTCEGMDDAYEYDVIRKAMTALWFTEEETQFIFRSIAAVLHLGNISFEAKMEDNIEACDVMNPETVAAAADLLQVPKEHMEEAFTRKSTFAEGEMIYSPVSVERATDIRDAFVKGLYSKVFIWIVNKINSSIYKPRGKDDTSGRQSIGVLDIFGFEKFDMNSFEQLCINYANENLQQFFVAQIFKNEQEEYDREGIEWNFVTF-VDNQEVLDMLAEKPMNFIALIDEESRFPQGTDESFLDKLNYNHKDNKHFVRPKSRVQSQFGVVHFAGTVYYDTTGFLDKNRNTFSADLVDLISSSKCNFFLNMFFKERSM--------------GTETRKRS--PTLGVQFRRSLDVLMKTLASCRSFFVRCVKPNNYKKPMEFDRELCWQQLRYSGMLETVRIRKSGYAMRHTFEEFVTRYHMLVRDSLRD--MSSRDASHLIATSL-LGQENWKLGTKRIFLKESQDVLLEESRAQLLSSKIIFLQ 748          
BLAST of Myosin heavy chain vs. Ensembl Nematostella
Match: EDO49515 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGF6])

HSP 1 Score: 442.965 bits (1138), Expect = 4.552e-132
Identity = 279/771 (36.19%), Postives = 419/771 (54.35%), Query Frame = 1
Query:  325 DMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELIL-ENVSTYKLLSNG-MIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSD---QAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSID-RNRQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEK-PMGILSLLDEECFFPKATTK-TFVEKLIKNQSTHPKLKA-TDFRAKAD-------FGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFK-AGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQN-RSQNLNAIKIIQ--RNCNAYLKLRNWA 2577
            DM  L  L E +++ NL DRY +  IYTY G   V +NPY++ P+YT  VI  Y+ R  +E PPHIYA+ D AYR+M    ++Q I+ TGESG+GKTE +K ++QY+A+V    +                   +  ++ QLLQ+NP+LEAFGNAKT++NDNSSRFGK++ I FD  G      I  YLLEK+R++ Q   ER FH+FY LL GA D L  +L L  +   Y  L+    ++VP  D+K+ F    +A++++G ++DE  +++++++A+L++GN E ++  +SD      + +  V +    +L   V  +  +L +  ++   E V       QA ++ +A++K+ Y+R+F W+V R+N SI  R R K   IG+LDI GFEIF  NSFEQ  INY NEKLQQ+F       EQEEY +E I+W  I++  +     ELIEK   GIL+LLDEEC  P   +  TF+EKL K    H   ++  D +  +D       F + HYAGKV Y  D +L KN D L   +   +   N    + ++ +     G  T +++               +T    +KES+ +LM  L + NPN++RCI PN  K +G  D +L+  Q++  G++E IR+ R GF  R  +    QRY +L P          R     +L  L++  + Y  G++KIF +    L  LEE R   + ++ V  Q   RG+  +K  QN R   +   K  +  R+   Y ++RN A
Sbjct:   25 DMVLLEPLTEDAIMENLWDRYNAKAIYTYIGNVVVSINPYRKFPLYTREVIAEYRSRNIYELPPHIYAIADDAYRSMRDHNKDQCIIITGESGSGKTEASKVIMQYVAAVCGKGR------------------EVDRVKEQLLQSNPILEAFGNAKTLRNDNSSRFGKYMDIEFDFKGDPVGGVITKYLLEKSRLVYQNKGERNFHIFYHLLRGASDNLLDDLRLTRDFDGYHYLNQSECVSVPTKDDKEDFSVVEKAMEVVGFTEDEISAVYKLLSAILNLGNTELEEFTTSDGTEAVTVLNEQVLKNTCEMLQCDVELLLNSLRERTVETKTERVHTPLNVAQASYARDALAKAVYQRLFAWIVDRVNDSIQVRKRGKRKVIGVLDIYGFEIFVDNSFEQFIINYCNEKLQQIFIELTLKSEQEEYVREGIEWTTIEY-FNNAVICELIEKNHSGILALLDEECLRPGEVSDLTFLEKLDKQWIHHEHYESRKDKKYLSDKTLPHGYFRLKHYAGKVTYDVDGFLDKNNDLLFRGLSQCMYSCNHPLTKKLFPE-----GCPTKSSKRRP------------KTTATQFKESVAELMKNLKSKNPNYIRCIKPNERKAAGVFDERLIKHQVRYLGLMENIRVRRAGFAFRQEYPVALQRYKMLCPRTWPNWLGAPRDGIVELLKHLNVKPTEYAYGRTKIFIRNPRTLFALEEKRKDGMEDLAVIIQKIFRGWRRKKQYQNMRRSEITIAKYYRRFRDQRDYRRMRNAA 759          
BLAST of Myosin heavy chain vs. Ensembl Nematostella
Match: EDO36037 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJR5])

HSP 1 Score: 443.736 bits (1140), Expect = 6.377e-131
Identity = 280/845 (33.14%), Postives = 449/845 (53.14%), Query Frame = 1
Query:  169 VWIPDDNEGFISGSLIEEKGDEATVKLEN--GKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLP-IYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKV---AHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRNRQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYR----KENIKWEFIDFGLDLQPTIELIE-KPMGILSLLDEECFFPKATTKTFVEKLIKNQSTH---------PKLKATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDA----ENIIGLSTTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNR-SQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQ 2628
            +W+PD+  G++ GS+++   DE TV+L+   GK +  P +             ED   L +LNE ++L NL+ RY  D IYTY     + VNPY  +  +YT   I  Y G+     PPH++A+ D AYR+M   K++QSI+ +GESGAGKTE+TK +++YL           T +  +  Q        G +E ++++ANP+LE+FGNAKT++N NSSRFGK++ ++F+    +    I  YLLE++R+  Q+  ER +HVFY+L  GA  ++K  L L     +  L+ G ++ P+ D+   FK    ++D +G SK+E+ +I+RV+AAVLH+GNI F+    +       +  + +V   A LLG+   E+ +AL    +  G   V      EQA  + +A++KS Y ++F  +V ++N+        T +IG+LDIAGFE +E+NSFEQ CINY NEKLQQ FN  +     ++YR    + +I  + +   ++ Q    LIE K  GIL +LDEE   PK T+  F   +      H         P +   + R    F + H+AG V Y +  ++ KN D L+ ++  L+ ES +SFV++++  A    + IIG  T      A  G + ++K  F +VG  ++  L +LMD L++T  +F+RCI PN +  +   +   ++ QL+C G++  + + + G+P+R  F E  Q Y    P+ + +  +D R     +   L +   +Y+ G SKIFF+ G  A  +        E + K  S    +L R   +      L+ IK+  +     +K R  A  ++   VK  ++VTR 
Sbjct:    7 LWVPDNEHGYLLGSIVDIGSDEITVQLDGFKGKHVTAPYDRTFPAEKDSNKDVEDNCALMFLNEGTLLNNLRVRYKKDKIYTYVANILLAVNPYHEVKELYTKETIMKYHGKSLGTLPPHVFAIADKAYRDMRAYKQSQSIVVSGESGAGKTESTKYILRYL-----------TESWGSGDQ--------GRIEQRIVEANPLLESFGNAKTMRNINSSRFGKYVEVHFNEKVIVVGGFISHYLLEQSRICMQSKGERNYHVFYRLCAGAPKQIKDMLRLTRAQDFNYLNQGSLSDPNLDDTSDFKRMDASMDNVGFSKEEKSNIYRVVAAVLHLGNIIFEDIDDTHGGCQVSSKCSDEVNITAKLLGVSPEELQQALTTRLMSAGGADVRVPLKLEQAYAARDALAKSIYTKLFDHIVAQVNQCFPFTSSFT-YIGVLDIAGFEYYELNSFEQFCINYCNEKLQQFFNDRIL----KQYRIIPAQPSINQDRVTPAIN-QSGSHLIEAKKTGILDILDEESKLPKPTSAHFTSDIHLKHKNHFRLALPRKSPLMYHRNLRDDEGFLIRHFAGAVCYHTQEFIDKNNDALHNDLAELISESKDSFVKSLFPSASGNGDRIIGGVTM-----AGSGRQGSKKLAFVSVGSKFRTQLQQLMDKLDSTGASFIRCIKPNGKMSANLFEGGSILSQLECAGMVSVLALMQDGWPSRTQFTELYQMYKNFLPSKLAR--LDPRMFCRALFHALGMSDKDYKFGSSKIFFRPGKFAEFDAVMQTD-PENLKKLVSKVTTWLIRTRWRRAIYGTLSVIKLANK-----IKFRTQAIIRIQKTVKMFIAVTRH 813          
BLAST of Myosin heavy chain vs. Ensembl Medaka
Match: myh9b (myosin heavy chain 9 [Source:NCBI gene;Acc:101164562])

HSP 1 Score: 1724.14 bits (4464), Expect = 0.000e+0
Identity = 956/1941 (49.25%), Postives = 1352/1941 (69.65%), Query Frame = 1
Query:   70 MENIDAKDLQYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPM---GILSLLDEECFFPKATTKTFVEKLIKNQSTHPKLKATDFRA-KADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKK-QTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSL-QMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKIDR 5868
            M ++D    ++L VD+++V++    +DWA KKLVW+P +  GF  GS+ EE GDE  V+L ++GK +K+  +++QK+NPPKF K EDMA+LT LNEASVL+NLK+RY+S LIYTYSGLFCVV+NPYK LPIY+  ++E YKG+KRHE PPHIYA+TD AYR+M+QD+E+QSILCTGESGAGKTENTKKVIQYLA VA+S K +K  +S+ LS         GELE QLLQANP+LEAFGNAKTIKNDNSSRFGKFIRINFD +G+I  ANIETYLLEK+R IRQA  ER FH+FY LL GA D+L+KEL+LEN + Y+ LSNG + +P   +K +F +T++A  IM I ++EQ  + +V+A+VL +GN+ FK+ER +DQA++PDNT AQKV+HL+G+ VT+ T+A+L P++K+GR+ V KAQT+EQAEF+VEA++K+TYERMFRWLVMRIN+++D+  RQ  +FIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W FIDFGLDLQP IELIEKP    GIL+LLDEEC+FPKAT K+FVEK+ + Q THPK          ADF + HYAGKVDY +D WL+KNMDPLN+NV +LL +S + FV  +WKD + I+GL   +   S   GA  TRKGMFRTVGQLYKE L+KLM  L NTNPNFVRCIIPNHEKK+GK++  LV+DQL+CNGVLEGIRICRQGFPNRI+FQEF+QRY ILTPN I KGFMDG++A  LM+  L++D + YRIGQSK+FF+AGVLA LEE+RD+K+T+II+ FQ++ RG++ARK    R Q L A+K+IQRNC AYLKLRNW WW+LFT+VKPLL V+RQEE +  K+EEL K KE            ++ ++ L  EK  +QE L+ E     + E  R  L  + +++E    + E+R  E +++ ++L  E+ K+Q  I+ L Q L+ EE   QK Q +K++ + ++K++E++V  L+D+ NKL KEKK +EER+++  + LAEEEEKSK L KLK++HE  IT+LE+RL RE+  RQ+LEK +R+LE + +E  D ++       E+R  L + E ++    A+++EE   K++AQ++IR+ E  ++E++EDLE EK+++ +AEK +RDL EE+E+LK EL DT +T+  QQ +  K+E E+   KK+ EDE K  E ++ E+R+K     + LN Q+E A ++K+ +EKAK  L+ E N+ + E+  L   K +SE  +K  E Q+ E+  + +ESE  + +   KL K Q EL +  ++ L E E K  +++K   SV SQL D+Q+  +EETR KL+  T LRQLE +   LK+QLEEE+ +K N+E  +QA+Q+Q+ ++KKK+++D+  L   +E +KK+ R+ E    R +E     ++ +K K  +Q EL D     +  +   +  ++K KK +  + E   ++ +Y  E+D  E E REKET+ + L RE+ +  D   EL+     L  ++ +L+SSKDDVGKNV  LEKAK  +E  LE  K  +EELE+E    +  K R+E+ + A KAQ +R+LA +DEM +E+ R + K++R+ E  LE+E+K ++A ++ +KK+E +  +L + +  + K +++  +Q+KK QG   +L RE+ E   ++ + L   KE EK+L+  E+ + Q+ E+L+ +ER KR    ERDE  +EI         A  +++R+E+ I+ L  + EE Q     + D+ KK + Q +QV  EL  ER N  R+E  ++  ER NKEL  K+++LE     KYKA +AA ++K+  L+ QL+ + +E   A +  ++ E+KLKE++  + DE + A+   +Q +K   R K+ +R L + E E   A +TQ R+LQR+L++  E+ E+ ++E+  LK K+ R
