transducin-like enhancer protein 3 isoform X4

Overview
Nametransducin-like enhancer protein 3 isoform X4
Smed IDSMED30022991
Length (bp)2980
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of transducin-like enhancer protein 3 isoform X4 (SMED30022991) t-SNE clustered cells

Violin plots show distribution of expression levels for transducin-like enhancer protein 3 isoform X4 (SMED30022991) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of transducin-like enhancer protein 3 isoform X4 (SMED30022991) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for transducin-like enhancer protein 3 isoform X4 (SMED30022991) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022991

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30022991h1SMcG0019043 SmedASXL_012889SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
protonephridiaSMED30022991h1SMcG0019043 dd_Smed_v4_4112_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30022991h1SMcG0019043 dd_Smed_v4_4112_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022991h1SMcG0019043 dd_Smed_v4_4112_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022991h1SMcG0019043 dd_Smed_v4_4112_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Human
Match: TLE3 (TLE family member 3, transcriptional corepressor [Source:HGNC Symbol;Acc:HGNC:11839])

HSP 1 Score: 476.478 bits (1225), Expect = 4.075e-160
Identity = 234/381 (61.42%), Postives = 285/381 (74.80%), Query Frame = 2
Query: 1433 MGFDPALSMRGASLP-----LPMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            +GFDP   MR   LP     +P  KP YSF ++ +  M PVP   +++  PG PR+ RQ+NTL HGEVVCAVTI+N  +HVYTGGKGCVK+WD+    +                      K  ++ +DCL +D+YIRS KL+PD RT+IVGGE+STLTIWDL SPTPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L+ +K   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDISAD+KYIVTGSGDKKAT+YEV++
Sbjct:    2 VGFDPHPPMRATGLPSSLASIPGGKPAYSFHVSADGQMQPVPFPHDALAGPGIPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDISQPGS----------------------KSPISQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLASPTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHTKP--DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY 353          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Human
Match: TLE3 (TLE family member 3, transcriptional corepressor [Source:HGNC Symbol;Acc:HGNC:11839])

HSP 1 Score: 486.878 bits (1252), Expect = 6.277e-159
Identity = 235/384 (61.20%), Postives = 286/384 (74.48%), Query Frame = 2
Query: 1424 LGPMGFDPALSMRGASLP-----LPMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
             G +GFDP   MR   LP     +P  KP YSF ++ +  M PVP   +++  PG PR+ RQ+NTL HGEVVCAVTI+N  +HVYTGGKGCVK+WD+    +                      K  ++ +DCL +D+YIRS KL+PD RT+IVGGE+STLTIWDL SPTPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L+ +K   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDISAD+KYIVTGSGDKKAT+YEV++
Sbjct:  362 FGAVGFDPHPPMRATGLPSSLASIPGGKPAYSFHVSADGQMQPVPFPHDALAGPGIPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDISQPGS----------------------KSPISQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLASPTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHTKP--DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY 716          

HSP 2 Score: 118.627 bits (296), Expect = 1.295e-26
Identity = 52/69 (75.36%), Postives = 62/69 (89.86%), Query Frame = 2
Query:  203 MQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLMSQ 409
            MQRHY+MYYEMSYGLN+EMHKQ+EI+KRL  IL Q++PFLSQEHQ QVA AVERAKQVTM +LN+++ Q
Sbjct:    1 MQRHYVMYYEMSYGLNIEMHKQTEIAKRLNTILAQIMPFLSQEHQQQVAQAVERAKQVTMTELNAIIGQ 69          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Human
Match: TLE3 (TLE family member 3, transcriptional corepressor [Source:HGNC Symbol;Acc:HGNC:11839])

HSP 1 Score: 485.723 bits (1249), Expect = 9.450e-159
Identity = 234/381 (61.42%), Postives = 285/381 (74.80%), Query Frame = 2
Query: 1433 MGFDPALSMRGASLP-----LPMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            +GFDP   MR   LP     +P  KP YSF ++ +  M PVP   +++  PG PR+ RQ+NTL HGEVVCAVTI+N  +HVYTGGKGCVK+WD+    +                      K  ++ +DCL +D+YIRS KL+PD RT+IVGGE+STLTIWDL SPTPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L+ +K   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDISAD+KYIVTGSGDKKAT+YEV++
Sbjct:  348 VGFDPHPPMRATGLPSSLASIPGGKPAYSFHVSADGQMQPVPFPHDALAGPGIPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDISQPGS----------------------KSPISQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLASPTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHTKP--DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY 699          

HSP 2 Score: 93.5893 bits (231), Expect = 7.305e-19
Identity = 42/57 (73.68%), Postives = 51/57 (89.47%), Query Frame = 2
Query:  233 MSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLM 403
            MSYGLN+EMHKQ+EI+KRL  IL Q++PFLSQEHQ QVA AVERAKQVTM +LN+++
Sbjct:    1 MSYGLNIEMHKQTEIAKRLNTILAQIMPFLSQEHQQQVAQAVERAKQVTMTELNAII 57          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Human
Match: TLE3 (TLE family member 3, transcriptional corepressor [Source:HGNC Symbol;Acc:HGNC:11839])

HSP 1 Score: 487.649 bits (1254), Expect = 1.296e-158
Identity = 237/384 (61.72%), Postives = 287/384 (74.74%), Query Frame = 2
Query: 1424 LGPMGFDPALSMRGASLP-----LPMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
             G +GFDP   MR   LP     +P  KP YSF ++ +  M PVP   +++  PG PR+ RQ+NTL HGEVVCAVTI+N  +HVYTGGKGCVK+WD+                         GSK  ++ +DCL +D+YIRS KL+PD RT+IVGGE+STLTIWDL SPTPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L+ +K   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDISAD+KYIVTGSGDKKAT+YEV++
Sbjct:  406 FGAVGFDPHPPMRATGLPSSLASIPGGKPAYSFHVSADGQMQPVPFPHDALAGPGIPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDI----------------------SQPGSKSPISQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLASPTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHTKP--DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY 760          

HSP 2 Score: 176.792 bits (447), Expect = 3.796e-45
Identity = 79/113 (69.91%), Postives = 96/113 (84.96%), Query Frame = 2
Query:   74 PGQ-SFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLMSQ 409
            PGQ  F F + E+CDRIK++F ++Q QYHSLK EYDK+  EKTEMQRHY+MYYEMSYGLN+EMHKQ+EI+KRL  IL Q++PFLSQEHQ QVA AVERAKQVTM +LN+++ Q
Sbjct:   13 PGQPGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNTILAQIMPFLSQEHQQQVAQAVERAKQVTMTELNAIIGQ 125          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Human
Match: TLE3 (TLE family member 3, transcriptional corepressor [Source:HGNC Symbol;Acc:HGNC:11839])

HSP 1 Score: 487.649 bits (1254), Expect = 1.514e-158
Identity = 237/384 (61.72%), Postives = 287/384 (74.74%), Query Frame = 2
Query: 1424 LGPMGFDPALSMRGASLP-----LPMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
             G +GFDP   MR   LP     +P  KP YSF ++ +  M PVP   +++  PG PR+ RQ+NTL HGEVVCAVTI+N  +HVYTGGKGCVK+WD+                         GSK  ++ +DCL +D+YIRS KL+PD RT+IVGGE+STLTIWDL SPTPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L+ +K   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDISAD+KYIVTGSGDKKAT+YEV++
Sbjct:  408 FGAVGFDPHPPMRATGLPSSLASIPGGKPAYSFHVSADGQMQPVPFPHDALAGPGIPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDI----------------------SQPGSKSPISQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLASPTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHTKP--DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY 762          

HSP 2 Score: 176.792 bits (447), Expect = 3.758e-45
Identity = 79/113 (69.91%), Postives = 96/113 (84.96%), Query Frame = 2
Query:   74 PGQ-SFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLMSQ 409
            PGQ  F F + E+CDRIK++F ++Q QYHSLK EYDK+  EKTEMQRHY+MYYEMSYGLN+EMHKQ+EI+KRL  IL Q++PFLSQEHQ QVA AVERAKQVTM +LN+++ Q
Sbjct:    6 PGQPGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNTILAQIMPFLSQEHQQQVAQAVERAKQVTMTELNAIIGQ 118          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Celegans
Match: unc-37 (Transcription factor unc-37 [Source:UniProtKB/Swiss-Prot;Acc:O02482])

HSP 1 Score: 346.665 bits (888), Expect = 2.748e-107
Identity = 180/374 (48.13%), Postives = 247/374 (66.04%), Query Frame = 2
Query: 1442 DPALSMR-GASLPLPMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            DP    R  A++    S+P YSF I D     P    P++   PG P  +++   L HGEVVCA TI+     VYTGGKGCVK+WD++ +   G++                  +  + S+DCL K++YIRS KL  D  T+++GGE+ST+ +WDL + T     ++   + ACYALA+S + K  F C +DG I ++DIHN+  +    GH DGASC+D++  G  LW+GGLDN+VRCWD+     A  ++++K+DF SQ+FSLG CP+ +W+AVGME++ VE+L+ + +  EKYQLT H+SCVLSLK+A SGK+F STGKD+ LNAWR PYGA+LFQ  E+SSVLSCDIS D+  IVTGSG+KKATLY V +
Sbjct:  264 DPHAQARLAAAIGQIGSRPAYSFKIVDGGVPTPTSFPPDAQKGPGIPTGLKKKMELNHGEVVCAATISRDNSRVYTGGKGCVKIWDVKESDISGATVVN---------------RPPIASLDCL-KENYIRSCKLFEDGNTLLIGGEASTVALWDLTTETKTL--DLETDSQACYALAMSPDEKLLFACLADGNILIYDIHNKVKVGTLPGHQDGASCLDLSKDGTKLWSGGLDNSVRCWDL-----AQRKEVAKHDFASQVFSLGCCPNDEWVAVGMENNYVEVLSTTGK--EKYQLTQHESCVLSLKFAHSGKFFISTGKDNALNAWRTPYGASLFQLKENSSVLSCDISFDDSLIVTGSGEKKATLYAVEY 612          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Celegans
Match: unc-37 (Transcription factor unc-37 [Source:UniProtKB/Swiss-Prot;Acc:O02482])

HSP 1 Score: 346.665 bits (888), Expect = 2.748e-107
Identity = 180/374 (48.13%), Postives = 247/374 (66.04%), Query Frame = 2
Query: 1442 DPALSMR-GASLPLPMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            DP    R  A++    S+P YSF I D     P    P++   PG P  +++   L HGEVVCA TI+     VYTGGKGCVK+WD++ +   G++                  +  + S+DCL K++YIRS KL  D  T+++GGE+ST+ +WDL + T     ++   + ACYALA+S + K  F C +DG I ++DIHN+  +    GH DGASC+D++  G  LW+GGLDN+VRCWD+     A  ++++K+DF SQ+FSLG CP+ +W+AVGME++ VE+L+ + +  EKYQLT H+SCVLSLK+A SGK+F STGKD+ LNAWR PYGA+LFQ  E+SSVLSCDIS D+  IVTGSG+KKATLY V +
Sbjct:  264 DPHAQARLAAAIGQIGSRPAYSFKIVDGGVPTPTSFPPDAQKGPGIPTGLKKKMELNHGEVVCAATISRDNSRVYTGGKGCVKIWDVKESDISGATVVN---------------RPPIASLDCL-KENYIRSCKLFEDGNTLLIGGEASTVALWDLTTETKTL--DLETDSQACYALAMSPDEKLLFACLADGNILIYDIHNKVKVGTLPGHQDGASCLDLSKDGTKLWSGGLDNSVRCWDL-----AQRKEVAKHDFASQVFSLGCCPNDEWVAVGMENNYVEVLSTTGK--EKYQLTQHESCVLSLKFAHSGKFFISTGKDNALNAWRTPYGASLFQLKENSSVLSCDISFDDSLIVTGSGEKKATLYAVEY 612          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Celegans
Match: plrg-1 (PLeiotropic ReGulator (Vertebrate) homolog [Source:UniProtKB/TrEMBL;Acc:G5EEL2])