Sbjct:    1 MSDVD----KFLYVDRNMVNNPLAQADWATKKLVWVPSERLGFEPGSVKEEHGDECVVELADSGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVVINPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKTKKDQSSSILSH--------GELEKQLLQANPILEAFGNAKTIKNDNSSRFGKFIRINFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLTGAGDKLRKELLLENYNNYRFLSNGNVTIPGQQDKDLFNETMDAFKIMSIPEEEQIGMLKVVASVLQLGNMSFKKERHTDQASMPDNTAAQKVSHLMGMNVTDFTRAILSPRIKVGRDYVQKAQTQEQAEFAVEALAKATYERMFRWLVMRINKALDKTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWSFIDFGLDLQPCIELIEKPASPPGILALLDEECWFPKATDKSFVEKVFQEQGTHPKFFKPKKLKDDADFSIFHYAGKVDYKADEWLMKNMDPLNDNVTTLLNQSTDKFVSELWKDVDRIVGLDKVSGM-SEMPGAFKTRKGMFRTVGQLYKEQLSKLMATLRNTNPNFVRCIIPNHEKKAGKLEPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACVLMIKSLELDPNLYRIGQSKVFFRAGVLAHLEEERDMKITDIIISFQAWCRGHVARKAFAKRQQQLTAMKVIQRNCAAYLKLRNWQWWRLFTKVKPLLQVSRQEEEMQAKDEELNKIKEKQLYAEEQLLEMEQKHQQLNAEKMALQEQLQAETELCAEAEEMRARLAAKKQELEEILHDLEARVEEEEERASQLATERKKMQQNITDLEQQLDEEEAARQKLQLEKVTLEAKMKKIEEEVMVLDDQNNKLLKEKKLMEERISEFTTNLAEEEEKSKSLQKLKTKHEAMITDLEDRLRREEKQRQELEKNRRKLEGDFTETHDQIAELQAQIAELRAQLAKKEEELQAALARIEEEAAQKNMAQKKIRELEAQLSELQEDLELEKQARAKAEKHRRDLGEELEALKTELEDTLDTTAAQQELRTKRETEVAQLKKTLEDEAKVHEQQLAELRQKHGQAFDELNEQLEQAKRNKVSMEKAKQALESEKNELSIEVQTLMQGKGESEHRRKKAEAQVQELQLKFTESERQRTEMTDKLTKVQAELENVNSL-LSEAEGKSIKVSKDYFSVESQLQDVQELLQEETRQKLSLNTRLRQLEEEQNNLKEQLEEEEGAKRNVEKQLQAVQAQLTEMKKKIDQDSGCLESAEEGKKKLQRDLEATVQRFDEKCAAYDKLDKTKTRLQQELDDLLVDQDHLRQIVSNLEKKQKKFDQMLAEEKTISARYAEERDRAEAEAREKETRALALTRELESLMDAKEELDRTNKALRAEMEDLMSSKDDVGKNVHELEKAKRTMEQQLEEMKTQLEELEDELQATEDAKLRLEVNMQAMKAQHERDLAGRDEMGEEKKRALIKQVREMEMELEDERKQRSAALAARKKLELDLKELESGIDMANKSRDDALKQLKKIQGQMKDLVRELDETRMSREEILALSKETEKKLKAMEAEMIQIQEELASAERLKRQAQQERDELQDEINNQGGKSALAAEERRRLEARIAQLEEELEEEQCNTELMNDRMKKAMLQTDQVNLELTAERSNSQRVEGARAQLERQNKELKLKLQDLEGTVKSKYKANMAALEAKVAQLEEQLEMESKERQAATKLVRRTEKKLKEVILQVDDERRSAEQHKDQSDKLNMRMKQLKRQLEEAEDEAQRAKATQ-RKLQRELDDATESAESMNREVTSLKNKLRR 1926          
BLAST of Myosin heavy chain vs. Ensembl Medaka
Match: myh9b (myosin heavy chain 9 [Source:NCBI gene;Acc:101164562])

HSP 1 Score: 1715.28 bits (4441), Expect = 0.000e+0
Identity = 953/1941 (49.10%), Postives = 1348/1941 (69.45%), Query Frame = 1
Query:   70 MENIDAKDLQYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPM---GILSLLDEECFFPKATTKTFVEKLIKNQSTHPKLKATDFRA-KADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKK-QTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSL-QMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKIDR 5868
            M ++D    ++L VD+++V++    +DWA KKLVW+P +  GF  GS+ EE GDE  V+L ++GK +K+  +++QK+NPPKF K EDMA+LT LNEASVL+NLK+RY+S LIYTYSGLFCVV+NPYK LPIY+  ++E YKG+KRHE PPHIYA+TD AYR+M+QD+E+QSILCTGESGAGKTENTKKVIQYLA VA+S K +K               + GELE QLLQANP+LEAFGNAKTIKNDNSSRFGKFIRINFD +G+I  ANIETYLLEK+R IRQA  ER FH+FY LL GA D+L+KEL+LEN + Y+ LSNG + +P   +K +F +T++A  IM I ++EQ  + +V+A+VL +GN+ FK+ER +DQA++PDNT AQKV+HL+G+ VT+ T+A+L P++K+GR+ V KAQT+EQAEF+VEA++K+TYERMFRWLVMRIN+++D+  RQ  +FIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W FIDFGLDLQP IELIEKP    GIL+LLDEEC+FPKAT K+FVEK+ + Q THPK          ADF + HYAGKVDY +D WL+KNMDPLN+NV +LL +S + FV  +WKD + I+GL   +   S   GA  TRKGMFRTVGQLYKE L+KLM  L NTNPNFVRCIIPNHEKK+GK++  LV+DQL+CNGVLEGIRICRQGFPNRI+FQEF+QRY ILTPN I KGFMDG++A  LM+  L++D + YRIGQSK+FF+AGVLA LEE+RD+K+T+II+ FQ++ RG++ARK    R Q L A+K+IQRNC AYLKLRNW WW+LFT+VKPLL V+RQEE +  K+EEL K KE            ++ ++ L  EK  +QE L+ E     + E  R  L  + +++E    + E+R  E +++ ++L  E+ K+Q  I+ L Q L+ EE   QK Q +K++ + ++K++E++V  L+D+ NKL KEKK +EER+++  + LAEEEEKSK L KLK++HE  IT+LE+RL RE+  RQ+LEK +R+LE + +E  D ++       E+R  L + E ++    A+++EE   K++AQ++IR+ E  ++E++EDLE EK+++ +AEK +RDL EE+E+LK EL DT +T+  QQ +  K+E E+   KK+ EDE K  E ++ E+R+K     + LN Q+E A ++K+ +EKAK  L+ E N+ + E+  L   K +SE  +K  E Q+ E+  + +ESE  + +   KL K Q EL +  ++ L E E K  +++K   SV SQL D+Q+  +EETR KL+  T LRQLE +   LK+QLEEE+ +K N+E  +QA+Q+Q+ ++KKK+++D+  L   +E +KK+ R+ E    R +E     ++ +K K  +Q EL D     +  +   +  ++K KK +  + E   ++ +Y  E+D  E E REKET+ + L RE+ +  D   EL+     L  ++ +L+SSKDDVGKNV  LEKAK  +E  LE  K  +EELE+E    +  K R+E+ + A KAQ +R+LA +DEM +E+ R + K++R+ E  LE+E+K ++A ++ +KK+E +  +L + +  + K +++  +Q+KK QG   +L RE+ E   ++ + L   KE EK+L+  E+ + Q+ E+L+ +ER KR    ERDE  +EI         A  +++R+E+ I+ L  + EE Q     + D+ KK + Q +QV  EL  ER N  R+E  ++  ER NKEL  K+++LE     KYKA +AA ++K+  L+ QL+ + +E   A +  ++ E+KLKE++  + DE + A+   +Q +K   R K+ +R L + E E   A +TQ R+LQR+L++  E+ E+ ++E+  LK K+ R
Sbjct:    1 MSDVD----KFLYVDRNMVNNPLAQADWATKKLVWVPSERLGFEPGSVKEEHGDECVVELADSGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVVINPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKTKK---------------DQGELEKQLLQANPILEAFGNAKTIKNDNSSRFGKFIRINFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLTGAGDKLRKELLLENYNNYRFLSNGNVTIPGQQDKDLFNETMDAFKIMSIPEEEQIGMLKVVASVLQLGNMSFKKERHTDQASMPDNTAAQKVSHLMGMNVTDFTRAILSPRIKVGRDYVQKAQTQEQAEFAVEALAKATYERMFRWLVMRINKALDKTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWSFIDFGLDLQPCIELIEKPASPPGILALLDEECWFPKATDKSFVEKVFQEQGTHPKFFKPKKLKDDADFSIFHYAGKVDYKADEWLMKNMDPLNDNVTTLLNQSTDKFVSELWKDVDRIVGLDKVSGM-SEMPGAFKTRKGMFRTVGQLYKEQLSKLMATLRNTNPNFVRCIIPNHEKKAGKLEPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACVLMIKSLELDPNLYRIGQSKVFFRAGVLAHLEEERDMKITDIIISFQAWCRGHVARKAFAKRQQQLTAMKVIQRNCAAYLKLRNWQWWRLFTKVKPLLQVSRQEEEMQAKDEELNKIKEKQLYAEEQLLEMEQKHQQLNAEKMALQEQLQAETELCAEAEEMRARLAAKKQELEEILHDLEARVEEEEERASQLATERKKMQQNITDLEQQLDEEEAARQKLQLEKVTLEAKMKKIEEEVMVLDDQNNKLLKEKKLMEERISEFTTNLAEEEEKSKSLQKLKTKHEAMITDLEDRLRREEKQRQELEKNRRKLEGDFTETHDQIAELQAQIAELRAQLAKKEEELQAALARIEEEAAQKNMAQKKIRELEAQLSELQEDLELEKQARAKAEKHRRDLGEELEALKTELEDTLDTTAAQQELRTKRETEVAQLKKTLEDEAKVHEQQLAELRQKHGQAFDELNEQLEQAKRNKVSMEKAKQALESEKNELSIEVQTLMQGKGESEHRRKKAEAQVQELQLKFTESERQRTEMTDKLTKVQAELENVNSL-LSEAEGKSIKVSKDYFSVESQLQDVQELLQEETRQKLSLNTRLRQLEEEQNNLKEQLEEEEGAKRNVEKQLQAVQAQLTEMKKKIDQDSGCLESAEEGKKKLQRDLEATVQRFDEKCAAYDKLDKTKTRLQQELDDLLVDQDHLRQIVSNLEKKQKKFDQMLAEEKTISARYAEERDRAEAEAREKETRALALTRELESLMDAKEELDRTNKALRAEMEDLMSSKDDVGKNVHELEKAKRTMEQQLEEMKTQLEELEDELQATEDAKLRLEVNMQAMKAQHERDLAGRDEMGEEKKRALIKQVREMEMELEDERKQRSAALAARKKLELDLKELESGIDMANKSRDDALKQLKKIQGQMKDLVRELDETRMSREEILALSKETEKKLKAMEAEMIQIQEELASAERLKRQAQQERDELQDEINNQGGKSALAAEERRRLEARIAQLEEELEEEQCNTELMNDRMKKAMLQTDQVNLELTAERSNSQRVEGARAQLERQNKELKLKLQDLEGTVKSKYKANMAALEAKVAQLEEQLEMESKERQAATKLVRRTEKKLKEVILQVDDERRSAEQHKDQSDKLNMRMKQLKRQLEEAEDEAQRAKATQ-RKLQRELDDATESAESMNREVTSLKNKLRR 1919          
BLAST of Myosin heavy chain vs. Ensembl Medaka
Match: myh11a (myosin heavy chain 11 [Source:NCBI gene;Acc:101164959])

HSP 1 Score: 1575.07 bits (4077), Expect = 0.000e+0
Identity = 905/1935 (46.77%), Postives = 1310/1935 (67.70%), Query Frame = 1
Query:   85 AKDLQYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKP---MGILSLLDEECFFPKATTKTFVEKLIKNQSTHPKL-KATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQ-ESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKIDR 5868
            ++D ++L VDK  ++     +DWA KKLVWIP +  GF + S+ EE G+E  V+L +NGK + +  +++QK+NPPKF K EDMA+LT LNEASVL+N+++RYFS LIYTYSGLFCVVVNPYK LPIY++ +IE YKG+KRHE PPHIY++TD AYRNM+QD+E+QSILCTGESGAGKTENTKKVIQYLA VA+S K +K ++              GELE QLLQANP+LEAFGNAKTIKNDNSSRFGKFIRINFD +G+I   + E                                   EL+LE  S Y+ LS G + +P   + +MF++T+EA+ IMG++ +E+  I +V + V+ +GNI FK+ER+ +QA +PDNT AQKV HL G+ VT+ T+A+L P++K+GREVV KAQTKEQA+F++EA++K+ YERMFRW++ R+N+++D+  RQ  +F+GILDIAGFEIFE NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W FIDFGLDLQP IELIE+P    GIL+LLDEEC+FPKAT  +FVEKL+  Q  H K  K    + K +F ++HYAGKVDY +  WL KNMDPLN+NV +LL  S+  FVQ +WKDA+ ++GL T     +++   A  T+KGMFRTVGQLYKESL KLM  L+NT PNFVRCIIPNHEK++GK+D+ LV++QL+CNGVLEGIRICRQGFPNRI+FQEF+QRY IL  + I KGFMDG++A  LM+  LD+D + YRIGQSKIFF+ GVLA+LEE+RD+K+T II+ FQ+ ARG+LARK    R Q L A+K+IQRNC AYLKLRNW WW+LFT+VKPLL VTRQEE ++LKEEEL+K+K+   K  ++ +     +  ++EE+N +QE L+ E     + E  R  L  + +++E    E E+R  E +++   L ++K K+Q ++ +L ++LE EE   QK Q +K++ + +IK+LE  +  +ED+ NKL KE+K +EER+AD  ++LAEEEEKSK LTKLK++HE+ I+ELE RL +E+ +RQ+L+K KR+LE E ++  + L+       E++  L + E ++    A+L++ET  K+ A ++IR+ E  I++++EDL++E+ ++ +AEK KRDL EE+E+LK EL DT +T+  QQ +  K+E E+   K++ E+E +  E ++QE+R+K    +E L  Q+E + + K  +EKAK  L++E ++   E+ +L  ++ + E  +K  E Q++++  R+++SE+ K +  +    Q EL + +   L E ESK  +L+K   S+ SQL D Q+   EETR KL   T LRQ E     L +QLEEE ++K N+E HV  L  Q+ D KKK+EE +  +   +E +K++ R+ E    + EE  +  ++ EK K  +Q EL+D    L++Q+   +  ++K KK +  + E  +++ KY  E+D  E E REKETK + L R +    D   ELE A   L  ++ +L+SSKDDVGKNV  LEK+K  LE  +E  K  +EELE+E    +  K R+E+ + A KAQ +R+L  +DEM +E+ R + K++R+ E  LE+E+K K    + KKK+E +  DL  Q+    K ++E  +Q++K Q    + QRE+++  AA+ + L   KE EK+ ++ E+ + QL E+L+ +ERAK+   +ERDE  +E+A+    +     +K+R+E+ I+ L  + EE Q  +  L D+ +K   Q++Q+ NEL  ER    + E+ +   ER NKEL  K+ E+E +   K+K+++ A ++K+  L+ QL+ +  +     ++ ++ ++KLK++M  + DE K+A+   +Q EKAT R K+ +R L+  +E +   +   R+LQR+L+E  E  +A  +E+  LK+K+ R
Sbjct:    7 SEDEKFLFVDKDFLNSPMAQADWAAKKLVWIPSEKHGFEAASIKEEHGEEVLVELADNGKKVTVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNIRERYFSGLIYTYSGLFCVVVNPYKMLPIYSDKIIEMYKGKKRHEVPPHIYSITDNAYRNMMQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKKDSS--------------GELEKQLLQANPILEAFGNAKTIKNDNSSRFGKFIRINFDVTGYIVGKSNE-----------------------------------ELLLEPFSNYRFLSAGHVQIPGQQDDEMFEETMEAMQIMGLTDEERIDILKVCSTVMQLGNIAFKKERNQEQATMPDNTAAQKVCHLQGINVTDFTRAILTPRIKVGREVVQKAQTKEQADFAIEALAKAVYERMFRWILGRVNKALDKTKRQGASFLGILDIAGFEIFEDNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPNNPPGILALLDEECWFPKATDVSFVEKLMNTQGNHMKFAKPKQLKDKTEFSILHYAGKVDYNATAWLTKNMDPLNDNVTALLSNSSSQFVQDLWKDADRVVGLDTIAKMTDTSMPSASKTKKGMFRTVGQLYKESLAKLMTTLHNTQPNFVRCIIPNHEKRAGKLDANLVLEQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILAASAIPKGFMDGKQACCLMIKHLDLDPNLYRIGQSKIFFRTGVLAQLEEERDLKITVIIIAFQAQARGFLARKAFAKRQQQLTAMKVIQRNCAAYLKLRNWQWWRLFTKVKPLLQVTRQEEEMSLKEEELQKAKDVATKFESELKEITLKHTQIVEERNALQEQLQAETELYAEAEEMRVRLAAKKQELEEILHEMEARLDEEEERAQTLLLDKKKMQQQMQELEEHLEEEEDARQKLQLEKVACEGKIKKLEDDILVMEDQNNKLVKERKLMEERIADFSASLAEEEEKSKNLTKLKNKHESMISELEVRLKKEEKSRQELDKAKRKLEAESNDLQEQLADLQAQIAELKAQLAKKEEELQNALARLEDETAQKNNALKKIRELEGHISDLQEDLDSERVARNKAEKIKRDLGEELEALKSELEDTLDTTATQQELRAKREQEVTLLKRAIEEENRTHEAQIQEMRQKHTQAVEELTEQLEQSKRVKTNLEKAKQALEKETSELTMEVRSLAQARQEGEHKRKKLEGQVADLQSRINDSEKQKAELPNVDSAQVEL-EGVTNLLNEAESKNIKLSKDVSSLSSQLQDSQELLAEETRQKLQLSTKLRQAEDDRNSLTEQLEEEMEAKRNMERHVSTLNVQLSDSKKKLEEMSGNIELLEEGKKRLQRDLEAANTQFEEKASAFDKLEKTKNRLQQELEDTLMDLDNQRQIVSNLEKKQKKFDQMLAEEKSISSKYAEERDRAEAEAREKETKALSLARALEEAQDSREELERANKALRMEMEDLISSKDDVGKNVHELEKSKRGLEAQVEEMKTQLEELEDELQAAEDAKLRLEVNMQALKAQFERDLQGRDEMGEEKKRQLIKQVRELETELEDERKQKALAAAAKKKLETDMKDLEGQIETVNKGRDEAIKQLRKLQAQMKDYQRELEDARAAREEVLGTAKESEKKAKSLEAELIQLQEELAAAERAKKQAEAERDELSDELASNASGKSALADEKRRLEAKIAQLEEELEEEQSNMEILNDRLRKSAQQVDQLSNELQTERSTAQKNESARQQMERQNKELKAKLLEMENQVKSKFKSSITALEAKVAQLEEQLEQENRDKQATGKSLRQKDKKLKDLMMQVEDERKQAEQYKDQAEKATSRMKQLKRQLEESEEESQRATAARRKLQRELDEATEANDAMSREVTSLKSKLRR 1891          
BLAST of Myosin heavy chain vs. Ensembl Medaka
Match: myh14 (myosin-10 [Source:NCBI gene;Acc:101160019])

HSP 1 Score: 1538.47 bits (3982), Expect = 0.000e+0
Identity = 885/1922 (46.05%), Postives = 1321/1922 (68.73%), Query Frame = 1
Query:  133 SANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKLENG-KTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDR-NRQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPM---GILSLLDEECFFPKATTKTFVEKLIKNQSTHPKL-KATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESA----FGGAK-TTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKK-QTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKI 5862
             A+ +DWA K+LVW+P +  GF S S+ EE+GDE  V+L +  + + L  E VQ++NPP+F K EDMADLT LNEASVL+NL++RY+S LIYTYSGLFCVVVNPYK L IYT +++E Y+G+KRHE PPHIYA+++ AYR+MLQD+E+QSILCTGESGAGKTENTKKVIQYLA VA+S K+       ++SQ        GELE QLLQANP+LEAFGNAKT+KNDNSSRFGKFIRINFD +G+I  ANIETYLLEK+R IRQA +ER FH+FYQ+L GA +  + EL+L N   Y+ L+ G I VP   + + F  T++++ IMG + +E  S+ +VI+AVL  GNI F +E++ DQA++PDNT AQK+ HLLG+ V E T+A+L P++K+GRE V KAQTKEQA+F++EA++K+TYER+FRWLV RINR++DR  RQ  +FIGILDIAGFEIF++NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I W FIDFGLDLQP I+LIE+P    G+L+LLDEEC+FP+AT +TFVEKL   Q +HPK  ++   R +ADF +IHYAGKVDY + +WLVKNMDPLN+NV SLL +S++ FV  +WK+ + I+GL   ++ ES+    FG A   T+KGMFRTVGQLYKESLTKLM  L NTNPNF+RCIIPNHEK++GK+   LV+DQL+CNGVLEGIRICRQGFPNRI FQEF+QRY ILTPN I + FMDG++A+ELM+  L++D + +R+GQSK+FF+AGVL  LEE+RD+K+T+ I++FQS ARG+LARK    + Q L+A++++QRNC+AYLKLRNW WW+LFT+VKPLL VTRQ+E + ++E EL+K+K+ L +   D+    K +  L+EEK  + + L+ E     + E  R  L  R +++E    E ESR  E +++  +L  EK ++Q  I  L + LE EE   Q+   +K++ + ++K L+  +    ++ ++L+KEKK LEE L++V   L EEEEK+K LTKLK++ E  I +LEERL RE+  R + EK KRR+E+E  E  + LS       E+R TL + E +I  +Q +L+EE   ++ AQR +R+A + ++E+KE++E E+  +ERAEK KRDL EE+E+L+ EL DT +T+  QQ +  ++E EL   ++  E+ET+R E+++ E++ K +  ++NL  Q++ + ++K ++E+ +       N+  +E+ +L++ + +SE+ +K  E Q+ E+S RL++++  + D E ++ K QTE+ + L+ NL   +SK  +L K   ++ SQL D ++  ++ETR K+   +  R LE +   L ++LEE+++  + +   +Q L  Q+ +++K+ EE    +   +E+R+K+ RE +    +  +   + ER E+ +  ++ E++D   AL+ ++ +    +++ KK +  ++E   ++ +   E+D  E ++REKET+ + L R +    D+  +LE     L  ++ +LV+ +DDVGKNV  LE+ +  LE + +N +V  +ELEEE A  + ++ R+E+ L A KAQ +RE+++ +E  +E+ R ++K+L   E  LEEE+  ++  V  KK++E E  +    +  S + K+E  +Q+++ QG    + RE+ +   A+ + + Q K+ EK+++T E+++  L+E+LS SER +R    ERD+  +E+   +  ++    +K+R+E+ +S L  + EE Q     L ++ +K   Q+E +  +L  ER    + E+ +   ER NKEL  ++ ELE     K+K +VAA ++KI+S++ QL+ + +E   A +  +K E+KLKE+M    DE + AD   EQ++K+  R K+ +R L+  +E +S  + Q R+LQR+LEE+ ++ +   +EI  L+T++
Sbjct:   34 GASQADWAAKRLVWVPSEKHGFESASIREERGDEVEVELTDSQRKLTLSREEVQRMNPPRFSKVEDMADLTCLNEASVLHNLRERYYSGLIYTYSGLFCVVVNPYKNLTIYTESIVEMYRGKKRHEMPPHIYAISEAAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKSGSLAGVCSVSQ--------GELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVAGYIVGANIETYLLEKSRAIRQAKDERTFHIFYQMLCGATEETRAELLLGNADEYRFLTGGSIPVPGQSDSENFTQTMDSMAIMGFTAEESISMLKVISAVLQFGNISFNKEKNHDQASMPDNTAAQKLCHLLGINVLEFTRAILTPRIKVGREYVQKAQTKEQADFAIEALAKATYERLFRWLVHRINRALDRRQRQGASFIGILDIAGFEIFQLNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIDWNFIDFGLDLQPCIDLIERPTHPPGVLALLDEECWFPRATDRTFVEKLSAEQGSHPKFFRSKQPRGEADFSIIHYAGKVDYKAVDWLVKNMDPLNDNVASLLHQSSDHFVSELWKEGK-IVGLDQVSSGESSGPVTFGAAGLKTKKGMFRTVGQLYKESLTKLMATLRNTNPNFLRCIIPNHEKRAGKLAPHLVLDQLRCNGVLEGIRICRQGFPNRIPFQEFRQRYEILTPNAIPRTFMDGKQASELMISALELDHNLFRVGQSKVFFRAGVLGHLEEERDLKITDTIIRFQSAARGFLARKAFFKKQQQLSALRVMQRNCHAYLKLRNWQWWRLFTKVKPLLQVTRQDEEIQVREAELQKAKDKLTRAEQDYSELDKKHAQLLEEKAVLADQLQAEAELFAEAEELRARLASRKQELEEVLSELESRLEEEEERGVQLANEKKRMQQNIQDLEEQLEEEETARQRLLLEKVTLETKVKSLDTDLLTAVEQRDRLSKEKKMLEEHLSEVSDQLTEEEEKTKSLTKLKNKQEAVIADLEERLKREEQGRLEQEKWKRRMESESLEAQEQLSELGMLSAELRGTLAQKEKEITTLQGRLEEEGARRAEAQRALREALSQVSELKEEVENERGMRERAEKQKRDLGEELEALRTELEDTLDTTAAQQELRSRREAELGELQRCVEEETRRHEVQVSELKVKHSTALDNLQEQLDNSKRAKAMLEEER-------NNLTSEIKSLQAGRTESERARKRAESQVQELSARLAQADRDREDREERIHKLQTEI-ESLSGNLSSSDSKSLRLAKEVSNLESQLHDAKELLQDETRQKMALASRARALEDEKNGLMEKLEEDEERAKEMTRQIQTLSQQLAELRKQSEEVNTAVEAGEETRRKLQRELDSAIQKERQREEEKERVERQRERLREEIEDMTIALQRERQNCIALEKRQKKFDQCLSEEKAVSARLAEERDKAEADSREKETRCLALSRSLQEVQDQRDDLERVNKQLRLEMEQLVNQQDDVGKNVHELERTRRALEAEAQNLRVQTQELEEELAEAENSRLRLEVTLQALKAQFEREISTSEEKGEEKRRALSKQL---EIQLEEERTQRSQAVLSKKQLEAELQEAEAHVEASSRSKDEAMKQLRRLQGQMKEVLRELDDSKLAREEVVAQSKDSEKKIQTLEADMLHLTEELSVSERQRRQAQQERDDLADEMVNSSSGKNALFEEKRRLEARVSQLEEELEEEQSNYELLSERQRKTALQVETLTVQLQGERTLTQKAESARELLERQNKELKTRLGELEGAVRGKHKLSVAALEAKIESMEEQLEQERQERAIATKIVRKTEKKLKEVMMQAEDERRHADQYREQLDKSMVRLKQLKRQLEEVEEEHSRSNAQKRKLQRELEELTDSSQIMTREITSLRTQL 1935          
BLAST of Myosin heavy chain vs. Ensembl Medaka
Match: ENSORLT00000000809.2 (myosin-10 [Source:NCBI gene;Acc:101154782])

HSP 1 Score: 1222.61 bits (3162), Expect = 0.000e+0
Identity = 734/1602 (45.82%), Postives = 1081/1602 (67.48%), Query Frame = 1
Query: 1084 VEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKP---MGILSLLDEECFFPKATTKTFVEKLIKNQSTHPKL-KATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQ-ESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLD-AESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKIDR 5868
            ++A+ IMG S DE   + RV++AVL  GN+ FK+ER++DQA++P+NT AQK+ HLLG+ + E T+A+L P++K+GR+ V KAQTKEQA+F+ EA++K+TYER+FRWLV RIN+++DR  RQ  +FIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++E I+W FIDFGLDLQP I+LIE+P    GIL+LLDEEC+FPKAT KTFV+K+++ Q TH K  K    + KADF +IHYAG+VDY +D WL+KNMDPLN+NV +LL +S + FV  +WKD + I+GL       E+AFG A  T+KGMFRTVGQLYKE L+KLM  L NTNPNFVRCIIPNHEK++GK+D  LV+DQL+CNGVLEGIRICRQGFPNRI+FQEF+QRY ILTPN I KGFMDG++A E M+  L++D + +RIGQSKIFF+AGVLA LEE+RD+K+T+II+ FQ+  RGYLARK    + Q L+A+K++QRNC AYLKLR+W WW+LFT+VKPLL VTRQEE +  K+EEL K KE   K+  +    ++ ++ L+EEKN + E L+ E     + E  R  L  + +++E    + ESR  E +++   L+ EK K+Q+ +  L + L+ EE   QK Q +K++A+ +IK+ E+ +  LED+ +K  KEKK +E+R+ ++   LAEEEEK+K L K+K++ E  + +LEERL +E+  RQ+LEK KR+L+ E S+  D +S      EE+++ L + E +   MQ++ +EE   K+   +Q+R+ +  ++E++EDLE+E++++ +AEK KRDL+EE+E+LK EL DT +T+  QQ +  K+E E+   KK+ E+E+K  E ++QE+R++    +E L+ Q+E A + K  +EKAK        + +NE+  L+ +K +SE  +K  E QL E   R++E E  K +  E   K QTEL D ++  LE+ E K  +L K    + SQL D Q+  +EETR KLN  + +RQLE +   L++Q EE++++++NLE  + +LQ+Q+ + KKK+E+D   +   +E++KK+ ++ E    RLEE     E+ EK K  +Q EL D    L+ Q+   +  ++K KK +  + E  +++ +Y  E+D  E E REKETK + + R ++   +   ELE     L  ++ +L+SSKDDVGKNV  LEK+K  LE  LE  K  +EELE+E    +  K R+E+ + A KAQ +R+L  +D+ +DE+ R + K++R+ EA LE+E+K K   V+ KKK+E +  D+   +  + K ++E  +Q++K Q    + QRE+++  A+++D     KE EK+L++ E+ + QL EDL+ SER +R    ERDE  +EI+  T  +   + +K+R+E+ I+ L  + EE Q  +  L D+ +K   Q++ +  EL+ ER    + EN +  AER NKEL  K+ ELE     ++KA++ A ++KI  L+ QL+ +  E   AN+  ++ E+KLKE+   + DE + AD   EQ+EKA  R K+ +R L+  +E  +  +   R+LQR+L++  E  E   +E+  LK ++ R