HSP 1 Score: 68.5514 bits (166), Expect = 9.984e-12
Identity = 52/235 (22.13%), Postives = 101/235 (42.98%), Query Frame = 2
Query: 1820 YIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGD-WLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGS 2521
            ++R++ + P  +    GG    + IWDL S   + K  +T    +  A+ +S    F F+   D  +  WD+    +I+H+ GH      + + P  + L T   D+T R WD+R        Q+  +   +   +   C S D  +      + V + +++        LT H   V +L        FAS   D+ +  W++P G  +   +  +++++   S D+  +V+G+
Sbjct:  130 WVRAVDVEPGNQWFASGGADRIIKIWDLASG--QLKLSLTGHISSVRAVKVSPRHPFLFSGGEDKQVKCWDLEYNKVIRHYHGHLSAVQALSVHPSLDVLVTCARDSTARVWDMRTKA-----QVHCFAGHTNTVADVVCQSVDPQVITASHDATVRLWDLA-AGRSMCTLTHHKKSVRALTIHPRLNMFASASPDN-IKQWKLPKGEFMQNLSGHNAIINTLSSNDDGVVVSGA 355          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Celegans
Match: plrg-1 (PLeiotropic ReGulator (Vertebrate) homolog [Source:UniProtKB/TrEMBL;Acc:G5EEL2])

HSP 1 Score: 68.9366 bits (167), Expect = 1.040e-11
Identity = 52/235 (22.13%), Postives = 101/235 (42.98%), Query Frame = 2
Query: 1820 YIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGD-WLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGS 2521
            ++R++ + P  +    GG    + IWDL S   + K  +T    +  A+ +S    F F+   D  +  WD+    +I+H+ GH      + + P  + L T   D+T R WD+R        Q+  +   +   +   C S D  +      + V + +++        LT H   V +L        FAS   D+ +  W++P G  +   +  +++++   S D+  +V+G+
Sbjct:  186 WVRAVDVEPGNQWFASGGADRIIKIWDLASG--QLKLSLTGHISSVRAVKVSPRHPFLFSGGEDKQVKCWDLEYNKVIRHYHGHLSAVQALSVHPSLDVLVTCARDSTARVWDMRTKA-----QVHCFAGHTNTVADVVCQSVDPQVITASHDATVRLWDLA-AGRSMCTLTHHKKSVRALTIHPRLNMFASASPDN-IKQWKLPKGEFMQNLSGHNAIINTLSSNDDGVVVSGA 411          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Celegans
Match: plrg-1 (PLeiotropic ReGulator (Vertebrate) homolog [Source:UniProtKB/TrEMBL;Acc:G5EEL2])

HSP 1 Score: 68.9366 bits (167), Expect = 1.040e-11
Identity = 52/235 (22.13%), Postives = 101/235 (42.98%), Query Frame = 2
Query: 1820 YIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGD-WLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGS 2521
            ++R++ + P  +    GG    + IWDL S   + K  +T    +  A+ +S    F F+   D  +  WD+    +I+H+ GH      + + P  + L T   D+T R WD+R        Q+  +   +   +   C S D  +      + V + +++        LT H   V +L        FAS   D+ +  W++P G  +   +  +++++   S D+  +V+G+
Sbjct:  186 WVRAVDVEPGNQWFASGGADRIIKIWDLASG--QLKLSLTGHISSVRAVKVSPRHPFLFSGGEDKQVKCWDLEYNKVIRHYHGHLSAVQALSVHPSLDVLVTCARDSTARVWDMRTKA-----QVHCFAGHTNTVADVVCQSVDPQVITASHDATVRLWDLA-AGRSMCTLTHHKKSVRALTIHPRLNMFASASPDN-IKQWKLPKGEFMQNLSGHNAIINTLSSNDDGVVVSGA 411          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Fly
Match: gro (gene:FBgn0001139 transcript:FBtr0084962)

HSP 1 Score: 479.559 bits (1233), Expect = 2.247e-156
Identity = 231/381 (60.63%), Postives = 288/381 (75.59%), Query Frame = 2
Query: 1430 PMGFDPALSMRGASLPLPMS----KP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            PM +DP   +R   +P P +    KP YSF +N   ++ PVP  P+++   G PR+ RQ+NTL HGEVVCAVTI+N  K+VYTGGKGCVKVWD+                         G+K  ++ +DCLQ+D+YIRS+KL+PD RT+IVGGE+S L+IWDL SPTPR K E+T +APACYALAIS + K CF+C SDG IAVWD+HN+ +++ FQGH DGASCIDI+P G+ LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+GDWLAVGME+S VE+L+ SK +  KYQL LH+SCVLSL++AA GKWF STGKD+LLNAWR PYGA++FQS E+SSVLSCDIS D+KYIVTGSGDKKAT+YEV++
Sbjct:  368 PMPYDPHAHVRTNGIPHPSALTGGKPAYSFHMNGEGSLQPVPFPPDALVGVGIPRHARQINTLSHGEVVCAVTISNPTKYVYTGGKGCVKVWDI----------------------SQPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLASPTPRIKAELTSAAPACYALAISPDSKVCFSCCSDGNIAVWDLHNEILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLRE-----GRQLQQHDFSSQIFSLGYCPTGDWLAVGMENSHVEVLHASKPD--KYQLHLHESCVLSLRFAACGKWFVSTGKDNLLNAWRTPYGASIFQSKETSSVLSCDISTDDKYIVTGSGDKKATVYEVIY 719          

HSP 2 Score: 151.754 bits (382), Expect = 1.839e-37
Identity = 69/114 (60.53%), Postives = 88/114 (77.19%), Query Frame = 2
Query:   68 PPPGQSFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLMSQ 409
            PPP     F I +  +RIKE+F ++Q QYHS+K E +K+  EKTEMQRHY+MYYEMSYGLNVEMHKQ+EI+KRL  ++ Q++PFL  +HQ QV  AVERAKQVTM +LN ++ Q
Sbjct:   14 PPPQGPIKFTIADTLERIKEEFNFLQAQYHSIKLECEKLSNEKTEMQRHYVMYYEMSYGLNVEMHKQTEIAKRLNTLINQLLPFLQADHQQQVLQAVERAKQVTMQELNLIIGQ 127          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Fly
Match: gro (gene:FBgn0001139 transcript:FBtr0084965)

HSP 1 Score: 479.559 bits (1233), Expect = 2.247e-156
Identity = 231/381 (60.63%), Postives = 288/381 (75.59%), Query Frame = 2
Query: 1430 PMGFDPALSMRGASLPLPMS----KP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            PM +DP   +R   +P P +    KP YSF +N   ++ PVP  P+++   G PR+ RQ+NTL HGEVVCAVTI+N  K+VYTGGKGCVKVWD+                         G+K  ++ +DCLQ+D+YIRS+KL+PD RT+IVGGE+S L+IWDL SPTPR K E+T +APACYALAIS + K CF+C SDG IAVWD+HN+ +++ FQGH DGASCIDI+P G+ LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+GDWLAVGME+S VE+L+ SK +  KYQL LH+SCVLSL++AA GKWF STGKD+LLNAWR PYGA++FQS E+SSVLSCDIS D+KYIVTGSGDKKAT+YEV++
Sbjct:  368 PMPYDPHAHVRTNGIPHPSALTGGKPAYSFHMNGEGSLQPVPFPPDALVGVGIPRHARQINTLSHGEVVCAVTISNPTKYVYTGGKGCVKVWDI----------------------SQPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLASPTPRIKAELTSAAPACYALAISPDSKVCFSCCSDGNIAVWDLHNEILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLRE-----GRQLQQHDFSSQIFSLGYCPTGDWLAVGMENSHVEVLHASKPD--KYQLHLHESCVLSLRFAACGKWFVSTGKDNLLNAWRTPYGASIFQSKETSSVLSCDISTDDKYIVTGSGDKKATVYEVIY 719          

HSP 2 Score: 151.754 bits (382), Expect = 1.839e-37
Identity = 69/114 (60.53%), Postives = 88/114 (77.19%), Query Frame = 2
Query:   68 PPPGQSFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLMSQ 409
            PPP     F I +  +RIKE+F ++Q QYHS+K E +K+  EKTEMQRHY+MYYEMSYGLNVEMHKQ+EI+KRL  ++ Q++PFL  +HQ QV  AVERAKQVTM +LN ++ Q
Sbjct:   14 PPPQGPIKFTIADTLERIKEEFNFLQAQYHSIKLECEKLSNEKTEMQRHYVMYYEMSYGLNVEMHKQTEIAKRLNTLINQLLPFLQADHQQQVLQAVERAKQVTMQELNLIIGQ 127          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Fly
Match: gro (gene:FBgn0001139 transcript:FBtr0084964)

HSP 1 Score: 479.559 bits (1233), Expect = 2.247e-156
Identity = 231/381 (60.63%), Postives = 288/381 (75.59%), Query Frame = 2
Query: 1430 PMGFDPALSMRGASLPLPMS----KP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            PM +DP   +R   +P P +    KP YSF +N   ++ PVP  P+++   G PR+ RQ+NTL HGEVVCAVTI+N  K+VYTGGKGCVKVWD+                         G+K  ++ +DCLQ+D+YIRS+KL+PD RT+IVGGE+S L+IWDL SPTPR K E+T +APACYALAIS + K CF+C SDG IAVWD+HN+ +++ FQGH DGASCIDI+P G+ LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+GDWLAVGME+S VE+L+ SK +  KYQL LH+SCVLSL++AA GKWF STGKD+LLNAWR PYGA++FQS E+SSVLSCDIS D+KYIVTGSGDKKAT+YEV++
Sbjct:  368 PMPYDPHAHVRTNGIPHPSALTGGKPAYSFHMNGEGSLQPVPFPPDALVGVGIPRHARQINTLSHGEVVCAVTISNPTKYVYTGGKGCVKVWDI----------------------SQPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLASPTPRIKAELTSAAPACYALAISPDSKVCFSCCSDGNIAVWDLHNEILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLRE-----GRQLQQHDFSSQIFSLGYCPTGDWLAVGMENSHVEVLHASKPD--KYQLHLHESCVLSLRFAACGKWFVSTGKDNLLNAWRTPYGASIFQSKETSSVLSCDISTDDKYIVTGSGDKKATVYEVIY 719          

HSP 2 Score: 151.754 bits (382), Expect = 1.839e-37
Identity = 69/114 (60.53%), Postives = 88/114 (77.19%), Query Frame = 2
Query:   68 PPPGQSFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLMSQ 409
            PPP     F I +  +RIKE+F ++Q QYHS+K E +K+  EKTEMQRHY+MYYEMSYGLNVEMHKQ+EI+KRL  ++ Q++PFL  +HQ QV  AVERAKQVTM +LN ++ Q
Sbjct:   14 PPPQGPIKFTIADTLERIKEEFNFLQAQYHSIKLECEKLSNEKTEMQRHYVMYYEMSYGLNVEMHKQTEIAKRLNTLINQLLPFLQADHQQQVLQAVERAKQVTMQELNLIIGQ 127          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Fly
Match: gro (gene:FBgn0001139 transcript:FBtr0084963)

HSP 1 Score: 479.559 bits (1233), Expect = 2.247e-156
Identity = 231/381 (60.63%), Postives = 288/381 (75.59%), Query Frame = 2
Query: 1430 PMGFDPALSMRGASLPLPMS----KP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            PM +DP   +R   +P P +    KP YSF +N   ++ PVP  P+++   G PR+ RQ+NTL HGEVVCAVTI+N  K+VYTGGKGCVKVWD+                         G+K  ++ +DCLQ+D+YIRS+KL+PD RT+IVGGE+S L+IWDL SPTPR K E+T +APACYALAIS + K CF+C SDG IAVWD+HN+ +++ FQGH DGASCIDI+P G+ LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+GDWLAVGME+S VE+L+ SK +  KYQL LH+SCVLSL++AA GKWF STGKD+LLNAWR PYGA++FQS E+SSVLSCDIS D+KYIVTGSGDKKAT+YEV++
Sbjct:  368 PMPYDPHAHVRTNGIPHPSALTGGKPAYSFHMNGEGSLQPVPFPPDALVGVGIPRHARQINTLSHGEVVCAVTISNPTKYVYTGGKGCVKVWDI----------------------SQPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLASPTPRIKAELTSAAPACYALAISPDSKVCFSCCSDGNIAVWDLHNEILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLRE-----GRQLQQHDFSSQIFSLGYCPTGDWLAVGMENSHVEVLHASKPD--KYQLHLHESCVLSLRFAACGKWFVSTGKDNLLNAWRTPYGASIFQSKETSSVLSCDISTDDKYIVTGSGDKKATVYEVIY 719          

HSP 2 Score: 151.754 bits (382), Expect = 1.839e-37
Identity = 69/114 (60.53%), Postives = 88/114 (77.19%), Query Frame = 2
Query:   68 PPPGQSFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLMSQ 409
            PPP     F I +  +RIKE+F ++Q QYHS+K E +K+  EKTEMQRHY+MYYEMSYGLNVEMHKQ+EI+KRL  ++ Q++PFL  +HQ QV  AVERAKQVTM +LN ++ Q
Sbjct:   14 PPPQGPIKFTIADTLERIKEEFNFLQAQYHSIKLECEKLSNEKTEMQRHYVMYYEMSYGLNVEMHKQTEIAKRLNTLINQLLPFLQADHQQQVLQAVERAKQVTMQELNLIIGQ 127          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Fly
Match: gro (gene:FBgn0001139 transcript:FBtr0302951)

HSP 1 Score: 479.559 bits (1233), Expect = 2.247e-156
Identity = 231/381 (60.63%), Postives = 288/381 (75.59%), Query Frame = 2
Query: 1430 PMGFDPALSMRGASLPLPMS----KP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            PM +DP   +R   +P P +    KP YSF +N   ++ PVP  P+++   G PR+ RQ+NTL HGEVVCAVTI+N  K+VYTGGKGCVKVWD+                         G+K  ++ +DCLQ+D+YIRS+KL+PD RT+IVGGE+S L+IWDL SPTPR K E+T +APACYALAIS + K CF+C SDG IAVWD+HN+ +++ FQGH DGASCIDI+P G+ LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+GDWLAVGME+S VE+L+ SK +  KYQL LH+SCVLSL++AA GKWF STGKD+LLNAWR PYGA++FQS E+SSVLSCDIS D+KYIVTGSGDKKAT+YEV++
Sbjct:  368 PMPYDPHAHVRTNGIPHPSALTGGKPAYSFHMNGEGSLQPVPFPPDALVGVGIPRHARQINTLSHGEVVCAVTISNPTKYVYTGGKGCVKVWDI----------------------SQPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLASPTPRIKAELTSAAPACYALAISPDSKVCFSCCSDGNIAVWDLHNEILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLRE-----GRQLQQHDFSSQIFSLGYCPTGDWLAVGMENSHVEVLHASKPD--KYQLHLHESCVLSLRFAACGKWFVSTGKDNLLNAWRTPYGASIFQSKETSSVLSCDISTDDKYIVTGSGDKKATVYEVIY 719          

HSP 2 Score: 151.754 bits (382), Expect = 1.839e-37
Identity = 69/114 (60.53%), Postives = 88/114 (77.19%), Query Frame = 2
Query:   68 PPPGQSFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLMSQ 409
            PPP     F I +  +RIKE+F ++Q QYHS+K E +K+  EKTEMQRHY+MYYEMSYGLNVEMHKQ+EI+KRL  ++ Q++PFL  +HQ QV  AVERAKQVTM +LN ++ Q
Sbjct:   14 PPPQGPIKFTIADTLERIKEEFNFLQAQYHSIKLECEKLSNEKTEMQRHYVMYYEMSYGLNVEMHKQTEIAKRLNTLINQLLPFLQADHQQQVLQAVERAKQVTMQELNLIIGQ 127          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Zebrafish
Match: tle3b (TLE family member 3, transcriptional corepressor b [Source:NCBI gene;Acc:100007463])

HSP 1 Score: 483.797 bits (1244), Expect = 2.121e-157
Identity = 236/380 (62.11%), Postives = 285/380 (75.00%), Query Frame = 2
Query: 1436 GFDPALSMRGASLP-----LPMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            GFDP   MR   LP     +P  KP YSF ++ +  M PVP  P+++  PG PR+ RQ+NTL HGEVVCAVTI+N  +HVYTGGKGCVK+WD+                         GSK  ++ +DCL +D+YIRS KL+PD RT+IVGGE+STLTIWDL S TPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L+ +K   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDISAD+KYIVTGSGDKKAT+YEV++
Sbjct:  406 GFDPHPHMRAPVLPASLTSIPGGKPAYSFHVSADGQMQPVPFPPDALIGPGIPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDI----------------------SQPGSKSPVSQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLASQTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHTKP--DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY 756          

HSP 2 Score: 134.42 bits (337), Expect = 9.598e-32
Identity = 65/111 (58.56%), Postives = 81/111 (72.97%), Query Frame = 2
Query:   74 PGQ-SFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLM 403
            PGQ  F F + E+CDRIK++F ++Q QYHSLK EYDK+  EKTEMQRHY+M               +EI+KRL AIL Q++PFLSQEHQ QVA AVERAKQVTM +LN+++
Sbjct:   13 PGQPGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRHYVM---------------TEIAKRLNAILAQIMPFLSQEHQQQVAQAVERAKQVTMTELNAII 108          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Zebrafish
Match: tle3b (TLE family member 3, transcriptional corepressor b [Source:NCBI gene;Acc:100007463])

HSP 1 Score: 483.797 bits (1244), Expect = 3.001e-157
Identity = 236/380 (62.11%), Postives = 285/380 (75.00%), Query Frame = 2
Query: 1436 GFDPALSMRGASLP-----LPMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            GFDP   MR   LP     +P  KP YSF ++ +  M PVP  P+++  PG PR+ RQ+NTL HGEVVCAVTI+N  +HVYTGGKGCVK+WD+                         GSK  ++ +DCL +D+YIRS KL+PD RT+IVGGE+STLTIWDL S TPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L+ +K   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDISAD+KYIVTGSGDKKAT+YEV++
Sbjct:  421 GFDPHPHMRAPVLPASLTSIPGGKPAYSFHVSADGQMQPVPFPPDALIGPGIPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDI----------------------SQPGSKSPVSQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLASQTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHTKP--DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY 771          

HSP 2 Score: 176.407 bits (446), Expect = 3.286e-45
Identity = 79/111 (71.17%), Postives = 96/111 (86.49%), Query Frame = 2
Query:   74 PGQ-SFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLM 403
            PGQ  F F + E+CDRIK++F ++Q QYHSLK EYDK+  EKTEMQRHY+MYYEMSYGLN+EMHKQ+EI+KRL AIL Q++PFLSQEHQ QVA AVERAKQVTM +LN+++
Sbjct:   13 PGQPGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNAILAQIMPFLSQEHQQQVAQAVERAKQVTMTELNAII 123          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Zebrafish
Match: tle3b (TLE family member 3, transcriptional corepressor b [Source:NCBI gene;Acc:100007463])

HSP 1 Score: 483.797 bits (1244), Expect = 3.001e-157
Identity = 236/380 (62.11%), Postives = 285/380 (75.00%), Query Frame = 2
Query: 1436 GFDPALSMRGASLP-----LPMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            GFDP   MR   LP     +P  KP YSF ++ +  M PVP  P+++  PG PR+ RQ+NTL HGEVVCAVTI+N  +HVYTGGKGCVK+WD+                         GSK  ++ +DCL +D+YIRS KL+PD RT+IVGGE+STLTIWDL S TPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L+ +K   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDISAD+KYIVTGSGDKKAT+YEV++
Sbjct:  421 GFDPHPHMRAPVLPASLTSIPGGKPAYSFHVSADGQMQPVPFPPDALIGPGIPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDI----------------------SQPGSKSPVSQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLASQTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHTKP--DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY 771          

HSP 2 Score: 176.407 bits (446), Expect = 3.286e-45
Identity = 79/111 (71.17%), Postives = 96/111 (86.49%), Query Frame = 2
Query:   74 PGQ-SFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLM 403
            PGQ  F F + E+CDRIK++F ++Q QYHSLK EYDK+  EKTEMQRHY+MYYEMSYGLN+EMHKQ+EI+KRL AIL Q++PFLSQEHQ QVA AVERAKQVTM +LN+++
Sbjct:   13 PGQPGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNAILAQIMPFLSQEHQQQVAQAVERAKQVTMTELNAII 123          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Zebrafish
Match: tle2b (TLE family member 2, transcriptional corepressor b [Source:ZFIN;Acc:ZDB-GENE-050208-677])

HSP 1 Score: 461.07 bits (1185), Expect = 9.695e-155
Identity = 218/354 (61.58%), Postives = 272/354 (76.84%), Query Frame = 2
Query: 1496 YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            YSF ++ +  M PVP  P+++  PG PR+ RQ++TL HGEVVCAVTI+ + +HVYTGGKGCVKVWD+    +                      K  +  +DCL +D+YIRS K++PD RT+IVGGE+STL+IWDL +PTPR K E+T SAPACYALAIS + K CF+C SDG I VWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVRCWD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L++SK   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS E+SSVLSCD+S D+KYIVTGSGDKKAT+YEV++
Sbjct:    2 YSFHVSADGQMQPVPFPPDALLGPGIPRHARQIHTLSHGEVVCAVTISTSTRHVYTGGKGCVKVWDISQPGS----------------------KSPMAQLDCLNRDNYIRSCKILPDGRTLIVGGEASTLSIWDLATPTPRIKAELTSSAPACYALAISPDNKVCFSCCSDGNIVVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRCWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVSKP--DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKETSSVLSCDVSPDDKYIVTGSGDKKATVYEVVY 326          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Zebrafish
Match: tle3a (TLE family member 3, transcriptional corepressor a [Source:NCBI gene;Acc:30206])

HSP 1 Score: 475.322 bits (1222), Expect = 5.275e-154
Identity = 231/373 (61.93%), Postives = 281/373 (75.34%), Query Frame = 2
Query: 1457 MRGASLPLPMS-----KP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            MR   LP  ++     KP YSF ++ +  M PVP  P+++  PG PR+ RQ+NTL HGEVVCAVTI+N  +HVYTGGKGCVK+WD+                         GSK  ++ +DCL +D+YIRS KL+PD RT+IVGGE+STLTIWDL S TPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L+ +K   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDISAD+KYIVTGSGDKKAT+YEV++
Sbjct:  419 MRAPGLPASLTSISGGKPAYSFHVSADGQMQPVPFPPDALIGPGIPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDI----------------------SQPGSKSPVSQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLASQTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHTKP--DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY 762          