Sbjct:    1 MDAMHIMGFSHDEIVCMLRVVSAVLQFGNVVFKKERNTDQASMPENTAAQKLCHLLGMNIMEFTRAILTPRIKVGRDYVQKAQTKEQADFAAEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWSFIDFGLDLQPCIDLIERPNNPPGILALLDEECWFPKATDKTFVDKVLQEQGTHAKFQKPRQLKDKADFCIIHYAGRVDYKADEWLMKNMDPLNDNVATLLHQSTDKFVAELWKDVDRIVGLDQVAGMNETAFGAAYKTKKGMFRTVGQLYKEQLSKLMATLRNTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERMIQALELDGNLFRIGQSKIFFRAGVLAHLEEERDLKITDIIIYFQAVCRGYLARKAFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRLFTKVKPLLQVTRQEEEMQAKDEELVKVKEKQMKVEGELVEMERKHQQLLEEKNILAEQLQAETELFAEAEEMRARLASKKQELEEILHDLESRLEEEEERTQGLQNEKKKMQSHVQDLEEQLDEEEAARQKLQLEKVTAEAKIKKYEEDILLLEDQNSKFQKEKKLMEDRINEMTVMLAEEEEKAKNLGKVKNKQEMMMVDLEERLKKEEKTRQELEKAKRKLDGETSDFQDQISELQSQIEELKVQLAKKEEEQQMMQSRCEEEANQKNNVLKQVRELQAQLSELQEDLESERQARNKAEKLKRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKAIEEESKNHEAQIQEMRQRHGTALEELSEQLEQAKRFKANLEKAKQSQDSANKELSNEVKTLQQAKTESEHKRKKLEAQLQEFMARVTEGERAKGELGERSNKLQTEL-DNVSSLLEDAERKGIKLAKDVSGLESQLQDAQELLQEETRQKLNLSSRIRQLEEEKNALQEQQEEDEEARKNLEKQLLSLQAQLSESKKKLEDDVGTIEGLEETKKKLQKDLELANQRLEEKTIAFEKMEKTKTRLQQELDDLTVDLDHQRQIVSNLEKKQKKFDQMLAEEKSISARYAEERDRAEAEAREKETKALSMTRALDEALEAKEELERINKQLRAEMEDLMSSKDDVGKNVHELEKSKRTLEQQLEEMKTQLEELEDELQATEDAKLRLEVNMQAMKAQYERDLQGRDDQNDEKKRALVKQVREMEAELEDERKQKALAVAAKKKLEMDLKDIEGHIEGANKARDEAIKQLRKLQAQMKDYQRELEDTRASRDDIFALSKETEKKLKSLEAEIVQLQEDLAASERGRRHAEQERDELQDEISNSTSGKAALMDEKRRLEARIAQLEEELEEEQGNMELLNDRLRKTTMQVDALSAELSAERSAAQKSENARQQAERQNKELRAKLGELEGSVKNRFKASITALEAKIAQLEEQLEQEARERAAANKIVRRTEKKLKEVCMQVEDERRHADQFKEQLEKANSRMKQLKRQLEEAEEEATRANASRRKLQRELDDATEASEGLSREVHTLKNRLRR 1601          
BLAST of Myosin heavy chain vs. Planmine SMEST
Match: SMESG000062420.1 (SMESG000062420.1)

HSP 1 Score: 3719.47 bits (9644), Expect = 0.000e+0
Identity = 1970/1973 (99.85%), Postives = 1971/1973 (99.90%), Query Frame = 1
Query:   70 MENIDAKDLQYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKLENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRNRQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPMGILSLLDEECFFPKATTKTFVEKLIKNQSTHPKLKATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKIDRLEKRTRAXXXXXXXXXXXXXXXXXXXESVTDSALKSVQED 5988
            MENIDAKDLQYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKLENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRNRQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPMGILSLLDEECFFPKATTKTFVEKLIKNQSTHPKLKATDFRAKADFGVIHYAGKVDYV+DNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQEEVVALKEEELKKSKETLEKMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLEAEKRSKERAEKAKRDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKLQLQEELNDANNELANLRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMREREELQIRLEEAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFR INKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLR SESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNEELQLLLSELEDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQANRNNKKLERKLKEIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKIDRLEKRTRAGGRPLRGDGGSDDGLSGDGESVTDSALKSVQED
Sbjct:    1 MENIDAKDLQYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKLENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRNRQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPMGILSLLDEECFFPKATTKTFVEKLIKNQSTHPKLKATDFRAKADFGVIHYAGKVDYVADNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQEEVVALKEEELKKSKETLEKMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLEAEKRSKERAEKAKRDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKLQLQEELNDANNELANLRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMREREELQIRLEEAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRNINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRASESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNEELQLLLSELEDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQANRNNKKLERKLKEIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKIDRLEKRTRAGGRPLRGDGGSDDGLSGDGESVTDSALKSVQED 1973          
BLAST of Myosin heavy chain vs. Planmine SMEST
Match: SMESG000049494.1 (SMESG000049494.1)

HSP 1 Score: 1924.83 bits (4985), Expect = 0.000e+0
Identity = 1036/1924 (53.85%), Postives = 1446/1924 (75.16%), Query Frame = 1
Query:   97 QYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPMGILSLLDEECFFPKATTKTFVEKLIKNQSTHPKLKATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIE-QIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTK 5859
            +YLQ+DK+L++DS   SDWA+KKL+WIPDD  G++   +++E  +E TV++ E GK   +  +++QK+NPPKF KSEDMA+LTYLNEASVL N+K+RYFS LIYTYSGLFCVV+NPYKRLPIY + +IEWYKGRKRHERPPHIYA+ D AYRNMLQD+E+QSILCTGESGAGKTENTKKVIQYLASVA S+KNQK +ASNA++QF+A  +NIGELE QLLQANP+LEAFGNAKTI+NDNSSRFGKFIRINFD+SGFI+ ANIETYLLEKARVIRQA+ ER FH+FYQ LL     +K  L+L  +S Y+ L NG  ++   DE Q F +T+EAL IMGI+ +EQE IFRVI++V+ MGN+EFKQ+R+SDQA LPDN+VAQK+AHLLGL VT+MTKA LKP++K+GRE V+KAQTKEQAEFSVEAISK+ YERMF+WLV RINR++D++ RQ TNFIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKE I WE+IDFGLDLQPTI+LIEK MGILSLLDEECFFPKAT K+FVEKL+K Q  HPKL   +FR+  DF V HYAG+VDYV++ WL KNMDPLNENVV LLQ+SN  FVQ+IWKDAEN + LS T  QE+ FG    TRKGM RTV QL+KESL KL+ VLNNTNP+FVRCIIPNHEK+  KI+SKLV+DQLKCNGVLEGIRICRQG+PNRILFQEFKQRY IL P  + +GFMDG+ A E +L  L++D + Y+IGQSKIFFKAGV+A LEEDRD++++ +I+KFQ+Y+RG+LARKN Q R Q +NAI+IIQRN  AYLKLRNW WW+LFT+VKPLLSVTRQEE+VA+KEEELKK  + LEK T +F  TKK  E L EEK ++  +L++E+F  QD E ER+ L ++LK+ ++   E E++E E K+K +KLE +++KL+ E+S LS+ LESEEQ  QK Q +K S +++  +L+ + AE++DKL+KL K+KK++++RL + M+TL+EEE+K+KQL+KLK+RHET ITELE++LSRE +ARQDLE+T+RRLE EL E S+ L  ++   ++++  L   ET+++++Q KLDEE  AK++  +Q+RD+E +I +++EDLE E+ +++RAEK KRD AEEIE+LK EL DTG+TSEE    LRK+E E+   +K+ E E K  E ++QE+RKK     E L  Q+E  NK KL  E +K QL++E ND + E  N ++++ + +K +KN E QL E+S+R  E+++ K +   K+ K T + ++ A+ ++ +E+  +Q  +   S++ +  DL+    +ET  KL  Q +LR +E + A ++DQ +EE++++  LE H Q L++QMQ  K K  ED++ L + DE  KK+ RE   L  +LEE+    E+ EK+K+ +QAEL+DA HA +SQ+++   +DRK KK+E+ +NE +         ++ ++K+ R+KETKI+QL  ++   +++ +E+E  K+ L ++L++L  ++DD GKN+ SLE+ K +LE +++  ++T+E+LEEENATL M K+R+++++   K    REL  K++  +E  +++ KK +D E  L++++  + ++ + K+K+E E  DL N+L  +EK KE+  RQ+KK+Q      QR++QE+ A +++ L Q+K+LEK+ +  ++ + +L+E+L QSE+ ++   +ER+EA+ E  ++  A + A  ++KR E+    L  + EELQ   +E +D  KK+  QLE  Q+EL  ER+ +  +E QK+ AE+  K+  ++++ELEM   KKYK  ++  Q+++   ++QL+ +  E NQ +R N+K ++K+K+++ L  DE+++ +  ++ Q++KA  +  + +  L+  ++ N+ L    R+L RDLE+  E+++  + +I+ LK++
Sbjct:   14 KYLQIDKNLINDSLQSSDWASKKLIWIPDDINGYVVAQIVKESVEECTVQIQETGKQKVVLKDHIQKMNPPKFSKSEDMANLTYLNEASVLSNIKERYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSASNAIAQFHATAINIGELEKQLLQANPILEAFGNAKTIRNDNSSRFGKFIRINFDSSGFIAGANIETYLLEKARVIRQASEERSFHIFYQ-LLSTKSEMKNTLLLGEMSGYRFLCNGAASISGIDEVQAFNETIEALKIMGITDEEQECIFRVISSVMLMGNMEFKQDRNSDQATLPDNSVAQKIAHLLGLQVTDMTKAFLKPRIKVGRETVSKAQTKEQAEFSVEAISKAMYERMFKWLVTRINRTLDKDKRQGTNFIGILDIAGFEIFEVNSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKEGISWEYIDFGLDLQPTIDLIEKSMGILSLLDEECFFPKATDKSFVEKLLKTQEKHPKLTKGEFRSNVDFSVEHYAGRVDYVAEKWLEKNMDPLNENVVQLLQKSNVPFVQSIWKDAENFVTLSATANQETQFGS--RTRKGMMRTVSQLHKESLVKLLSVLNNTNPHFVRCIIPNHEKRPAKIESKLVLDQLKCNGVLEGIRICRQGYPNRILFQEFKQRYQILCPQTVNQGFMDGKAAAEQLLNALEVDKNLYKIGQSKIFFKAGVVAGLEEDRDLQISSLIIKFQAYSRGFLARKNCQARIQQINAIRIIQRNSVAYLKLRNWPWWRLFTKVKPLLSVTRQEEIVAMKEEELKKLNDVLEKTTGEFTETKKILEQLKEEKIRLSNELQQEKFNFQDAEDERQKLSQKLKESDNLIAELEAKESEDKEKISKLEEDQDKLKQEVSDLSEQLESEEQTRQKLQLEKNSLEQKNTQLQDENAEIDDKLSKLVKDKKTVDDRLTETMNTLSEEEQKNKQLSKLKTRHETIITELEDKLSRENSARQDLERTRRRLENELKENSEQLVEKNSILDDLKQRLAYTETELVKLQTKLDEELVAKAIVTKQLRDSEGLIQDLREDLETERAARDRAEKIKRDQAEEIEALKSELSDTGSTSEEHLEALRKREEEITLLRKTAEVENKNFESKIQELRKKHTTKAEQLQEQLEKTNKEKLAFEASKNQLEKEFNDLSVECRNSQNARMEVDKKRKNLEQQLLELSNRTIEADKTKKEQLEKINKLTAIVEQNALQIDSLENTNNQAARQIQSLQVENRDLKACLSDETEAKLKMQASLRAVEEERANIQDQADEEERNRVILEKHCQILENQMQAFKTKAVEDSELLQQQDEINKKLNREIYNLTQQLEESAATIEKVEKSKKKLQAELEDASHAYDSQRSEFLNNDRKYKKIENNLNELMKEKAAMQQTRENIDKDCRDKETKIIQLLGKIEKMEEEYAEMERQKNNLDKELHDLSFAQDDAGKNLMSLEREKTKLENEVQELQMTMEDLEEENATLCMVKDRLDVEIANIKNSFQRELIQKEDNFEELRKLMIKKQKDLEIELDDDKAIRASIQTAKRKLELEVEDLNNRLDMTEKAKEDYLRQLKKFQSAGGEKQRDLQEITAKRDELLVQVKDLEKKWKAGDNEIAKLTEELGQSEKLRKIAVAEREEAIHENQSLIAANNKAQEERKRFETRCQNLEEELEELQNAFNETDDIRKKLSLQLETAQSELGNERERLVTVEGQKTNAEKTLKDCQNQLQELEMNMSKKYKTQLSNLQTRVNQSEAQLENETAEKNQLSRLNRKNDKKMKDLL-LQLDESRKNEEGMKNQLDKANKQVNRLKSELREIEDENTNLKATKRKLTRDLEDATESRDNLENQIQSLKSR 1933          