HSP 2 Score: 176.792 bits (447), Expect = 2.391e-45
Identity = 79/111 (71.17%), Postives = 96/111 (86.49%), Query Frame = 2
Query:   74 PGQ-SFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLM 403
            PGQ  F F + E+CDRIK++F ++Q QYHSLK EYDK+  EKTEMQRHY+MYYEMSYGLN+EMHKQ+EI+KRL AIL Q++PFLSQEHQ QVA AVERAKQVTM +LN+++
Sbjct:   13 PGQPGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNAILAQIMPFLSQEHQQQVAQAVERAKQVTMTELNAII 123          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Xenopus
Match: fbxw4 (F-box and WD repeat domain containing 4 [Source:Xenbase;Acc:XB-GENE-852986])

HSP 1 Score: 478.404 bits (1230), Expect = 6.052e-156
Identity = 230/381 (60.37%), Postives = 285/381 (74.80%), Query Frame = 2
Query: 1433 MGFDPALSMRGASLP-----LPMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            +GFDP   MR   +P     +P  KP YSF ++ +  M PVP  P+++  PG PR+ RQ+NTL HGEVVCAVTI+N  +HVYTGGKGCVKVWD+                           K  ++ +DCL +D+YIRS +L+PD RT+IVGGE+STL+IWDL +PTPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGME+S VE+L+++K   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDIS D+KYIVTGSGDKKAT+YEV++
Sbjct:  348 VGFDPHHHMRVPGIPPNLTGIPGGKPAYSFHVSADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGN----------------------KSPVSQLDCLNRDNYIRSCRLLPDGRTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMENSNVEVLHVTKP--DKYQLHLHESCVLSLKFAHCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY 699          

HSP 2 Score: 172.555 bits (436), Expect = 5.353e-44
Identity = 84/125 (67.20%), Postives = 98/125 (78.40%), Query Frame = 2
Query:   47 SIMFP-TRPP-----PGQSFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLM 403
            S M+P TR P     P Q F F I E+CDRIKE+F ++Q QYHSLK E +K+  EKTEMQRHY+MYYEMSYGLN+EMHKQ+EI KRL AI  QVIPFLSQEHQ QV  AVERAKQVTM +LN+++
Sbjct:    6 SKMYPQTRHPAAPHQPAQPFKFTISESCDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNAICAQVIPFLSQEHQQQVVQAVERAKQVTMAELNAII 130          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Xenopus
Match: fbxw4 (F-box and WD repeat domain containing 4 [Source:Xenbase;Acc:XB-GENE-852986])

HSP 1 Score: 479.174 bits (1232), Expect = 8.217e-156
Identity = 231/382 (60.47%), Postives = 286/382 (74.87%), Query Frame = 2
Query: 1430 PMGFDPALSMRGASLP-----LPMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            P+GFDP   MR   +P     +P  KP YSF ++ +  M PVP  P+++  PG PR+ RQ+NTL HGEVVCAVTI+N  +HVYTGGKGCVKVWD+                           K  ++ +DCL +D+YIRS +L+PD RT+IVGGE+STL+IWDL +PTPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGME+S VE+L+++K   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDIS D+KYIVTGSGDKKAT+YEV++
Sbjct:  379 PVGFDPHHHMRVPGIPPNLTGIPGGKPAYSFHVSADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGN----------------------KSPVSQLDCLNRDNYIRSCRLLPDGRTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMENSNVEVLHVTKP--DKYQLHLHESCVLSLKFAHCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY 731          

HSP 2 Score: 98.5969 bits (244), Expect = 2.062e-20
Identity = 52/110 (47.27%), Postives = 66/110 (60.00%), Query Frame = 2
Query:   74 PGQSFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLM 403
            P Q F F I E+CDRIKE+F ++Q QYHSLK E +K+  EKTEMQRHY+M  ++          Q E    L     Q   +    HQ QV  AVERAKQVTM +LN+++
Sbjct:   20 PAQPFKFTISESCDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMVRKL----------QGECKLYLHLCCPQFCLYF--YHQQQVVQAVERAKQVTMAELNAII 117          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Xenopus
Match: tle1 (transducin like enhancer of split 1 [Source:NCBI gene;Acc:100101799])

HSP 1 Score: 477.248 bits (1227), Expect = 1.862e-155
Identity = 234/383 (61.10%), Postives = 286/383 (74.67%), Query Frame = 2
Query: 1430 PM-GFDPALSMRGASLP-----LPMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            PM GFDP   MR   +P     +P  KP YSF +  +  M PVP  P+++  PG PR+ RQ+NTL HGEVVCAVTI+N  +HVYTGGKGCVKVWD+                         G+K  ++ +DCL +D+YIRS KL+PD  T+IVGGE+STL+IWDL +PTPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L+++K   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDIS D+KYIVTGSGDKKAT+YEV++
Sbjct:  343 PMSGFDPPPHMRVPGMPPNLAGIPGGKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDI----------------------SQPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKP--DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISIDDKYIVTGSGDKKATVYEVIY 696          

HSP 2 Score: 93.5893 bits (231), Expect = 6.472e-19
Identity = 55/125 (44.00%), Postives = 66/125 (52.80%), Query Frame = 2
Query:   53 MFPT--RPPP----GQSFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLMSQ 409
            MFP    P P    GQ F F IPE+ DRIKE+F ++Q QYHSLK E +K+  EKTEMQRHY+M                                    HQ QVA AVERAKQVTM +LN+++ Q
Sbjct:    1 MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVM------------------------------------HQQQVAQAVERAKQVTMAELNAIIGQ 89          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Xenopus
Match: fbxw4 (F-box and WD repeat domain containing 4 [Source:Xenbase;Acc:XB-GENE-852986])

HSP 1 Score: 479.559 bits (1233), Expect = 2.004e-155
Identity = 231/381 (60.63%), Postives = 287/381 (75.33%), Query Frame = 2
Query: 1433 MGFDPALSMRGASLP-----LPMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            +GFDP   MR   +P     +P  KP YSF ++ +  M PVP  P+++  PG PR+ RQ+NTL HGEVVCAVTI+N  +HVYTGGKGCVKVWD+                         G+K  ++ +DCL +D+YIRS +L+PD RT+IVGGE+STL+IWDL +PTPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGME+S VE+L+++K   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDIS D+KYIVTGSGDKKAT+YEV++
Sbjct:  422 VGFDPHHHMRVPGIPPNLTGIPGGKPAYSFHVSADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDI----------------------SHPGNKSPVSQLDCLNRDNYIRSCRLLPDGRTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMENSNVEVLHVTKP--DKYQLHLHESCVLSLKFAHCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY 773          

HSP 2 Score: 174.096 bits (440), Expect = 2.857e-44
Identity = 85/127 (66.93%), Postives = 99/127 (77.95%), Query Frame = 2
Query:   47 SIMFP-TRPP-----PGQSFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLMSQ 409
            S M+P TR P     P Q F F I E+CDRIKE+F ++Q QYHSLK E +K+  EKTEMQRHY+MYYEMSYGLN+EMHKQ+EI KRL AI  QVIPFLSQEHQ QV  AVERAKQVTM +LN+++ Q
Sbjct:    6 SKMYPQTRHPAAPHQPAQPFKFTISESCDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNAICAQVIPFLSQEHQQQVVQAVERAKQVTMAELNAIIGQ 132          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Xenopus
Match: fbxw4 (F-box and WD repeat domain containing 4 [Source:Xenbase;Acc:XB-GENE-852986])

HSP 1 Score: 477.248 bits (1227), Expect = 2.043e-155
Identity = 230/381 (60.37%), Postives = 285/381 (74.80%), Query Frame = 2
Query: 1433 MGFDPALSMRGASLP-----LPMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            +GFDP   MR   +P     +P  KP YSF ++ +  M PVP  P+++  PG PR+ RQ+NTL HGEVVCAVTI+N  +HVYTGGKGCVKVWD+                           K  ++ +DCL +D+YIRS +L+PD RT+IVGGE+STL+IWDL +PTPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGME+S VE+L+++K   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDIS D+KYIVTGSGDKKAT+YEV++
Sbjct:  354 VGFDPHHHMRVPGIPPNLTGIPGGKPAYSFHVSADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGN----------------------KSPVSQLDCLNRDNYIRSCRLLPDGRTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMENSNVEVLHVTKP--DKYQLHLHESCVLSLKFAHCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY 705          

HSP 2 Score: 135.191 bits (339), Expect = 5.513e-32
Identity = 65/97 (67.01%), Postives = 75/97 (77.32%), Query Frame = 2
Query:   53 MFP-TRPP-----PGQSFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLS 325
            M+P TR P     P Q F F I E+CDRIKE+F ++Q QYHSLK E +K+  EKTEMQRHY+MYYEMSYGLN+EMHKQ+EI KRL AI  QVIPFLS
Sbjct:    1 MYPQTRHPAAPHQPAQPFKFTISESCDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNAICAQVIPFLS 97          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Mouse
Match: Tle3 (transducin-like enhancer of split 3 [Source:MGI Symbol;Acc:MGI:104634])

HSP 1 Score: 486.878 bits (1252), Expect = 3.321e-159
Identity = 235/384 (61.20%), Postives = 286/384 (74.48%), Query Frame = 2
Query: 1424 LGPMGFDPALSMRGASLP-----LPMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
             G +GFDP   MR   LP     +P  KP YSF ++ +  M PVP   +++  PG PR+ RQ+NTL HGEVVCAVTI+N  +HVYTGGKGCVK+WD+    +                      K  ++ +DCL +D+YIRS KL+PD RT+IVGGE+STLTIWDL SPTPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L+ +K   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDISAD+KYIVTGSGDKKAT+YEV++
Sbjct:  358 FGAVGFDPHPPMRATGLPSSLASIPGGKPAYSFHVSADGQMQPVPFPHDALAGPGIPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDISQPGS----------------------KSPISQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLASPTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHTKP--DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY 712          

HSP 2 Score: 118.627 bits (296), Expect = 8.544e-27
Identity = 52/69 (75.36%), Postives = 62/69 (89.86%), Query Frame = 2
Query:  203 MQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLMSQ 409
            MQRHY+MYYEMSYGLN+EMHKQ+EI+KRL  IL Q++PFLSQEHQ QVA AVERAKQVTM +LN+++ Q
Sbjct:    1 MQRHYVMYYEMSYGLNIEMHKQTEIAKRLNTILAQIMPFLSQEHQQQVAQAVERAKQVTMTELNAIIGQ 69          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Mouse
Match: Tle3 (transducin-like enhancer of split 3 [Source:MGI Symbol;Acc:MGI:104634])

HSP 1 Score: 486.878 bits (1252), Expect = 4.898e-159
Identity = 235/384 (61.20%), Postives = 286/384 (74.48%), Query Frame = 2
Query: 1424 LGPMGFDPALSMRGASLP-----LPMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
             G +GFDP   MR   LP     +P  KP YSF ++ +  M PVP   +++  PG PR+ RQ+NTL HGEVVCAVTI+N  +HVYTGGKGCVK+WD+    +                      K  ++ +DCL +D+YIRS KL+PD RT+IVGGE+STLTIWDL SPTPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L+ +K   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDISAD+KYIVTGSGDKKAT+YEV++
Sbjct:  362 FGAVGFDPHPPMRATGLPSSLASIPGGKPAYSFHVSADGQMQPVPFPHDALAGPGIPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDISQPGS----------------------KSPISQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLASPTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHTKP--DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY 716          

HSP 2 Score: 118.627 bits (296), Expect = 9.045e-27
Identity = 52/69 (75.36%), Postives = 62/69 (89.86%), Query Frame = 2
Query:  203 MQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLMSQ 409
            MQRHY+MYYEMSYGLN+EMHKQ+EI+KRL  IL Q++PFLSQEHQ QVA AVERAKQVTM +LN+++ Q
Sbjct:    1 MQRHYVMYYEMSYGLNIEMHKQTEIAKRLNTILAQIMPFLSQEHQQQVAQAVERAKQVTMTELNAIIGQ 69          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Mouse
Match: Tle3 (transducin-like enhancer of split 3 [Source:MGI Symbol;Acc:MGI:104634])

HSP 1 Score: 485.723 bits (1249), Expect = 8.805e-159
Identity = 234/381 (61.42%), Postives = 285/381 (74.80%), Query Frame = 2
Query: 1433 MGFDPALSMRGASLP-----LPMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            +GFDP   MR   LP     +P  KP YSF ++ +  M PVP   +++  PG PR+ RQ+NTL HGEVVCAVTI+N  +HVYTGGKGCVK+WD+    +                      K  ++ +DCL +D+YIRS KL+PD RT+IVGGE+STLTIWDL SPTPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L+ +K   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDISAD+KYIVTGSGDKKAT+YEV++
Sbjct:  351 VGFDPHPPMRATGLPSSLASIPGGKPAYSFHVSADGQMQPVPFPHDALAGPGIPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDISQPGS----------------------KSPISQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLASPTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHTKP--DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY 702          

HSP 2 Score: 101.293 bits (251), Expect = 2.218e-21
Identity = 45/60 (75.00%), Postives = 54/60 (90.00%), Query Frame = 2
Query:  224 YYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLM 403
            YYEMSYGLN+EMHKQ+EI+KRL  IL Q++PFLSQEHQ QVA AVERAKQVTM +LN+++
Sbjct:    1 YYEMSYGLNIEMHKQTEIAKRLNTILAQIMPFLSQEHQQQVAQAVERAKQVTMTELNAII 60          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Mouse
Match: Tle3 (transducin-like enhancer of split 3 [Source:MGI Symbol;Acc:MGI:104634])

HSP 1 Score: 487.649 bits (1254), Expect = 8.898e-159
Identity = 237/384 (61.72%), Postives = 287/384 (74.74%), Query Frame = 2
Query: 1424 LGPMGFDPALSMRGASLP-----LPMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
             G +GFDP   MR   LP     +P  KP YSF ++ +  M PVP   +++  PG PR+ RQ+NTL HGEVVCAVTI+N  +HVYTGGKGCVK+WD+                         GSK  ++ +DCL +D+YIRS KL+PD RT+IVGGE+STLTIWDL SPTPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L+ +K   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDISAD+KYIVTGSGDKKAT+YEV++
Sbjct:  406 FGAVGFDPHPPMRATGLPSSLASIPGGKPAYSFHVSADGQMQPVPFPHDALAGPGIPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDI----------------------SQPGSKSPISQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLASPTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHTKP--DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY 760          

HSP 2 Score: 176.792 bits (447), Expect = 2.630e-45
Identity = 79/113 (69.91%), Postives = 96/113 (84.96%), Query Frame = 2
Query:   74 PGQ-SFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLMSQ 409
            PGQ  F F + E+CDRIK++F ++Q QYHSLK EYDK+  EKTEMQRHY+MYYEMSYGLN+EMHKQ+EI+KRL  IL Q++PFLSQEHQ QVA AVERAKQVTM +LN+++ Q
Sbjct:   13 PGQPGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNTILAQIMPFLSQEHQQQVAQAVERAKQVTMTELNAIIGQ 125          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Mouse
Match: Tle3 (transducin-like enhancer of split 3 [Source:MGI Symbol;Acc:MGI:104634])

HSP 1 Score: 487.649 bits (1254), Expect = 9.145e-159
Identity = 237/384 (61.72%), Postives = 287/384 (74.74%), Query Frame = 2
Query: 1424 LGPMGFDPALSMRGASLP-----LPMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
             G +GFDP   MR   LP     +P  KP YSF ++ +  M PVP   +++  PG PR+ RQ+NTL HGEVVCAVTI+N  +HVYTGGKGCVK+WD+                         GSK  ++ +DCL +D+YIRS KL+PD RT+IVGGE+STLTIWDL SPTPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L+ +K   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDISAD+KYIVTGSGDKKAT+YEV++
Sbjct:  408 FGAVGFDPHPPMRATGLPSSLASIPGGKPAYSFHVSADGQMQPVPFPHDALAGPGIPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDI----------------------SQPGSKSPISQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLASPTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHTKP--DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY 762          

HSP 2 Score: 176.792 bits (447), Expect = 2.466e-45
Identity = 79/113 (69.91%), Postives = 96/113 (84.96%), Query Frame = 2
Query:   74 PGQ-SFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLMSQ 409
            PGQ  F F + E+CDRIK++F ++Q QYHSLK EYDK+  EKTEMQRHY+MYYEMSYGLN+EMHKQ+EI+KRL  IL Q++PFLSQEHQ QVA AVERAKQVTM +LN+++ Q
Sbjct:    6 PGQPGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNTILAQIMPFLSQEHQQQVAQAVERAKQVTMTELNAIIGQ 118          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. UniProt/SwissProt
Match: sp|Q08122|TLE3_MOUSE (Transducin-like enhancer protein 3 OS=Mus musculus OX=10090 GN=Tle3 PE=1 SV=3)

HSP 1 Score: 487.649 bits (1254), Expect = 9.068e-158
Identity = 237/384 (61.72%), Postives = 287/384 (74.74%), Query Frame = 2
Query: 1424 LGPMGFDPALSMRGASLP-----LPMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
             G +GFDP   MR   LP     +P  KP YSF ++ +  M PVP   +++  PG PR+ RQ+NTL HGEVVCAVTI+N  +HVYTGGKGCVK+WD+                         GSK  ++ +DCL +D+YIRS KL+PD RT+IVGGE+STLTIWDL SPTPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L+ +K   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDISAD+KYIVTGSGDKKAT+YEV++
Sbjct:  418 FGAVGFDPHPPMRATGLPSSLASIPGGKPAYSFHVSADGQMQPVPFPHDALAGPGIPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDI----------------------SQPGSKSPISQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLASPTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHTKP--DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY 772          

HSP 2 Score: 176.792 bits (447), Expect = 1.907e-44
Identity = 79/113 (69.91%), Postives = 96/113 (84.96%), Query Frame = 2
Query:   74 PGQ-SFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLMSQ 409
            PGQ  F F + E+CDRIK++F ++Q QYHSLK EYDK+  EKTEMQRHY+MYYEMSYGLN+EMHKQ+EI+KRL  IL Q++PFLSQEHQ QVA AVERAKQVTM +LN+++ Q
Sbjct:   13 PGQPGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNTILAQIMPFLSQEHQQQVAQAVERAKQVTMTELNAIIGQ 125          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. UniProt/SwissProt
Match: sp|Q04726|TLE3_HUMAN (Transducin-like enhancer protein 3 OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=2)

HSP 1 Score: 487.649 bits (1254), Expect = 9.363e-158
Identity = 237/384 (61.72%), Postives = 287/384 (74.74%), Query Frame = 2
Query: 1424 LGPMGFDPALSMRGASLP-----LPMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
             G +GFDP   MR   LP     +P  KP YSF ++ +  M PVP   +++  PG PR+ RQ+NTL HGEVVCAVTI+N  +HVYTGGKGCVK+WD+                         GSK  ++ +DCL +D+YIRS KL+PD RT+IVGGE+STLTIWDL SPTPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L+ +K   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDISAD+KYIVTGSGDKKAT+YEV++
Sbjct:  418 FGAVGFDPHPPMRATGLPSSLASIPGGKPAYSFHVSADGQMQPVPFPHDALAGPGIPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDI----------------------SQPGSKSPISQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLASPTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHTKP--DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY 772          

HSP 2 Score: 176.792 bits (447), Expect = 1.978e-44
Identity = 79/113 (69.91%), Postives = 96/113 (84.96%), Query Frame = 2
Query:   74 PGQ-SFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLMSQ 409
            PGQ  F F + E+CDRIK++F ++Q QYHSLK EYDK+  EKTEMQRHY+MYYEMSYGLN+EMHKQ+EI+KRL  IL Q++PFLSQEHQ QVA AVERAKQVTM +LN+++ Q
Sbjct:   13 PGQPGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNTILAQIMPFLSQEHQQQVAQAVERAKQVTMTELNAIIGQ 125          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. UniProt/SwissProt
Match: sp|Q9JIT3|TLE3_RAT (Transducin-like enhancer protein 3 OS=Rattus norvegicus OX=10116 GN=Tle3 PE=1 SV=1)

HSP 1 Score: 486.108 bits (1250), Expect = 2.437e-157
Identity = 236/381 (61.94%), Postives = 286/381 (75.07%), Query Frame = 2
Query: 1433 MGFDPALSMRGASLP-----LPMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            +GFDP   MR   LP     +P  KP YSF ++ +  M PVP   +++  PG PR+ RQ+NTL HGEVVCAVTI+N  +HVYTGGKGCVK+WD+                         GSK  ++ +DCL +D+YIRS KL+PD RT+IVGGE+STLTIWDL SPTPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L+ +K   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDISAD+KYIVTGSGDKKAT+YEV++
Sbjct:  413 VGFDPHPPMRATGLPSSLASIPGGKPAYSFHVSADGQMQPVPFPHDALAGPGIPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDI----------------------SQPGSKSPISQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLASPTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHTKP--DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY 764          

HSP 2 Score: 176.792 bits (447), Expect = 1.770e-44
Identity = 79/113 (69.91%), Postives = 96/113 (84.96%), Query Frame = 2
Query:   74 PGQ-SFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLMSQ 409
            PGQ  F F + E+CDRIK++F ++Q QYHSLK EYDK+  EKTEMQRHY+MYYEMSYGLN+EMHKQ+EI+KRL  IL Q++PFLSQEHQ QVA AVERAKQVTM +LN+++ Q
Sbjct:   13 PGQPGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNTILAQIMPFLSQEHQQQVAQAVERAKQVTMTELNAIIGQ 125          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. UniProt/SwissProt
Match: sp|O13168|TLE3B_DANRE (Transducin-like enhancer protein 3-B OS=Danio rerio OX=7955 GN=tle3b PE=1 SV=2)

HSP 1 Score: 483.797 bits (1244), Expect = 2.265e-156
Identity = 236/380 (62.11%), Postives = 285/380 (75.00%), Query Frame = 2
Query: 1436 GFDPALSMRGASLP-----LPMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            GFDP   MR   LP     +P  KP YSF ++ +  M PVP  P+++  PG PR+ RQ+NTL HGEVVCAVTI+N  +HVYTGGKGCVK+WD+                         GSK  ++ +DCL +D+YIRS KL+PD RT+IVGGE+STLTIWDL S TPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L+ +K   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDISAD+KYIVTGSGDKKAT+YEV++
Sbjct:  421 GFDPHPHMRAPVLPASLTSIPGGKPAYSFHVSADGQMQPVPFPPDALIGPGIPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDI----------------------SQPGSKSPVSQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLASQTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHTKP--DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY 771          

HSP 2 Score: 176.407 bits (446), Expect = 2.480e-44
Identity = 79/111 (71.17%), Postives = 96/111 (86.49%), Query Frame = 2
Query:   74 PGQ-SFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLM 403
            PGQ  F F + E+CDRIK++F ++Q QYHSLK EYDK+  EKTEMQRHY+MYYEMSYGLN+EMHKQ+EI+KRL AIL Q++PFLSQEHQ QVA AVERAKQVTM +LN+++
Sbjct:   13 PGQPGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNAILAQIMPFLSQEHQQQVAQAVERAKQVTMTELNAII 123          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. UniProt/SwissProt
Match: sp|Q04727|TLE4_HUMAN (Transducin-like enhancer protein 4 OS=Homo sapiens OX=9606 GN=TLE4 PE=1 SV=3)