BLAST of Myosin heavy chain vs. Planmine SMEST
Match: SMESG000049494.1 (SMESG000049494.1)

HSP 1 Score: 1912.89 bits (4954), Expect = 0.000e+0
Identity = 1033/1924 (53.69%), Postives = 1442/1924 (74.95%), Query Frame = 1
Query:   97 QYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPMGILSLLDEECFFPKATTKTFVEKLIKNQSTHPKLKATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIE-QIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTK 5859
            +YLQ+DK+L++DS   SDWA+KKL+WIPDD  G++   +++E  +E TV++ E GK   +  +++QK+NPPKF KSEDMA+LTYLNEASVL N+K+RYFS LIYTYSGLFCVV+NPYKRLPIY + +IEWYKGRKRHERPPHIYA+ D AYRNMLQD+E+QSILCTGESGAGKTENTKKVIQYLASVA S+KNQK +ASNA++QF+      GELE QLLQANP+LEAFGNAKTI+NDNSSRFGKFIRINFD+SGFI+ ANIETYLLEKARVIRQA+ ER FH+FYQLL      +K  L+L  +S Y+ L NG  ++   DE Q F +T+EAL IMGI+ +EQE IFRVI++V+ MGN+EFKQ+R+SDQA LPDN+VAQK+AHLLGL VT+MTKA LKP++K+GRE V+KAQTKEQAEFSVEAISK+ YERMF+WLV RINR++D++ RQ TNFIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKE I WE+IDFGLDLQPTI+LIEK MGILSLLDEECFFPKAT K+FVEKL+K Q  HPKL   +FR+  DF V HYAG+VDYV++ WL KNMDPLNENVV LLQ+SN  FVQ+IWKDAEN + LS T  QE+ FG    TRKGM RTV QL+KESL KL+ VLNNTNP+FVRCIIPNHEK+  KI+SKLV+DQLKCNGVLEGIRICRQG+PNRILFQEFKQRY IL P  + +GFMDG+ A E +L  L++D + Y+IGQSKIFFKAGV+A LEEDRD++++ +I+KFQ+Y+RG+LARKN Q R Q +NAI+IIQRN  AYLKLRNW WW+LFT+VKPLLSVTRQEE+VA+KEEELKK  + LEK T +F  TKK  E L EEK ++  +L++E+F  QD E ER+ L ++LK+ ++   E E++E E K+K +KLE +++KL+ E+S LS+ LESEEQ  QK Q +K S +++  +L+ + AE++DKL+KL K+KK++++RL + M+TL+EEE+K+KQL+KLK+RHET ITELE++LSRE +ARQDLE+T+RRLE EL E S+ L  ++   ++++  L   ET+++++Q KLDEE  AK++  +Q+RD+E +I +++EDLE E+ +++RAEK KRD AEEIE+LK EL DTG+TSEE    LRK+E E+   +K+ E E K  E ++QE+RKK     E L  Q+E  NK KL  E +K QL++E ND + E  N ++++ + +K +KN E QL E+S+R  E+++ K +   K+ K T + ++ A+ ++ +E+  +Q  +   S++ +  DL+    +ET  KL  Q +LR +E + A ++DQ +EE++++  LE H Q L++QMQ  K K  ED++ L + DE  KK+ RE   L  +LEE+    E+ EK+K+ +QAEL+DA HA +SQ+++   +DRK KK+E+ +NE +         ++ ++K+ R+KETKI+QL  ++   +++ +E+E  K+ L ++L++L  ++DD GKN+ SLE+ K +LE +++  ++T+E+LEEENATL M K+R+++++   K    REL  K++  +E  +++ KK +D E  L++++  + ++ + K+K+E E  DL N+L  +EK KE+  RQ+KK+Q      QR++QE+ A +++ L Q+K+LEK+ +  ++ + +L+E+L QSE+ ++   +ER+EA+ E  ++  A + A  ++KR E+    L  + EELQ   +E +D  KK+  QLE  Q+EL  ER+ +  +E QK+ AE+  K+  ++++ELEM   KKYK  ++  Q+++   ++QL+ +  E NQ +R N+K ++K+K+++ L  DE+++ +  ++ Q++KA  +  + +  L+  ++ N+ L    R+L RDLE+  E+++  + +I+ LK++
Sbjct:   14 KYLQIDKNLINDSLQSSDWASKKLIWIPDDINGYVVAQIVKESVEECTVQIQETGKQKVVLKDHIQKMNPPKFSKSEDMANLTYLNEASVLSNIKERYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSASNAIAQFH------GELEKQLLQANPILEAFGNAKTIRNDNSSRFGKFIRINFDSSGFIAGANIETYLLEKARVIRQASEERSFHIFYQLL-STKSEMKNTLLLGEMSGYRFLCNGAASISGIDEVQAFNETIEALKIMGITDEEQECIFRVISSVMLMGNMEFKQDRNSDQATLPDNSVAQKIAHLLGLQVTDMTKAFLKPRIKVGRETVSKAQTKEQAEFSVEAISKAMYERMFKWLVTRINRTLDKDKRQGTNFIGILDIAGFEIFEVNSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKEGISWEYIDFGLDLQPTIDLIEKSMGILSLLDEECFFPKATDKSFVEKLLKTQEKHPKLTKGEFRSNVDFSVEHYAGRVDYVAEKWLEKNMDPLNENVVQLLQKSNVPFVQSIWKDAENFVTLSATANQETQFGS--RTRKGMMRTVSQLHKESLVKLLSVLNNTNPHFVRCIIPNHEKRPAKIESKLVLDQLKCNGVLEGIRICRQGYPNRILFQEFKQRYQILCPQTVNQGFMDGKAAAEQLLNALEVDKNLYKIGQSKIFFKAGVVAGLEEDRDLQISSLIIKFQAYSRGFLARKNCQARIQQINAIRIIQRNSVAYLKLRNWPWWRLFTKVKPLLSVTRQEEIVAMKEEELKKLNDVLEKTTGEFTETKKILEQLKEEKIRLSNELQQEKFNFQDAEDERQKLSQKLKESDNLIAELEAKESEDKEKISKLEEDQDKLKQEVSDLSEQLESEEQTRQKLQLEKNSLEQKNTQLQDENAEIDDKLSKLVKDKKTVDDRLTETMNTLSEEEQKNKQLSKLKTRHETIITELEDKLSRENSARQDLERTRRRLENELKENSEQLVEKNSILDDLKQRLAYTETELVKLQTKLDEELVAKAIVTKQLRDSEGLIQDLREDLETERAARDRAEKIKRDQAEEIEALKSELSDTGSTSEEHLEALRKREEEITLLRKTAEVENKNFESKIQELRKKHTTKAEQLQEQLEKTNKEKLAFEASKNQLEKEFNDLSVECRNSQNARMEVDKKRKNLEQQLLELSNRTIEADKTKKEQLEKINKLTAIVEQNALQIDSLENTNNQAARQIQSLQVENRDLKACLSDETEAKLKMQASLRAVEEERANIQDQADEEERNRVILEKHCQILENQMQAFKTKAVEDSELLQQQDEINKKLNREIYNLTQQLEESAATIEKVEKSKKKLQAELEDASHAYDSQRSEFLNNDRKYKKIENNLNELMKEKAAMQQTRENIDKDCRDKETKIIQLLGKIEKMEEEYAEMERQKNNLDKELHDLSFAQDDAGKNLMSLEREKTKLENEVQELQMTMEDLEEENATLCMVKDRLDVEIANIKNSFQRELIQKEDNFEELRKLMIKKQKDLEIELDDDKAIRASIQTAKRKLELEVEDLNNRLDMTEKAKEDYLRQLKKFQSAGGEKQRDLQEITAKRDELLVQVKDLEKKWKAGDNEIAKLTEELGQSEKLRKIAVAEREEAIHENQSLIAANNKAQEERKRFETRCQNLEEELEELQNAFNETDDIRKKLSLQLETAQSELGNERERLVTVEGQKTNAEKTLKDCQNQLQELEMNMSKKYKTQLSNLQTRVNQSEAQLENETAEKNQLSRLNRKNDKKMKDLL-LQLDESRKNEEGMKNQLDKANKQVNRLKSELREIEDENTNLKATKRKLTRDLEDATESRDNLENQIQSLKSR 1927          
BLAST of Myosin heavy chain vs. Planmine SMEST
Match: SMESG000049494.1 (SMESG000049494.1)

HSP 1 Score: 1912.12 bits (4952), Expect = 0.000e+0
Identity = 1034/1928 (53.63%), Postives = 1444/1928 (74.90%), Query Frame = 1
Query:   97 QYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPMGILSLLDEECFFPKATTKTFVEKLIKNQSTHPKLKATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIE-QIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTKIDRL 5871
            +YLQ+DK+L++DS   SDWA+KKL+WIPDD  G++   +++E  +E TV++ E GK   +  +++QK+NPPKF KSEDMA+LTYLNEASVL N+K+RYFS LIYTYSGLFCVV+NPYKRLPIY + +IEWYKGRKRHERPPHIYA+ D AYRNMLQD+E+QSILCTGESGAGKTENTKKVIQYLASVA S+KNQK +ASNA++QF+      GELE QLLQANP+LEAFGNAKTI+NDNSSRFGKFIRINFD+SGFI+ ANIETYLLEKARVIRQA+ ER FH+FYQLL      +K  L+L  +S Y+ L NG  ++   DE Q F +T+EAL IMGI+ +EQE IFRVI++V+ MGN+EFKQ+R+SDQA LPDN+VAQK+AHLLGL VT+MTKA LKP++K+GRE V+KAQTKEQAEFSVEAISK+ YERMF+WLV RINR++D++ RQ TNFIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKE I WE+IDFGLDLQPTI+LIEK MGILSLLDEECFFPKAT K+FVEKL+K Q  HPKL   +FR+  DF V HYAG+VDYV++ WL KNMDPLNENVV LLQ+SN  FVQ+IWKDAEN + LS T  QE+ FG    TRKGM RTV QL+KESL KL+ VLNNTNP+FVRCIIPNHEK+  KI+SKLV+DQLKCNGVLEGIRICRQG+PNRILFQEFKQRY IL P  + +GFMDG+ A E +L  L++D + Y+IGQSKIFFKAGV+A LEEDRD++++ +I+KFQ+Y+RG+LARKN Q R Q +NAI+IIQRN  AYLKLRNW WW+LFT+VKPLLSVTRQEE+VA+KEEELKK  + LEK T +F  TKK  E L EEK ++  +L++E+F  QD E ER+ L ++LK+ ++   E E++E E K+K +KLE +++KL+ E+S LS+ LESEEQ  QK Q +K S +++  +L+ + AE++DKL+KL K+KK++++RL + M+TL+EEE+K+KQL+KLK+RHET ITELE++LSRE +ARQDLE+T+RRLE EL E S+ L  ++   ++++  L   ET+++++Q KLDEE  AK++  +Q+RD+E +I +++EDLE E+ +++RAEK KRD AEEIE+LK EL DTG+TSEE    LRK+E E+   +K+ E E K  E ++QE+RKK     E L  Q+E  NK KL  E +K QL++E ND + E  N ++++ + +K +KN E QL E+S+R  E+++ K +   K+ K T + ++ A+ ++ +E+  +Q  +   S++ +  DL+    +ET  KL  Q +LR +E + A ++DQ +EE++++  LE H Q L++QMQ  K K  ED++ L + DE  KK+ RE   L  +LEE+    E+ EK+K+ +QAEL+DA HA +SQ+++   +DRK KK+E+ +NE +         ++ ++K+ R+KETKI+QL  ++   +++ +E+E  K+ L ++L++L  ++DD GKN+ SLE+ K +LE +++  ++T+E+LEEENATL M K+R+++++   K    REL  K++  +E  +++ KK +D E  L++++  + ++ + K+K+E E  DL N+L  +EK KE+  RQ+KK+Q      QR++QE+ A +++ L Q+K+LEK+ +  ++ + +L+E+L QSE+ ++   +ER+EA+ E  ++  A + A  ++KR E+    L  + EELQ   +E +D  KK+  QLE  Q+EL  ER+ +  +E QK+ AE+  K+  ++++ELEM   KKYK  ++  Q+++   ++QL+ +  E NQ +R N+K ++K+K+++ L  DE+++ +  ++ Q++KA  +  + +  L+  ++ N+ L    R+L RDLE+  E+++  + +I+ LK++ + L
Sbjct:   14 KYLQIDKNLINDSLQSSDWASKKLIWIPDDINGYVVAQIVKESVEECTVQIQETGKQKVVLKDHIQKMNPPKFSKSEDMANLTYLNEASVLSNIKERYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSASNAIAQFH------GELEKQLLQANPILEAFGNAKTIRNDNSSRFGKFIRINFDSSGFIAGANIETYLLEKARVIRQASEERSFHIFYQLL-STKSEMKNTLLLGEMSGYRFLCNGAASISGIDEVQAFNETIEALKIMGITDEEQECIFRVISSVMLMGNMEFKQDRNSDQATLPDNSVAQKIAHLLGLQVTDMTKAFLKPRIKVGRETVSKAQTKEQAEFSVEAISKAMYERMFKWLVTRINRTLDKDKRQGTNFIGILDIAGFEIFEVNSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKEGISWEYIDFGLDLQPTIDLIEKSMGILSLLDEECFFPKATDKSFVEKLLKTQEKHPKLTKGEFRSNVDFSVEHYAGRVDYVAEKWLEKNMDPLNENVVQLLQKSNVPFVQSIWKDAENFVTLSATANQETQFGS--RTRKGMMRTVSQLHKESLVKLLSVLNNTNPHFVRCIIPNHEKRPAKIESKLVLDQLKCNGVLEGIRICRQGYPNRILFQEFKQRYQILCPQTVNQGFMDGKAAAEQLLNALEVDKNLYKIGQSKIFFKAGVVAGLEEDRDLQISSLIIKFQAYSRGFLARKNCQARIQQINAIRIIQRNSVAYLKLRNWPWWRLFTKVKPLLSVTRQEEIVAMKEEELKKLNDVLEKTTGEFTETKKILEQLKEEKIRLSNELQQEKFNFQDAEDERQKLSQKLKESDNLIAELEAKESEDKEKISKLEEDQDKLKQEVSDLSEQLESEEQTRQKLQLEKNSLEQKNTQLQDENAEIDDKLSKLVKDKKTVDDRLTETMNTLSEEEQKNKQLSKLKTRHETIITELEDKLSRENSARQDLERTRRRLENELKENSEQLVEKNSILDDLKQRLAYTETELVKLQTKLDEELVAKAIVTKQLRDSEGLIQDLREDLETERAARDRAEKIKRDQAEEIEALKSELSDTGSTSEEHLEALRKREEEITLLRKTAEVENKNFESKIQELRKKHTTKAEQLQEQLEKTNKEKLAFEASKNQLEKEFNDLSVECRNSQNARMEVDKKRKNLEQQLLELSNRTIEADKTKKEQLEKINKLTAIVEQNALQIDSLENTNNQAARQIQSLQVENRDLKACLSDETEAKLKMQASLRAVEEERANIQDQADEEERNRVILEKHCQILENQMQAFKTKAVEDSELLQQQDEINKKLNREIYNLTQQLEESAATIEKVEKSKKKLQAELEDASHAYDSQRSEFLNNDRKYKKIENNLNELMKEKAAMQQTRENIDKDCRDKETKIIQLLGKIEKMEEEYAEMERQKNNLDKELHDLSFAQDDAGKNLMSLEREKTKLENEVQELQMTMEDLEEENATLCMVKDRLDVEIANIKNSFQRELIQKEDNFEELRKLMIKKQKDLEIELDDDKAIRASIQTAKRKLELEVEDLNNRLDMTEKAKEDYLRQLKKFQSAGGEKQRDLQEITAKRDELLVQVKDLEKKWKAGDNEIAKLTEELGQSEKLRKIAVAEREEAIHENQSLIAANNKAQEERKRFETRCQNLEEELEELQNAFNETDDIRKKLSLQLETAQSELGNERERLVTVEGQKTNAEKTLKDCQNQLQELEMNMSKKYKTQLSNLQTRVNQSEAQLENETAEKNQLSRLNRKNDKKMKDLL-LQLDESRKNEEGMKNQLDKANKQVNRLKSELREIEDENTNLKATKRKLTRDLEDATESRDNLENQIQSLKSRRNTL 1931          