HSP 1 Score: 480.715 bits (1236), Expect = 4.252e-155
Identity = 231/381 (60.63%), Postives = 288/381 (75.59%), Query Frame = 2
Query: 1433 MGFDPALSMRGASLP-----LPMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            +GFDP   MR  ++P     +P  KP YSF ++ +  M PVP  P+++  PG PR+ RQ+NTL HGEVVCAVTI+N  +HVYTGGKGCVKVWD+                         G+K  ++ +DCL +D+YIRS +L+PD RT+IVGGE+STL+IWDL +PTPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGME+S VE+L+++K   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDIS D+KYIVTGSGDKKAT+YEV++
Sbjct:  422 VGFDPHHHMRVPAIPPNLTGIPGGKPAYSFHVSADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDI----------------------SHPGNKSPVSQLDCLNRDNYIRSCRLLPDGRTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMENSNVEVLHVTKP--DKYQLHLHESCVLSLKFAHCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY 773          

HSP 2 Score: 174.866 bits (442), Expect = 8.821e-44
Identity = 85/126 (67.46%), Postives = 99/126 (78.57%), Query Frame = 2
Query:   47 SIMFP-TRPP----PGQSFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLMSQ 409
            S M+P TR P    P Q F F I E+CDRIKE+F ++Q QYHSLK E +K+  EKTEMQRHY+MYYEMSYGLN+EMHKQ+EI KRL AI  QVIPFLSQEHQ QV  AVERAKQVTM +LN+++ Q
Sbjct:    6 SKMYPQTRHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNAICAQVIPFLSQEHQQQVVQAVERAKQVTMAELNAIIGQ 131          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. TrEMBL
Match: A0A1S3HTK5 (transducin-like enhancer protein 4 isoform X5 OS=Lingula unguis OX=7574 GN=LOC106158072 PE=4 SV=1)

HSP 1 Score: 501.901 bits (1291), Expect = 3.317e-161
Identity = 243/384 (63.28%), Postives = 293/384 (76.30%), Query Frame = 2
Query: 1409 GTSGPLGPMGFDPALSMRGASLPLPMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            GT+  L  +GFDP   MR  SL +P  KP YSF ++ +  M PVP  P+++  PG PR+ RQ+NTL HGEVVCAVTI+N  +HVYTGGKGCVKVWD+                         G+K  ++ +DCLQ+D+YIRSIKL+ D RT+IVGGE+STL+IWDL +PTPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+P G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L+ SK   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDISAD+KYIVTGSGDKKATLYEV+F
Sbjct:  391 GTADRLAAVGFDPHAHMRAPSLGIPGGKPAYSFHVSADGTMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDI----------------------SQPGNKSPVSQLDCLQRDNYIRSIKLLKDGRTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISPDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHSKP--DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATLYEVIF 745          

HSP 2 Score: 189.504 bits (480), Expect = 2.918e-46
Identity = 89/132 (67.42%), Postives = 106/132 (80.30%), Query Frame = 2
Query:   53 MFPTRPP----PGQSFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLMSQGDEKYPKFH 436
            M+P R P    PGQ F F + E+CDRIKE+F+++Q QYHSLK E +K+ QEKTEMQRHY+MYYEMSYGLNVEMHKQ+EI+KRL AIL QVIPFLSQEHQ QVAAAVERAKQVTM +LN+++    +  P  H
Sbjct:    1 MYPNRHPAPHQPGQPFKFTVAESCDRIKEEFSFLQAQYHSLKMECEKLAQEKTEMQRHYVMYYEMSYGLNVEMHKQTEIAKRLNAILAQVIPFLSQEHQQQVAAAVERAKQVTMAELNAIIGMQAQHLPHAH 132          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. TrEMBL
Match: A0A1S3HWD7 (transducin-like enhancer protein 4 isoform X4 OS=Lingula unguis OX=7574 GN=LOC106158072 PE=4 SV=1)

HSP 1 Score: 501.901 bits (1291), Expect = 3.341e-161
Identity = 243/384 (63.28%), Postives = 293/384 (76.30%), Query Frame = 2
Query: 1409 GTSGPLGPMGFDPALSMRGASLPLPMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            GT+  L  +GFDP   MR  SL +P  KP YSF ++ +  M PVP  P+++  PG PR+ RQ+NTL HGEVVCAVTI+N  +HVYTGGKGCVKVWD+                         G+K  ++ +DCLQ+D+YIRSIKL+ D RT+IVGGE+STL+IWDL +PTPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+P G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L+ SK   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDISAD+KYIVTGSGDKKATLYEV+F
Sbjct:  393 GTADRLAAVGFDPHAHMRAPSLGIPGGKPAYSFHVSADGTMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDI----------------------SQPGNKSPVSQLDCLQRDNYIRSIKLLKDGRTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISPDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHSKP--DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATLYEVIF 747          

HSP 2 Score: 188.734 bits (478), Expect = 5.075e-46
Identity = 88/123 (71.54%), Postives = 104/123 (84.55%), Query Frame = 2
Query:   53 MFPTRPP----PGQSFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLMSQ 409
            M+P R P    PGQ F F + E+CDRIKE+F+++Q QYHSLK E +K+ QEKTEMQRHY+MYYEMSYGLNVEMHKQ+EI+KRL AIL QVIPFLSQEHQ QVAAAVERAKQVTM +LN+++ Q
Sbjct:    1 MYPNRHPAPHQPGQPFKFTVAESCDRIKEEFSFLQAQYHSLKMECEKLAQEKTEMQRHYVMYYEMSYGLNVEMHKQTEIAKRLNAILAQVIPFLSQEHQQQVAAAVERAKQVTMAELNAIIGQ 123          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. TrEMBL
Match: A0A1S3HTL2 (transducin-like enhancer protein 4 isoform X7 OS=Lingula unguis OX=7574 GN=LOC106158072 PE=4 SV=1)

HSP 1 Score: 501.516 bits (1290), Expect = 5.391e-161
Identity = 243/384 (63.28%), Postives = 293/384 (76.30%), Query Frame = 2
Query: 1409 GTSGPLGPMGFDPALSMRGASLPLPMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            GT+  L  +GFDP   MR  SL +P  KP YSF ++ +  M PVP  P+++  PG PR+ RQ+NTL HGEVVCAVTI+N  +HVYTGGKGCVKVWD+                         G+K  ++ +DCLQ+D+YIRSIKL+ D RT+IVGGE+STL+IWDL +PTPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+P G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L+ SK   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDISAD+KYIVTGSGDKKATLYEV+F
Sbjct:  388 GTADRLAAVGFDPHAHMRAPSLGIPGGKPAYSFHVSADGTMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDI----------------------SQPGNKSPVSQLDCLQRDNYIRSIKLLKDGRTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISPDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHSKP--DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATLYEVIF 742          

HSP 2 Score: 190.66 bits (483), Expect = 1.330e-46
Identity = 89/128 (69.53%), Postives = 107/128 (83.59%), Query Frame = 2
Query:   53 MFPTRPP----PGQSFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLMSQGDEKY 424
            M+P R P    PGQ F F + E+CDRIKE+F+++Q QYHSLK E +K+ QEKTEMQRHY+MYYEMSYGLNVEMHKQ+EI+KRL AIL QVIPFLSQEHQ QVAAAVERAKQVTM +LN+++  G +K+
Sbjct:    1 MYPNRHPAPHQPGQPFKFTVAESCDRIKEEFSFLQAQYHSLKMECEKLAQEKTEMQRHYVMYYEMSYGLNVEMHKQTEIAKRLNAILAQVIPFLSQEHQQQVAAAVERAKQVTMAELNAIIGVGGDKH 128          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. TrEMBL
Match: A0A1S3HTM6 (transducin-like enhancer protein 4 isoform X3 OS=Lingula unguis OX=7574 GN=LOC106158072 PE=4 SV=1)

HSP 1 Score: 501.516 bits (1290), Expect = 5.519e-161
Identity = 243/384 (63.28%), Postives = 293/384 (76.30%), Query Frame = 2
Query: 1409 GTSGPLGPMGFDPALSMRGASLPLPMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            GT+  L  +GFDP   MR  SL +P  KP YSF ++ +  M PVP  P+++  PG PR+ RQ+NTL HGEVVCAVTI+N  +HVYTGGKGCVKVWD+                         G+K  ++ +DCLQ+D+YIRSIKL+ D RT+IVGGE+STL+IWDL +PTPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+P G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L+ SK   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDISAD+KYIVTGSGDKKATLYEV+F
Sbjct:  399 GTADRLAAVGFDPHAHMRAPSLGIPGGKPAYSFHVSADGTMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDI----------------------SQPGNKSPVSQLDCLQRDNYIRSIKLLKDGRTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISPDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHSKP--DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATLYEVIF 753          

HSP 2 Score: 191.045 bits (484), Expect = 1.156e-46
Identity = 89/128 (69.53%), Postives = 107/128 (83.59%), Query Frame = 2
Query:   53 MFPTRPP----PGQSFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLMSQGDEKY 424
            M+P R P    PGQ F F + E+CDRIKE+F+++Q QYHSLK E +K+ QEKTEMQRHY+MYYEMSYGLNVEMHKQ+EI+KRL AIL QVIPFLSQEHQ QVAAAVERAKQVTM +LN+++  G +K+
Sbjct:    1 MYPNRHPAPHQPGQPFKFTVAESCDRIKEEFSFLQAQYHSLKMECEKLAQEKTEMQRHYVMYYEMSYGLNVEMHKQTEIAKRLNAILAQVIPFLSQEHQQQVAAAVERAKQVTMAELNAIIGVGGDKH 128          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. TrEMBL
Match: A0A1S3HUZ7 (transducin-like enhancer protein 4 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106158072 PE=4 SV=1)

HSP 1 Score: 501.516 bits (1290), Expect = 6.118e-161
Identity = 243/384 (63.28%), Postives = 293/384 (76.30%), Query Frame = 2
Query: 1409 GTSGPLGPMGFDPALSMRGASLPLPMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            GT+  L  +GFDP   MR  SL +P  KP YSF ++ +  M PVP  P+++  PG PR+ RQ+NTL HGEVVCAVTI+N  +HVYTGGKGCVKVWD+                         G+K  ++ +DCLQ+D+YIRSIKL+ D RT+IVGGE+STL+IWDL +PTPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+P G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L+ SK   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDISAD+KYIVTGSGDKKATLYEV+F
Sbjct:  401 GTADRLAAVGFDPHAHMRAPSLGIPGGKPAYSFHVSADGTMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDI----------------------SQPGNKSPVSQLDCLQRDNYIRSIKLLKDGRTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISPDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHSKP--DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATLYEVIF 755          

HSP 2 Score: 190.66 bits (483), Expect = 1.306e-46
Identity = 89/128 (69.53%), Postives = 107/128 (83.59%), Query Frame = 2
Query:   53 MFPTRPP----PGQSFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLMSQGDEKY 424
            M+P R P    PGQ F F + E+CDRIKE+F+++Q QYHSLK E +K+ QEKTEMQRHY+MYYEMSYGLNVEMHKQ+EI+KRL AIL QVIPFLSQEHQ QVAAAVERAKQVTM +LN+++  G +K+
Sbjct:    1 MYPNRHPAPHQPGQPFKFTVAESCDRIKEEFSFLQAQYHSLKMECEKLAQEKTEMQRHYVMYYEMSYGLNVEMHKQTEIAKRLNAILAQVIPFLSQEHQQQVAAAVERAKQVTMAELNAIIGVGGDKH 128          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Cavefish
Match: ENSAMXT00000040766.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000032.1:7193346:7202398:-1 gene:ENSAMXG00000032101.1 transcript:ENSAMXT00000040766.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 466.463 bits (1199), Expect = 9.966e-157
Identity = 229/373 (61.39%), Postives = 280/373 (75.07%), Query Frame = 2
Query: 1457 MRGASLPLPMS-----KP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            MR   LP  ++     KP YSF ++ +  M PVP  P+++  PG PR+ RQ+NTL HGEVVCAVTI+N  +HVYTGGKGCVK+WD+    +                      K  ++ +DCL +D+YIRS KL+PD RT+IVGGE+STLTIWDL S TPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L+ +K   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDISAD+KYIVTGSGDKKAT+YEV++
Sbjct:    1 MRAPGLPTSLTSISGGKPAYSFHVSADGQMQPVPFPPDALIGPGIPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDISQPGS----------------------KSPVSQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLASQTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHTKP--DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY 344          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Cavefish
Match: tle3a (TLE family member 3, transcriptional corepressor a [Source:NCBI gene;Acc:30206])