BLAST of Myosin heavy chain vs. Planmine SMEST
Match: SMESG000049494.1 (SMESG000049494.1)

HSP 1 Score: 1910.19 bits (4947), Expect = 0.000e+0
Identity = 1033/1924 (53.69%), Postives = 1442/1924 (74.95%), Query Frame = 1
Query:   97 QYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIEEKGDEATVKL-ENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRINRSIDRN-RQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPMGILSLLDEECFFPKATTKTFVEKLIKNQSTHPKLKATDFRAKADFGVIHYAGKVDYVSDNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYARGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSVTRQXXXXXXXXXXXXXXXXXXXXMTADFETTKKNYEFLMEEKNKIQEDLEKERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNKLQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKLTKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQAARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQAKLDEETTAKSLAQRQIRDAENVITEIKEDLXXXXXXXXXXXXXXXDLAEEIESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEIRKKAAVTIENLNNQIEAANKSKLVVEKAKXXXXXXXXXXXXXXXXXRSSKADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKKQTELADKLAMNLEEIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFALLKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKVMXXXXXXXXXXXXAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSDRKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDDKLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVTIEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKKLRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQIKKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLSQSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNXXXXXXXXXXXDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKELHDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQAXXXXXXXXXXXXXIMALMADETKRADNAIE-QIEKATGRFKKAERSLQMEQENNSALSTQNRRLQRDLEEVNETKEARDQEIKILKTK 5859
            +YLQ+DK+L++DS   SDWA+KKL+WIPDD  G++   +++E  +E TV++ E GK   +  +++QK+NPPKF KSEDMA+LTYLNEASVL N+K+RYFS LIYTYSGLFCVV+NPYKRLPIY + +IEWYKGRKRHERPPHIYA+ D AYRNMLQD+E+QSILCTGESGAGKTENTKKVIQYLASVA S+KNQK +ASNA++QF+      GELE QLLQANP+LEAFGNAKTI+NDNSSRFGKFIRINFD+SGFI+ ANIETYLLEKARVIRQA+ ER FH+FYQLL      +K  L+L  +S Y+ L NG  ++   DE Q F +T+EAL IMGI+ +EQE IFRVI++V+ MGN+EFKQ+R+SDQA LPDN+VAQK+AHLLGL VT+MTKA LKP++K+GRE V+KAQTKEQAEFSVEAISK+ YERMF+WLV RINR++D++ RQ TNFIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKE I WE+IDFGLDLQPTI+LIEK MGILSLLDEECFFPKAT K+FVEKL+K Q  HPKL   +FR+  DF V HYAG+VDYV++ WL KNMDPLNENVV LLQ+SN  FVQ+IWKDAEN + LS T  QE+ FG    TRKGM RTV QL+KESL KL+ VLNNTNP+FVRCIIPNHEK+  KI+SKLV+DQLKCNGVLEGIRICRQG+PNRILFQEFKQRY IL P  + +GFMDG+ A E +L  L++D + Y+IGQSKIFFKAGV+A LEEDRD++++ +I+KFQ+Y+RG+LARKN Q R Q +NAI+IIQRN  AYLKLRNW WW+LFT+VKPLLSVTRQEE+VA+KEEELKK  + LEK T +F  TKK  E L EEK ++  +L++E+F  QD E ER+ L ++LK+ ++   E E++E E K+K +KLE +++KL+ E+S LS+ LESEEQ  QK Q +K S +++  +L+ + AE++DKL+KL K+KK++++RL + M+TL+EEE+K+KQL+KLK+RHET ITELE++LSRE +ARQDLE+T+RRLE EL E S+ L  ++   ++++  L   ET+++++Q KLDEE  AK++  +Q+RD+E +I +++EDLE E+ +++RAEK KRD AEEIE+LK EL DTG+TSEE    LRK+E E+   +K+ E E K  E ++QE+RKK     E L  Q+E  NK KL  E +K QL++E ND + E  N ++++ + +K +KN E QL E+S+R  E+++ K +   K+ K T + ++ A+ ++ +E+  +Q  +   S++ +  DL+    +ET  KL  Q +LR +E + A ++DQ +EE++++  LE H Q L++QMQ  K K  ED++ L + DE  KK+ RE   L  +LEE+    E+ EK+K+ +QAEL+DA HA +SQ+++   +DRK KK+E+ +NE +         ++ ++K+ R+KETKI+QL  ++   +++ +E+E  K+ L ++L++L  ++DD GKN+ SLE+ K +LE +++  ++T+E+LEEENATL M K+R+++++   K    REL  K++  +E  +++ KK +D E  L++++  + ++ + K+K+E E  DL N+L  +EK KE+  RQ+KK+Q      QR++QE+ A +++ L Q+K+LEK+ +  ++ + +L+E+L QSE+ ++   +ER+EA+ E  ++  A + A  ++KR E+    L  + EELQ   +E +D  KK+  QLE  Q+EL  ER+ +  +E QK+ AE+  K+  ++++ELEM   KKYK  ++  Q+++   ++QL+ +  E NQ +R N+K ++K+K+++ L  DE+++ +  ++ Q++KA  +  + +  L+  ++ N+ L    R+L RDLE+  E+++  + +I+ LK++
Sbjct:   14 KYLQIDKNLINDSLQSSDWASKKLIWIPDDINGYVVAQIVKESVEECTVQIQETGKQKVVLKDHIQKMNPPKFSKSEDMANLTYLNEASVLSNIKERYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSASNAIAQFH------GELEKQLLQANPILEAFGNAKTIRNDNSSRFGKFIRINFDSSGFIAGANIETYLLEKARVIRQASEERSFHIFYQLL-STKSEMKNTLLLGEMSGYRFLCNGAASISGIDEVQAFNETIEALKIMGITDEEQECIFRVISSVMLMGNMEFKQDRNSDQATLPDNSVAQKIAHLLGLQVTDMTKAFLKPRIKVGRETVSKAQTKEQAEFSVEAISKAMYERMFKWLVTRINRTLDKDKRQGTNFIGILDIAGFEIFEVNSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKEGISWEYIDFGLDLQPTIDLIEKSMGILSLLDEECFFPKATDKSFVEKLLKTQEKHPKLTKGEFRSNVDFSVEHYAGRVDYVAEKWLEKNMDPLNENVVQLLQKSNVPFVQSIWKDAENFVTLSATANQETQFGS--RTRKGMMRTVSQLHKESLVKLLSVLNNTNPHFVRCIIPNHEKRPAKIESKLVLDQLKCNGVLEGIRICRQGYPNRILFQEFKQRYQILCPQTVNQGFMDGKAAAEQLLNALEVDKNLYKIGQSKIFFKAGVVAGLEEDRDLQISSLIIKFQAYSRGFLARKNCQARIQQINAIRIIQRNSVAYLKLRNWPWWRLFTKVKPLLSVTRQEEIVAMKEEELKKLNDVLEKTTGEFTETKKILEQLKEEKIRLSNELQQEKFNFQDAEDERQKLSQKLKESDNLIAELEAKESEDKEKISKLEEDQDKLKQEVSDLSEQLESEEQTRQKLQLEKNSLEQKNTQLQDENAEIDDKLSKLVKDKKTVDDRLTETMNTLSEEEQKNKQLSKLKTRHETIITELEDKLSRENSARQDLERTRRRLENELKENSEQLVEKNSILDDLKQRLAYTETELVKLQTKLDEELVAKAIVTKQLRDSEGLIQDLREDLETERAARDRAEKIKRDQAEEIEALKSELSDTGSTSEEHLEALRKREEEITLLRKTAEVENKNFESKIQELRKKHTTKAEQLQEQLEKTNKEKLAFEASKNQLEKEFNDLSVECRNSQNARMEVDKKRKNLEQQLLELSNRTIEADKTKKEQLEKINKLTAIVEQNALQIDSLENTNNQAARQIQSLQVENRDLKACLSDETEAKLKMQASLRAVEEERANIQDQADEEERNRVILEKHCQILENQMQAFKTKAVEDSELLQQQDEINKKLNREIYNLTQQLEESAATIEKVEKSKKKLQAELEDASHAYDSQRSEFLNNDRKYKKIENNLNELMKEKAAMQQTRENIDKDCRDKETKIIQLLGKIEKMEEEYAEMERQKNNLDKELHDLSFAQDDAGKNLMSLEREKTKLENEVQELQMTMEDLEEENATLCMVKDRLDVEIANIKNSFQRELIQKEDNFEELRKLMIKKQKDLEIELDDDKAIRASIQTAKRKLELEVEDLNNRLDMTEKAKEDYLRQLKKFQSAGGEKQRDLQEITAKRDELLVQVKDLEKKWKAGDNEIAKLTEELGQSEKLRKIAVAEREEAIHENQSLIAANNKAQEERKRFETRCQNLEEELEELQNAFNETDDIRKKLSLQLETAQSELGNERERLVTVEGQKTNAEKTLKDCQNQLQELEMNMSKKYKTQLSNLQTRVNQSEAQLENETAEKNQLSRLNRKNDKKMKDLL-LQLDESRKNEEGMKNQLDKANKQVNRLKSELREIEDENTNLKATKRKLTRDLEDATESRDNLENQIQSLKSR 1927          
The following BLAST results are available for this feature:
BLAST of Myosin heavy chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MYH100.000e+049.51myosin heavy chain 10 [Source:HGNC Symbol;Acc:HGNC... [more]
MYH100.000e+049.43myosin heavy chain 10 [Source:HGNC Symbol;Acc:HGNC... [more]
MYH90.000e+049.46myosin heavy chain 9 [Source:HGNC Symbol;Acc:HGNC:... [more]
MYH100.000e+048.93myosin heavy chain 10 [Source:HGNC Symbol;Acc:HGNC... [more]
MYH110.000e+048.47myosin heavy chain 11 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Myosin heavy chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nmy-10.000e+046.39Non-muscle MYosin [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
nmy-20.000e+042.46Non-muscle MYosin [Source:UniProtKB/TrEMBL;Acc:G5... [more]
unc-540.000e+036.64Myosin-4 [Source:UniProtKB/Swiss-Prot;Acc:P02566][more]
unc-540.000e+036.64Myosin-4 [Source:UniProtKB/Swiss-Prot;Acc:P02566][more]
unc-540.000e+036.64Myosin-4 [Source:UniProtKB/Swiss-Prot;Acc:P02566][more]
back to top
BLAST of Myosin heavy chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zip0.000e+050.15gene:FBgn0265434 transcript:FBtr0302572[more]
zip0.000e+050.15gene:FBgn0265434 transcript:FBtr0302574[more]
zip0.000e+050.15gene:FBgn0265434 transcript:FBtr0100466[more]
zip0.000e+050.15gene:FBgn0265434 transcript:FBtr0100467[more]
zip0.000e+049.92gene:FBgn0265434 transcript:FBtr0302573[more]
back to top
BLAST of Myosin heavy chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myh9a0.000e+049.77myosin, heavy chain 9a, non-muscle [Source:ZFIN;Ac... [more]
myh100.000e+048.81myosin, heavy chain 10, non-muscle [Source:ZFIN;Ac... [more]
myh11a0.000e+048.68myosin, heavy chain 11a, smooth muscle [Source:ZFI... [more]
myh100.000e+048.89myosin, heavy chain 10, non-muscle [Source:ZFIN;Ac... [more]
myh100.000e+048.89myosin, heavy chain 10, non-muscle [Source:ZFIN;Ac... [more]
back to top
BLAST of Myosin heavy chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MYH90.000e+048.58myosin, heavy chain 9, non-muscle [Source:NCBI gen... [more]
MYH90.000e+048.10myosin, heavy chain 9, non-muscle [Source:NCBI gen... [more]
MYH90.000e+048.16myosin, heavy chain 9, non-muscle [Source:NCBI gen... [more]
MYH90.000e+048.43myosin, heavy chain 9, non-muscle [Source:NCBI gen... [more]
MYH90.000e+048.12myosin, heavy chain 9, non-muscle [Source:NCBI gen... [more]
back to top
BLAST of Myosin heavy chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Myh100.000e+049.61myosin, heavy polypeptide 10, non-muscle [Source:M... [more]
Myh90.000e+049.28myosin, heavy polypeptide 9, non-muscle [Source:MG... [more]
Myh100.000e+049.61myosin, heavy polypeptide 10, non-muscle [Source:M... [more]
Myh100.000e+049.03myosin, heavy polypeptide 10, non-muscle [Source:M... [more]
Myh110.000e+048.47myosin, heavy polypeptide 11, smooth muscle [Sourc... [more]
back to top
BLAST of Myosin heavy chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9JLT0|MYH10_RAT0.000e+049.51Myosin-10 OS=Rattus norvegicus OX=10116 GN=Myh10 P... [more]
sp|Q61879|MYH10_MOUSE0.000e+049.61Myosin-10 OS=Mus musculus OX=10090 GN=Myh10 PE=1 S... [more]
sp|Q8VDD5|MYH9_MOUSE0.000e+049.28Myosin-9 OS=Mus musculus OX=10090 GN=Myh9 PE=1 SV=... [more]
sp|P35580|MYH10_HUMAN0.000e+049.51Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV... [more]
sp|P35579|MYH9_HUMAN0.000e+049.46Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4[more]
back to top
BLAST of Myosin heavy chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RIV70.000e+053.15Non-muscle myosin II heavy chain OS=Fasciola hepat... [more]
A0A504Y9W60.000e+053.10Non-muscle myosin II heavy chain OS=Fasciola gigan... [more]
A0A4S2LML20.000e+051.97Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2LP740.000e+051.97Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2LML10.000e+051.97Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Myosin heavy chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myh11a0.000e+048.01myosin-11-like [Source:NCBI gene;Acc:103025732][more]
myh11a0.000e+048.01myosin-11-like [Source:NCBI gene;Acc:103025732][more]
myh11a0.000e+047.90myosin-11-like [Source:NCBI gene;Acc:103025732][more]
myh11b0.000e+046.96myosin, heavy chain 11b, smooth muscle [Source:ZFI... [more]
myh100.000e+047.05myosin, heavy chain 10, non-muscle [Source:ZFIN;Ac... [more]
back to top
BLAST of Myosin heavy chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myh100.000e+059.37myosin, heavy chain 10, non-muscle [Source:ZFIN;Ac... [more]
ENSPMAT00000003821.10.000e+034.93pep scaffold:Pmarinus_7.0:GL477325:10535:35195:1 g... [more]
ENSPMAT00000002731.10.000e+035.10pep scaffold:Pmarinus_7.0:GL478284:11062:40470:1 g... [more]
ENSPMAT00000005582.10.000e+037.09pep scaffold:Pmarinus_7.0:GL481917:38212:72095:-1 ... [more]
ENSPMAT00000004078.10.000e+043.71pep scaffold:Pmarinus_7.0:GL478761:5289:25008:-1 g... [more]
back to top
BLAST of Myosin heavy chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MYO10.000e+039.78Type II myosin heavy chain; required for wild-type... [more]
MYO22.010e-15838.29Type V myosin motor involved in actin-based transp... [more]
MYO45.554e-15037.30Type V myosin motor involved in actin-based transp... [more]
MYO57.889e-11733.33One of two type I myosin motors; contains proline-... [more]
MYO32.874e-11533.42One of two type I myosins; localizes to actin cort... [more]
back to top
BLAST of Myosin heavy chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
MYHC-ST2.881e-17350.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418191.562e-15537.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455633.921e-13435.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495154.552e-13236.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO360376.377e-13133.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Myosin heavy chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myh9b0.000e+049.25myosin heavy chain 9 [Source:NCBI gene;Acc:1011645... [more]
myh9b0.000e+049.10myosin heavy chain 9 [Source:NCBI gene;Acc:1011645... [more]
myh11a0.000e+046.77myosin heavy chain 11 [Source:NCBI gene;Acc:101164... [more]
myh140.000e+046.05myosin-10 [Source:NCBI gene;Acc:101160019][more]
ENSORLT00000000809.20.000e+045.82myosin-10 [Source:NCBI gene;Acc:101154782][more]
back to top
BLAST of Myosin heavy chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062420.10.000e+099.85SMESG000062420.1[more]
SMESG000049494.10.000e+053.85SMESG000049494.1[more]
SMESG000049494.10.000e+053.69SMESG000049494.1[more]
SMESG000049494.10.000e+053.63SMESG000049494.1[more]
SMESG000049494.10.000e+053.69SMESG000049494.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022992 ID=SMED30022992|Name=Myosin heavy chain|organism=Schmidtea mediterranea sexual|type=transcript|length=6157bp
ATATATATGCATCTCAAAATTGGAAATTAAATTATTAATTTTAATTTACT
AACAAATTTTTGTTGTAAAATGGAAAATATTGATGCTAAAGACTTGCAAT
ATTTACAAGTTGATAAAAGTTTAGTTTCTGACTCTGCTAATTTGTCTGAT
TGGGCTAACAAAAAATTGGTTTGGATACCTGACGACAATGAAGGATTTAT
TTCAGGATCACTTATAGAAGAAAAAGGCGATGAAGCTACTGTCAAACTGG
AAAATGGCAAAACAATGAAATTACCAATTGAAAATGTTCAAAAAGTGAAT
CCACCAAAATTTTTTAAATCTGAAGATATGGCAGATTTAACTTATTTGAA
TGAAGCATCAGTTCTATATAATTTAAAAGACAGATATTTTTCAGACTTAA
TATATACATATTCCGGATTATTTTGTGTCGTTGTAAATCCATACAAGCGC
TTGCCTATTTATACAAATAATGTAATTGAGTGGTACAAAGGTCGAAAACG
TCACGAAAGACCGCCACATATTTACGCAGTTACTGATGTCGCATATCGAA
ATATGCTCCAAGATAAAGAAAATCAATCAATTCTTTGCACTGGTGAATCC
GGAGCAGGAAAAACTGAAAATACGAAAAAAGTTATTCAATATTTGGCCTC
AGTTGCAACTTCTTTGAAAAATCAAAAAACCACAGCCAGTAATGCATTGT
CACAATTTTATGCTCACGATGTTAACATTGGAGAATTGGAGACCCAATTA
CTTCAGGCCAATCCGGTTTTAGAAGCTTTTGGAAATGCAAAGACTATCAA
AAACGATAATTCATCTCGTTTTGGTAAATTTATTCGAATCAATTTTGACA
CTTCTGGATTCATTTCCAGTGCAAACATAGAAACATATTTATTGGAAAAA
GCTAGAGTTATTAGACAGGCAGCTAATGAACGGTGCTTTCACGTGTTTTA
TCAGCTTCTTCTTGGTGCAGACGACCGATTGAAAAAGGAATTAATCTTAG
AAAATGTTTCTACATACAAACTTTTATCCAACGGCATGATAGCTGTACCA
GATTACGATGAAAAGCAAATGTTTAAAGATACAGTCGAAGCTCTCGATAT
AATGGGGATTTCGAAAGACGAACAAGAATCTATTTTCCGAGTTATAGCCG
CAGTTTTACACATGGGAAATATCGAATTCAAACAAGAAAGAAGTTCGGAT
CAGGCTGCTTTACCAGACAATACAGTTGCTCAAAAGGTTGCTCATCTTCT
CGGTTTACCGGTCACAGAAATGACCAAAGCACTGCTGAAACCAAAATTGA
AAATTGGAAGAGAAGTTGTAGCAAAAGCTCAAACTAAAGAACAAGCCGAA
TTTTCCGTTGAAGCTATAAGCAAATCAACATATGAAAGAATGTTTCGATG
GCTGGTAATGAGAATAAATAGATCAATTGACAGAAATAGACAAAAAACTA
ATTTCATTGGCATTCTTGATATTGCTGGCTTTGAAATATTTGAAATAAAC
TCTTTTGAACAATTGTGTATAAACTATACCAACGAGAAATTGCAACAGCT
TTTCAATCATACAATGTTTGTGCTAGAACAAGAAGAATACAGAAAAGAAA
ATATCAAATGGGAATTCATTGACTTTGGTCTTGATTTGCAGCCAACTATC
GAACTAATTGAAAAGCCAATGGGTATTCTTTCTTTGTTAGATGAAGAGTG
CTTTTTCCCAAAAGCTACCACAAAGACATTTGTTGAAAAATTAATTAAAA
ACCAATCGACGCACCCTAAATTGAAAGCTACTGATTTTAGAGCAAAAGCA
GATTTTGGGGTTATTCATTACGCGGGAAAAGTTGATTATGTCTCCGATAA
TTGGCTGGTGAAAAATATGGATCCTCTTAATGAGAACGTTGTTAGTCTCT
TACAAGAATCAAATGAAAGTTTTGTCCAGACAATTTGGAAAGATGCAGAA
AACATTATTGGCTTATCAACTACTACCGCCCAAGAATCTGCCTTTGGAGG
TGCAAAAACTACTCGCAAAGGAATGTTTAGAACCGTCGGTCAGCTTTACA
AAGAATCATTAACGAAATTGATGGATGTTCTGAATAATACCAATCCCAAT
TTTGTGAGATGTATCATTCCCAATCATGAAAAAAAATCTGGTAAAATCGA
TTCAAAATTGGTTATTGATCAATTAAAATGTAATGGTGTGCTGGAGGGTA
TCAGAATATGCCGACAAGGATTTCCAAACCGAATTTTATTCCAAGAGTTC
AAACAACGTTATGGAATTCTTACACCAAATGTCATACTAAAAGGTTTTAT
GGACGGTCGAAAAGCAACAGAATTAATGCTTGGAGAGTTGGATATTGATG
CATCAAATTACAGAATTGGTCAGAGTAAAATATTTTTCAAAGCTGGAGTT
TTGGCTAGATTAGAGGAAGATCGAGATATTAAGTTGACTGAAATCATAGT
CAAATTTCAATCTTATGCACGTGGATATTTGGCAAGAAAAAATTTACAAA
ATCGATCGCAAAATCTCAATGCAATTAAAATTATTCAAAGAAATTGTAAT
GCATACTTAAAATTGAGAAATTGGGCCTGGTGGAAATTATTCACACGTGT
TAAGCCTCTATTAAGTGTTACAAGGCAAGAGGAAGTTGTGGCTTTGAAGG
AAGAAGAATTGAAAAAATCAAAAGAAACTCTCGAAAAGATGACTGCTGAT
TTCGAAACAACTAAGAAAAATTATGAATTTCTCATGGAAGAAAAAAATAA
AATTCAGGAAGATTTGGAAAAGGAGCGTTTTGCATTGCAAGATATGGAAG
GGGAAAGAGAAAATTTGATCAAGCGATTAAAAGATATTGAATCAGATGCT
CAAGAATGCGAGTCAAGAGAGATGGAAACAAAAGACAAATGCAATAAATT
GGAAATCGAGAAAAATAAATTACAAAATGAAATTTCACAGCTTAGCCAAA
ATTTAGAATCAGAGGAACAGAACTTGCAAAAAGCTCAAGCAGACAAATTA
AGTGCTGATAAACGAATTAAGGAACTGGAACAAAAAGTGGCCGAATTAGA
AGATAAACTTAACAAGTTAACTAAAGAGAAAAAGTCTCTAGAAGAGCGAT
TGGCTGATGTTATGTCTACTTTGGCGGAAGAAGAAGAAAAGAGTAAACAA
TTAACGAAACTCAAATCCCGTCACGAAACAAGTATCACTGAATTAGAAGA
GAGATTGAGCAGAGAACAAGCAGCTCGACAAGATTTAGAAAAAACAAAGA
GACGACTAGAAACTGAATTGTCTGAAAAATCTGATAATTTATCATCTCAA
AGCCATACATATGAAGAAATTAGAATTACTCTTGAACGAGCAGAAACACA
AATAATTCAAATGCAAGCTAAATTAGATGAAGAAACAACGGCAAAATCGT
TGGCTCAGAGACAAATTCGAGACGCAGAAAACGTAATCACCGAAATCAAA
GAAGATCTTGAAGCTGAAAAACGTTCAAAAGAGAGAGCTGAAAAAGCTAA
GAGAGATTTAGCCGAAGAAATAGAATCTCTTAAAATGGAATTACTCGATA
CGGGAAATACATCAGAAGAACAGCAAAGCGTATTGCGCAAAAAAGAAGTT
GAATTACAAAATTTTAAAAAATCTTTTGAAGATGAAACAAAACGAACTGA
ACTTGAAATGCAAGAAATTCGTAAAAAAGCCGCAGTAACGATTGAAAACC
TCAACAATCAAATAGAAGCTGCTAACAAATCAAAACTTGTTGTTGAAAAG
GCTAAATTACAGTTGCAAGAAGAACTTAATGATGCAAATAACGAATTAGC
AAATTTAAGATCCTCCAAAGCTGACTCTGAAAAACTTAAGAAGAACACAG
AACTACAACTTTCAGAAATATCTCATCGCCTTTCAGAATCTGAAGAACAC
AAGCTAGATGCTGAATCAAAACTTAAAAAACAAACCGAGTTGGCTGACAA
ATTGGCTATGAATCTCGAAGAAATTGAAAGCAAATTGTCGCAATTAACTA