HSP 1 Score: 474.167 bits (1219), Expect = 7.564e-154
Identity = 229/373 (61.39%), Postives = 280/373 (75.07%), Query Frame = 2
Query: 1457 MRGASLPLPMS-----KP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            MR   LP  ++     KP YSF ++ +  M PVP  P+++  PG PR+ RQ+NTL HGEVVCAVTI+N  +HVYTGGKGCVK+WD+    +                      K  ++ +DCL +D+YIRS KL+PD RT+IVGGE+STLTIWDL S TPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L+ +K   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDISAD+KYIVTGSGDKKAT+YEV++
Sbjct:  413 MRAPGLPASLTSISGGKPAYSFHVSADGQMQPVPFPPDALIGPGIPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDISQPGS----------------------KSPVSQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLASQTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHTKP--DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY 756          

HSP 2 Score: 176.792 bits (447), Expect = 2.265e-45
Identity = 79/111 (71.17%), Postives = 96/111 (86.49%), Query Frame = 2
Query:   74 PGQ-SFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLM 403
            PGQ  F F + E+CDRIK++F ++Q QYHSLK EYDK+  EKTEMQRHY+MYYEMSYGLN+EMHKQ+EI+KRL AIL Q++PFLSQEHQ QVA AVERAKQVTM +LN+++
Sbjct:   13 PGQPGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNAILAQIMPFLSQEHQQQVAQAVERAKQVTMTELNAII 123          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Cavefish
Match: tle2a (TLE family member 2, transcriptional corepressor a [Source:ZFIN;Acc:ZDB-GENE-030131-2826])

HSP 1 Score: 470.315 bits (1209), Expect = 1.001e-152
Identity = 224/368 (60.87%), Postives = 279/368 (75.82%), Query Frame = 2
Query: 1457 MRGASLPLPMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            + G+  P    KP YSF ++ +  M PVP  P+++  PG PR+ RQ++TL HGEVVCAVTI+ + +HVYTGGKGCVKVWD+                         GSK  +  +DCL +D+YIRS KL+PD RT+IVGGE+STL+IWDL +PTPR K E+T SAPACYALAIS + K CF+C SDG I VWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVRCWD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L++SK +  KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYG+++FQS ESSSVLSCDIS D+++IVTGSGDKKAT+YEV++
Sbjct:  382 LSGSLQPAASGKPAYSFHVSADGQMQPVPFPPDALLGPGIPRHARQIHTLSHGEVVCAVTISTSTRHVYTGGKGCVKVWDI----------------------SQPGSKSPMAQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLSIWDLATPTPRIKAELTSSAPACYALAISPDNKVCFSCCSDGNIVVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRCWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVSKPD--KYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGSSIFQSKESSSVLSCDISPDDQFIVTGSGDKKATVYEVIY 720          

HSP 2 Score: 139.043 bits (349), Expect = 2.196e-33
Identity = 63/93 (67.74%), Postives = 77/93 (82.80%), Query Frame = 2
Query:  131 FAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLMSQ 409
            F ++Q QYHSLK E +K+  EKTE+QRHY+MYYEMSYGLN+EMHKQ+EI+KRL  I  Q+IPFLSQEHQ QV  A+ERAKQVTM +LN+ + Q
Sbjct:    1 FQFLQTQYHSLKLECEKLATEKTEIQRHYVMYYEMSYGLNIEMHKQTEIAKRLNVICAQLIPFLSQEHQQQVVQAMERAKQVTMGELNASIGQ 93          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Cavefish
Match: tle2b (TLE family member 2, transcriptional corepressor b [Source:ZFIN;Acc:ZDB-GENE-050208-677])

HSP 1 Score: 448.358 bits (1152), Expect = 5.807e-150
Identity = 218/354 (61.58%), Postives = 270/354 (76.27%), Query Frame = 2
Query: 1496 YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            YSF ++ +  M PVP   +++  PG PR+ RQ++TL HGEVVCAVTI+ + +HVYTGGKGCVKVWD+    +                      K  +  +DCL +D+YIRS KL+PD RT+IVGGE+STL+IWDL +PTPR K E+T SAPACYALAIS + K CF+C SDG I VWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVRCWD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L++SK   +KYQL LH+SCVLSLK+A   KWF STGKD+LLNAWR PYGA++FQS ESSSVLSCD+S D+KYIVTGSGDKKAT+YEV++
Sbjct:    2 YSFHVSADGQMQPVPFPSDALLGPGIPRHARQIHTLSHGEVVCAVTISTSTRHVYTGGKGCVKVWDISQPGS----------------------KSPMAQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLSIWDLATPTPRIKAELTSSAPACYALAISPDNKVCFSCCSDGNIVVWDLHNQTLVQ-FQGHTDGASCIDISNDGTKLWTGGLDNTVRCWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVSKP--DKYQLHLHESCVLSLKFAYC-KWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDVSPDDKYIVTGSGDKKATVYEVVY 324          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Cavefish
Match: tle2b (TLE family member 2, transcriptional corepressor b [Source:ZFIN;Acc:ZDB-GENE-050208-677])

HSP 1 Score: 426.787 bits (1096), Expect = 3.237e-141
Identity = 208/354 (58.76%), Postives = 258/354 (72.88%), Query Frame = 2
Query: 1496 YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            YSF ++ +  M PVP   +++  PG PR+ RQ++TL HGEVVCAVTI+ + +HVYTGGKGCVKVWD+    +                      K  +  +DCL +D+YIRS KL+PD RT+IVGGE+STL+IWDL +PTPR K E+T SAPACYALAIS + K CF+C SDG I VWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTV               + +   Q  IFSLGYCP+G+WLAVGMESS VE+L++SK   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCD+S D+KYIVTGSGDKKAT+YEV++
Sbjct:   38 YSFHVSADGQMQPVPFPSDALLGPGIPRHARQIHTLSHGEVVCAVTISTSTRHVYTGGKGCVKVWDISQPGS----------------------KSPMAQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLSIWDLATPTPRIKAELTSSAPACYALAISPDNKVCFSCCSDGNIVVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTV---------------LKQQQHQGIIFSLGYCPTGEWLAVGMESSNVEVLHVSKP--DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDVSPDDKYIVTGSGDKKATVYEVVY 352          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002530.1 (pep scaffold:Pmarinus_7.0:GL486002:914:6103:1 gene:ENSPMAG00000002307.1 transcript:ENSPMAT00000002530.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 472.626 bits (1215), Expect = 1.390e-159
Identity = 232/381 (60.89%), Postives = 285/381 (74.80%), Query Frame = 2
Query: 1433 MGFDPALSMRGASLP-----LPMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            +GFDP   MRG  +P     +P  KP YSF ++ +  M PVP  P+++  PG PR+ RQ++TL HGEVVCAVTI+N  +HVYTGGKGCVKVWD++                          K  ++ +DCL +D+YIRS KL+PD RT+IVGGE+STL+IWDL +PTPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L+  K   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDIS D+KYIVTGSGDKKAT+YEV++
Sbjct:    3 VGFDPHSHMRGPGIPSGLASIPGGKPAYSFHVSADGQMQPVPFPPDALIGPGIPRHARQISTLGHGEVVCAVTISNPTRHVYTGGKGCVKVWDIRDPAG----------------------KSPVSQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGMKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHCMKP--DKYQLHLHESCVLSLKFAHCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISGDDKYIVTGSGDKKATVYEVIY 354          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002471.1 (pep scaffold:Pmarinus_7.0:GL476407:90601:137795:1 gene:ENSPMAG00000002146.1 transcript:ENSPMAT00000002471.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 478.019 bits (1229), Expect = 5.194e-156
Identity = 230/381 (60.37%), Postives = 286/381 (75.07%), Query Frame = 2
Query: 1433 MGFDPALSMRGASLP-----LPMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            +GFDP   MR   +P     +P  KP YSF ++ +  M PVP  P+++  PG PR+ RQ++TL HGEVVCAVTI+N  +HVYTGGKGCVK+WD+                         G+K  ++ +DCL +++YIRS KL+PD RT+IVGGE+ST++IWDL +PTPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L+ SK   +KYQL LH+SCVLS+K+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDIS D+KYIVTGSGDKKATLYEV++
Sbjct:  406 VGFDPHPHMRAPGIPPSLAAVPSGKPAYSFHVSADGQMQPVPFPPDALMGPGIPRHARQISTLPHGEVVCAVTISNPTRHVYTGGKGCVKIWDI----------------------GQPGTKTPVSQLDCLNRENYIRSCKLLPDGRTLIVGGEASTISIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHSKP--DKYQLHLHESCVLSIKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATLYEVIY 757          

HSP 2 Score: 164.466 bits (415), Expect = 4.347e-42
Identity = 77/109 (70.64%), Postives = 89/109 (81.65%), Query Frame = 2
Query:   77 GQSFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLM 403
            GQ F F + E CDRIKE+F + Q QYHSLK E +K+  EKTEMQRHY+MYYEMSYGLN+EMHKQ+EI KRL AI  QVIPFLSQEHQ QV  AVERAKQVTM +LN+++
Sbjct:    6 GQPFKFTVTETCDRIKEEFQF-QAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQTEIVKRLNAICAQVIPFLSQEHQQQVIQAVERAKQVTMSELNAII 113          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002582.1 (pep scaffold:Pmarinus_7.0:GL476407:354021:372810:-1 gene:ENSPMAG00000002262.1 transcript:ENSPMAT00000002582.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 474.937 bits (1221), Expect = 1.152e-154
Identity = 233/382 (60.99%), Postives = 287/382 (75.13%), Query Frame = 2
Query: 1433 MGFDPALSMRGASLP--LPMS----KP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            +GFDP   MR   +P  LP S    KP YSF ++ +  M PVP  P+++  PG PR+ RQ++TL HGEVVCAVTI+N  +HVYTGGKGCVK+WD+                         G+K  ++ +DCL +D+YIRS KL+PD RT+IVGGE+ST++IWDL +PTPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L+ SK   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS E+SSVLSCDIS D+KYIVTGSGDKKATLYEV++
Sbjct:  408 VGFDPHSHMRVPGVPPSLPNSISGGKPAYSFHVSADGQMQPVPFPPDALMGPGIPRHARQISTLPHGEVVCAVTISNPTRHVYTGGKGCVKIWDI----------------------GQPGTKTPVSQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTISIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHSKP--DKYQLHLHESCVLSLKFAHCGKWFVSTGKDYLLNAWRTPYGASIFQSKETSSVLSCDISVDDKYIVTGSGDKKATLYEVIY 760          