AATCTGAATTATCAGTTCGAAGTCAGTTAGCAGATTTACAAAAGGACTTT
GAAGAAGAAACTCGATTAAAATTGAATGCTCAAACTACATTAAGGCAGTT
AGAAAGTCAATTTGCTTTATTAAAAGATCAATTAGAAGAGGAGCAACAAT
CAAAAGAAAATTTAGAAAGTCACGTACAAGCTCTACAGAGTCAAATGCAA
GATGTCAAAAAGAAAGTTGAAGAAGATGCTCAACAGCTATTAGAATTTGA
TGAATCTCGTAAAAAAGTAATGCGTGAACGAGAAGAATTGCAGATTAGAC
TTGAAGAAGCAATCAATCAGACTGAAAGATCAGAAAAAGCTAAGCGAACA
ATTCAAGCCGAGCTTCAAGATGCATATCATGCCCTAGAAAGTCAGAAAAA
TGACCAAACTCAAAGTGATCGAAAACTTAAAAAAATGGAATCACAAGTCA
ATGAAACATTGAACTTGAATAAAAAATATTTAGCTGAAAAGGATACATTA
GAAAAAGAAAATCGTGAAAAAGAAACAAAAATCATGCAATTACAGAGAGA
AATGAATGCAAATGACGATAAACTTTCGGAATTGGAAAATGCAAAATCCT
TACTGACTCGGCAATTGAATGAATTGGTTTCGAGCAAAGATGATGTTGGT
AAAAATGTTGGCAGTTTAGAAAAGGCTAAAATTCAATTAGAAACCGATTT
AGAGAATTGTAAAGTTACTATTGAAGAATTAGAAGAAGAAAATGCAACTC
TTCAAATGAATAAAGAACGAGTTGAAATGCAATTAACTGCTACTAAAGCC
CAACTGGATAGGGAGCTAGCTTCCAAAGATGAAATGCACGATGAACAGTT
CAGAATTATAAACAAAAAGCTTCGTGATGCAGAAGCGGCACTTGAAGAAG
AGCAGAAATCCAAAACAGCTATGGTTTCATTGAAAAAGAAAATAGAAAAT
GAGAACATGGATTTATTAAATCAATTAACAGAATCTGAGAAGGTCAAAGA
AGAGCTGGCCAGACAGATTAAAAAATACCAAGGAAATTCTAGCAATCTTC
AAAGAGAAATGCAAGAACTTGTTGCTGCTAAAAATGATTATTTGAAGCAG
ATTAAAGAACTAGAAAAGCGCTTACGTACTTCTGAAAGCAATGTAAACCA
ATTATCCGAAGACCTTTCGCAGTCTGAACGTGCTAAGAGAACCATTGCAT
CTGAAAGAGATGAAGCTTTAGAAGAAATTGCCACAATCACTATGGCTAGG
GATACAGCTATTGCAGATAAAAAACGTATTGAGAGTAGCATTTCAGCATT
AAGCATGGATAATGAAGAATTGCAATTACTTTTGTCAGAATTAGAAGACA
AAAATAAGAAAATTATTTCTCAGTTAGAACAAGTTCAAAATGAATTAAAT
GTTGAACGACAAAATATAAGTAGATTAGAAAATCAAAAATCAACTGCCGA
AAGACTGAATAAAGAATTGCATGATAAAATTGAAGAATTGGAAATGGAAG
CTGGTAAAAAATATAAAGCTACAGTTGCTGCTCAACAAAGTAAAATCCAA
AGTCTTGATTCTCAGCTGGACGCTAAAATTGAGGAAATAAACCAAGCTAA
TAGAAATAACAAGAAACTAGAAAGAAAGTTGAAAGAAATTATGGCTCTTA
TGGCTGATGAAACAAAGCGGGCTGACAATGCAATCGAACAGATTGAAAAA
GCCACTGGCAGATTTAAAAAAGCAGAGAGAAGTTTACAGATGGAACAAGA
AAACAATTCTGCTCTAAGTACACAAAATCGCCGATTACAACGAGATTTGG
AAGAAGTAAATGAAACCAAAGAAGCACGGGACCAAGAAATTAAAATTCTT
AAAACCAAAATCGACAGATTGGAAAAAAGAACACGCGCTGGGGGTCGACC
TCTTAGAGGAGACGGTGGATCTGATGATGGGTTATCTGGAGATGGAGAAT
CCGTAACTGATTCTGCTTTAAAATCTGTTCAAGAAGACTAATTCAATAAG
TCCTAAAATGAACAATAAATTCTTGAATAATTAGTTAATACAAAAATTTT
TGAATAATTTATATTTGGACTAACTTTTAATTCCTATTTGGTTTGCTCAA
TATATAATTGTTTTGATATATTTAATATTTCTATTTTATCAATTTGTGTA
CTTGGGG
back to top

protein sequence of SMED30022992-orf-1

>SMED30022992-orf-1 ID=SMED30022992-orf-1|Name=SMED30022992-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1974bp
MENIDAKDLQYLQVDKSLVSDSANLSDWANKKLVWIPDDNEGFISGSLIE
EKGDEATVKLENGKTMKLPIENVQKVNPPKFFKSEDMADLTYLNEASVLY
NLKDRYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPH
IYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLK
NQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSR
FGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGA
DDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKD
EQESIFRVIAAVLHMGNIEFKQERSSDQAALPDNTVAQKVAHLLGLPVTE
MTKALLKPKLKIGREVVAKAQTKEQAEFSVEAISKSTYERMFRWLVMRIN
RSIDRNRQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMF
VLEQEEYRKENIKWEFIDFGLDLQPTIELIEKPMGILSLLDEECFFPKAT
TKTFVEKLIKNQSTHPKLKATDFRAKADFGVIHYAGKVDYVSDNWLVKNM
DPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRK
GMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVID
QLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKAT
ELMLGELDIDASNYRIGQSKIFFKAGVLARLEEDRDIKLTEIIVKFQSYA
RGYLARKNLQNRSQNLNAIKIIQRNCNAYLKLRNWAWWKLFTRVKPLLSV
TRQEEVVALKEEELKKSKETLEKMTADFETTKKNYEFLMEEKNKIQEDLE
KERFALQDMEGERENLIKRLKDIESDAQECESREMETKDKCNKLEIEKNK
LQNEISQLSQNLESEEQNLQKAQADKLSADKRIKELEQKVAELEDKLNKL
TKEKKSLEERLADVMSTLAEEEEKSKQLTKLKSRHETSITELEERLSREQ
AARQDLEKTKRRLETELSEKSDNLSSQSHTYEEIRITLERAETQIIQMQA
KLDEETTAKSLAQRQIRDAENVITEIKEDLEAEKRSKERAEKAKRDLAEE
IESLKMELLDTGNTSEEQQSVLRKKEVELQNFKKSFEDETKRTELEMQEI
RKKAAVTIENLNNQIEAANKSKLVVEKAKLQLQEELNDANNELANLRSSK
ADSEKLKKNTELQLSEISHRLSESEEHKLDAESKLKKQTELADKLAMNLE
EIESKLSQLTKSELSVRSQLADLQKDFEEETRLKLNAQTTLRQLESQFAL
LKDQLEEEQQSKENLESHVQALQSQMQDVKKKVEEDAQQLLEFDESRKKV
MREREELQIRLEEAINQTERSEKAKRTIQAELQDAYHALESQKNDQTQSD
RKLKKMESQVNETLNLNKKYLAEKDTLEKENREKETKIMQLQREMNANDD
KLSELENAKSLLTRQLNELVSSKDDVGKNVGSLEKAKIQLETDLENCKVT
IEELEEENATLQMNKERVEMQLTATKAQLDRELASKDEMHDEQFRIINKK
LRDAEAALEEEQKSKTAMVSLKKKIENENMDLLNQLTESEKVKEELARQI
KKYQGNSSNLQREMQELVAAKNDYLKQIKELEKRLRTSESNVNQLSEDLS
QSERAKRTIASERDEALEEIATITMARDTAIADKKRIESSISALSMDNEE
LQLLLSELEDKNKKIISQLEQVQNELNVERQNISRLENQKSTAERLNKEL
HDKIEELEMEAGKKYKATVAAQQSKIQSLDSQLDAKIEEINQANRNNKKL
ERKLKEIMALMADETKRADNAIEQIEKATGRFKKAERSLQMEQENNSALS
TQNRRLQRDLEEVNETKEARDQEIKILKTKIDRLEKRTRAGGRPLRGDGG
SDDGLSGDGESVTDSALKSVQED*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000070intestinal phagocyte
PLANA:0000120progenitor cell
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036961Kinesin_motor_dom_sf
IPR001609Myosin_head_motor_dom
IPR000048IQ_motif_EF-hand-BS
IPR002928Myosin_tail
IPR027401Myosin_IQ_contain_sf
IPR004009Myosin_N
IPR027417P-loop_NTPase
IPR008989Myosin_S1_N
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0003774motor activity
GO:0005515protein binding
GO:0051015actin filament binding
GO:0000166nucleotide binding
GO:0003779actin binding
Vocabulary: cellular component
TermDefinition
GO:0016459myosin complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1439..1522
NoneNo IPR availableCOILSCoilCoilcoord: 1081..1157
NoneNo IPR availableCOILSCoilCoilcoord: 1622..1705
NoneNo IPR availableCOILSCoilCoilcoord: 1537..1578
NoneNo IPR availableCOILSCoilCoilcoord: 1819..1937
NoneNo IPR availableCOILSCoilCoilcoord: 1397..1431
NoneNo IPR availableCOILSCoilCoilcoord: 1594..1614
NoneNo IPR availableCOILSCoilCoilcoord: 1741..1813
NoneNo IPR availableCOILSCoilCoilcoord: 1172..1263
NoneNo IPR availableCOILSCoilCoilcoord: 1285..1312
NoneNo IPR availableCOILSCoilCoilcoord: 850..1073
NoneNo IPR availableCOILSCoilCoilcoord: 1327..1389
NoneNo IPR availableGENE3DG3DSA:3.30.70.3240coord: 717..787
e-value: 1.6E-24
score: 87.9
NoneNo IPR availableGENE3DG3DSA:1.20.5.1050coord: 846..968
e-value: 3.0E-11
score: 45.4
coord: 969..1080
e-value: 1.2E-7
score: 33.8
NoneNo IPR availableGENE3DG3DSA:1.20.120.720coord: 347..646
e-value: 4.4E-282
score: 939.0
NoneNo IPR availableGENE3DG3DSA:1.20.58.530coord: 471..673
e-value: 4.4E-282
score: 939.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1905..1943
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1890..1973
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1018..1069
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1018..1079
NoneNo IPR availablePANTHERPTHR45615FAMILY NOT NAMEDcoord: 10..1937
NoneNo IPR availablePANTHERPTHR45615:SF16MYOSIN-9coord: 10..1937
NoneNo IPR availableCDDcd01377MYSc_class_IIcoord: 96..774
e-value: 0.0
score: 1247.36
NoneNo IPR availableSUPERFAMILYSSF90257Myosin rod fragmentscoord: 1244..1361
NoneNo IPR availableSUPERFAMILYSSF90257Myosin rod fragmentscoord: 846..971
NoneNo IPR availableSUPERFAMILYSSF90257Myosin rod fragmentscoord: 1472..1582
NoneNo IPR availableSUPERFAMILYSSF90257Myosin rod fragmentscoord: 961..1074
IPR001609Myosin head, motor domainPRINTSPR00193MYOSINHEAVYcoord: 462..490
score: 79.54
coord: 112..131
score: 68.08
coord: 168..193
score: 73.13
coord: 232..259
score: 79.32
coord: 516..544
score: 46.67
IPR001609Myosin head, motor domainSMARTSM00242MYSc_2acoord: 76..787
e-value: 0.0
score: 1300.5
IPR001609Myosin head, motor domainPFAMPF00063Myosin_headcoord: 85..774
e-value: 7.5E-293
score: 972.9
IPR001609Myosin head, motor domainPROSITEPS51456MYOSIN_MOTORcoord: 82..786
score: 264.309
IPR000048IQ motif, EF-hand binding siteSMARTSM00015iq_5coord: 788..810
e-value: 1.4E-4
score: 31.2
IPR000048IQ motif, EF-hand binding sitePFAMPF00612IQcoord: 791..809
e-value: 4.0E-4
score: 19.9
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 789..818
score: 9.487
IPR004009Myosin, N-terminal, SH3-likePFAMPF02736Myosin_Ncoord: 31..67
e-value: 5.6E-14
score: 51.7
IPR004009Myosin, N-terminal, SH3-likePROSITEPS51844SH3_LIKEcoord: 29..78
score: 19.331
IPR027401Myosin IQ motif-containing domain superfamilyGENE3DG3DSA:4.10.270.10coord: 788..845
e-value: 2.6E-25
score: 90.4
IPR002928Myosin tailPFAMPF01576Myosin_tail_1coord: 851..1930
e-value: 5.4E-222
score: 739.8
IPR008989Myosin S1 fragment, N-terminalGENE3DG3DSA:2.30.30.360coord: 37..76
e-value: 4.4E-282
score: 939.0
IPR008989Myosin S1 fragment, N-terminalSUPERFAMILYSSF50084Myosin S1 fragment, N-terminal domaincoord: 29..63
IPR036961Kinesin motor domain superfamilyGENE3DG3DSA:3.40.850.10coord: 77..715
e-value: 4.4E-282
score: 939.0
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 56..845