HSP 2 Score: 163.696 bits (413), Expect = 6.580e-42
Identity = 75/108 (69.44%), Postives = 87/108 (80.56%), Query Frame = 2
Query:   80 QSFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLM 403
            Q F F I E CDRIKE+F ++Q QYHSLK E +K+  EKTEMQRHY+MYYEMSYGLN+EMHKQ EI KRL AI  Q+IPFLS EHQ QV  AVERAKQVTM +LN+++
Sbjct:    1 QPFKFAINETCDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQMEIVKRLNAICAQIIPFLSPEHQQQVIQAVERAKQVTMSELNAII 108          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Sea Lamprey
Match: POC1A (POC1 centriolar protein A [Source:HGNC Symbol;Acc:HGNC:24488])

HSP 1 Score: 78.1814 bits (191), Expect = 2.773e-15
Identity = 46/207 (22.22%), Postives = 98/207 (47.34%), Query Frame = 2
Query: 1823 IRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALA--ISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQ-SQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPY 2434
            +RS+    D ++++   +  ++ +W +     R K   +++  + +  +   S +G+   +   D  + VWD +++  +  F  H    + +D  P G  +   G DNTV+ WDIR      N+ +  Y    + + SL + P+G++L      S +++L++ +  L  Y L  H     ++ ++ +G +FAS G D  +  W+  +
Sbjct:  105 VRSVSFSADGQSLVTASDDKSIKVWTVH----RQKFLYSLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWDSNSRECVHTFYEHGGFVNQVDFHPSGTCIAAAGTDNTVKVWDIRM-----NKLLQHYQVHGAAVNSLSFHPTGNYLITASNDSTLKVLDLVEGRL-FYTLHGHQGPATAVAFSRAGDFFASGGSDEQVMVWKTNF 301          

HSP 2 Score: 65.4698 bits (158), Expect = 3.254e-11
Identity = 43/172 (25.00%), Postives = 76/172 (44.19%), Query Frame = 2
Query: 2045 SMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDF---QSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSS-VLSCDISADEKYIVTGSGDKKATLYE 2548
            S+ +HF+GH D  + +D  P    L +G +D  +  W+ +   RA       Y F   +  + S+ + PSG  L V     +   L +     E      H + V S+ ++A G+   +   D  +  W +     L+  N+ S+ V S   S D + IV+GS D+   +++
Sbjct:    9 SLERHFKGHRDTITSVDFNPNMKQLASGSMDACLMVWNFKPQTRA-------YRFVGHKDAVMSVQFSPSGH-LVVSASRDKTVRLWVPSVKGESTVFKAHTATVRSVSFSADGQSLVTASDDKSIKVWTVHRQKFLYSLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWD 172          

HSP 3 Score: 51.2174 bits (121), Expect = 8.709e-7
Identity = 30/138 (21.74%), Postives = 55/138 (39.86%), Query Frame = 2
Query: 2009 DGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAW 2422
            D  + VW+   Q+    F GH D    +  +P G+ + +   D TVR W     G +   +       + + S+ +   G  L    +   +++  + +Q    Y L  H + V S K++  G+   S   D  +  W
Sbjct:   39 DACLMVWNFKPQTRAYRFVGHKDAVMSVQFSPSGHLVVSASRDKTVRLWVPSVKGESTVFKAHT----ATVRSVSFSADGQSLVTASDDKSIKVWTVHRQKF-LYSLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVW 171          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Sea Lamprey
Match: plrg1 (pleiotropic regulator 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2787])

HSP 1 Score: 77.0258 bits (188), Expect = 8.507e-15
Identity = 56/244 (22.95%), Postives = 105/244 (43.03%), Query Frame = 2
Query: 1820 YIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGD-WLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYE 2548
            ++RSI + P  +  + G    T+ IW+L   T + K  +T        +A+S+   + F+C  D  I  WD+    +I+H+ GH   A  +D+ P  + L T G D T R WDIR         +      +   +   C + +  +  G     V + +++     +  LT H   V S+        FAS   D+ +  W+ P G      +  +++++C     +  +V+G+ +    L++
Sbjct:  215 WVRSIAVEPGNQWFVTGSADRTIKIWELA--TGKLKLSLTGHISTVRGVAVSSRSPYLFSCGEDKQIKCWDLEYNKVIRHYHGHLSAAYALDLHPTIDVLVTCGRDATARVWDIRTKA-----NVHTLTGHTNTVADVKCQAVEPQIITGSHDCTVRLWDLAAGK-SRVTLTNHKKSVRSVVLHPRQYTFASASPDN-IKQWKFPDGVFFQNLSGHNAIINCLALNSDGVLVSGADNGTMHLWD 449          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Yeast
Match: TAF5 (Subunit (90 kDa) of TFIID and SAGA complexes; involved in RNA polymerase II transcription initiation and in chromatin modification [Source:SGD;Acc:S000000402])

HSP 1 Score: 68.9366 bits (167), Expect = 2.672e-12
Identity = 47/204 (23.04%), Postives = 83/204 (40.69%), Query Frame = 2
Query: 1823 IRSIKLVPDARTMIVGGESSTLTIWDLGSPTP--RSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRM 2428
            + S    PD + ++ G E  T+ +W + + T     KG         + ++ S  G +      D    +W   +   ++ F GH +   C+   P G  ++TG  D T R WD+      D+ ++      + + S+  CP G WL+ G E   + + +I      K       + + SL Y+  G    S G DH +  W +
Sbjct:  528 VYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGH----NHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDV---STGDSVRLF-LGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDL 723          

HSP 2 Score: 54.6842 bits (130), Expect = 6.058e-8
Identity = 36/128 (28.12%), Postives = 61/128 (47.66%), Query Frame = 2
Query: 1787 LNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGA-SCIDITPKGNNLWTGGLDNTVRCWDIRE 2167
            LN +DC         +   P+   +  G    T  +WD+ S     +  +  +AP   ++A+  +G++      DG I VWDI     +K  +GH   A   +  + +GN L +GG D+TVR WD+++
Sbjct:  609 LNDVDC---------VSFHPNGCYVFTGSSDKTCRMWDV-STGDSVRLFLGHTAPVI-SIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLKK 725          

HSP 3 Score: 52.373 bits (124), Expect = 3.502e-7
Identity = 37/210 (17.62%), Postives = 88/210 (41.90%), Query Frame = 2
Query: 1952 ACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFS--------LGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQ--SNESSSVLSCDISADEKYIVTGSGDKKATLYEV 2551
              Y+ + S + K+  +   D  + +W +   + +  ++GHN     +  +P G+   T   D T R W    +            +  +IF+        + + P+G ++  G       + ++S  +  +  L  H + V+S+     G+W ++  +D ++N W +  G  L Q   +  +++ S   S +   +++G  D    ++++
Sbjct:  527 TVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHI------------YPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLG-HTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDL 723          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Yeast
Match: TUP1 (General repressor of transcription; forms complex with Cyc8p, involved in the establishment of repressive chromatin structure through interactions with histones H3 and H4, appears to enhance expression of some genes [Source:SGD;Acc:S000000680])

HSP 1 Score: 67.0106 bits (162), Expect = 9.414e-12
Identity = 52/211 (24.64%), Postives = 87/211 (41.23%), Query Frame = 2
Query: 1961 ALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQIS-KYDFQSQIFSLGYCP-SGDWLAVGMESSQVEILN------ISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSS-------------VLSCDISADEKYIVTGSGDK 2530
            ++  S +GKF      D  I +WDI N+ ++   QGH      +D  P G+ L +G  D TVR WD+R        Q S     +  + ++   P  G ++A G     V + +      + + + E    T H   V S+ +   G+   S   D  +  W +    N   S   +S             VLS   + +++YI++GS D+
Sbjct:  448 SVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLR------TGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDR 652          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Yeast
Match: PRP46 (Member of the NineTeen Complex (NTC); this complex contains Prp19p and stabilizes U6 snRNA in catalytic forms of the spliceosome containing U2, U5, and U6 snRNAs [Source:SGD;Acc:S000006072])

HSP 1 Score: 58.5362 bits (140), Expect = 3.085e-9
Identity = 29/116 (25.00%), Postives = 54/116 (46.55%), Query Frame = 2
Query: 1820 YIRSIKLVP-DARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIR 2164
            ++R + + P D    I G   +T+ +WDL   T + K  +         +A+S    + F+   D  +  WD+    +I+ + GH  G   + I P  + + T G D+ ++ WD+R
Sbjct:  141 WVRCVAIDPVDNEWFITGSNDTTMKVWDLA--TGKLKTTLAGHVMTVRDVAVSDRHPYLFSVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIKLWDMR 254          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Yeast
Match: LST8 (Protein required for the transport of Gap1p; required for the transport of amino acid permease Gap1p from the Golgi to the cell surface; component of the TOR signaling pathway; associates with both Tor1p and Tor2p; contains a WD-repeat [Source:SGD;Acc:S000004951])

HSP 1 Score: 53.1434 bits (126), Expect = 9.503e-8
Identity = 48/255 (18.82%), Postives = 99/255 (38.82%), Query Frame = 2
Query: 1808 QKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKY-----QLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSS--VLSCDISADEKYIVTGSGDKKATLYEV 2551
              DS +  +++  D + +   G  + + ++D+ +  P              +++   + ++      DG I VWD+ + S+ ++++ HN   + + I P    L +   D  +R WD+ E       Q++  D  + + SL     G  LA         +  +       +     +   H + +  +  ++  K  A+   DH    W +     L  + +     V  C  SAD  Y+VT S D    L+++
Sbjct:   30 HSDSQVNRLEITNDKKLLATAGHQN-VRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGE--NQCTHQLTPED-DTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Yeast
Match: ASC1 (G-protein beta subunit and guanine dissociation inhibitor for Gpa2p; ortholog of RACK1 that inhibits translation; core component of the small (40S) ribosomal subunit; required to prevent frameshifting at ribosomes stalled at repeated CGA codons; regulates P-body formation induced by replication stress; represses Gcn4p in the absence of amino acid starvation [Source:SGD;Acc:S000004722])

HSP 1 Score: 50.447 bits (119), Expect = 6.645e-7
Identity = 39/189 (20.63%), Postives = 83/189 (43.92%), Query Frame = 2
Query: 1970 ISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTL----HDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSG 2524
            ++A+G +  +   D  + +WD+      + F GH      +DI  K + + +G  D T++ W I+  G+     +   D+ SQ+  +    + D  +V + S+  + + +   NL ++Q+      H+S + +L  +  G   AS GKD  +  W +     ++  +    V S   S +  ++   + 
Sbjct:   73 LTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIK--GQCLATLLGHNDWVSQVRVVPNEKADD-DSVTIISAGNDKM-VKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFSLAFSPNRYWLAAATA 257          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Nematostella
Match: EDO29280 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T433])

HSP 1 Score: 462.611 bits (1189), Expect = 9.366e-154
Identity = 238/406 (58.62%), Postives = 292/406 (71.92%), Query Frame = 2
Query: 1385 LAAALGRAGTSG------PLGPMGFDPALSMRGASLPL--------PMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            L A+ G  G  G      PL  +GFDP+   R  + PL        P  KP YSF +  +  M PVP  P+++     PR+ RQ+N L HGEVVCAVTI++  +HVYTGGKGCVKVWD+  A+                       K L+++++CL +D+YIRS +L+PD RT+IVGGE+STLTIWDL S  PR K E+T +APACYALA+S + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+P G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCPSGDWLAVGME+S VE+L+ +K   +KYQL LHDSCVLSLK+A SG WF +TGKD+LLNAWR PYGA++FQS ESSSVLSCDISAD+KYIVTGSGDKKATLYEV+F
Sbjct:   95 LMASSGMPGAGGLGFGRSPL--VGFDPSGHSRLGASPLGPNLSGAPPGGKPAYSFHVAGDGQMQPVPFPPDALMGSNIPRHARQINQLNHGEVVCAVTISHPTRHVYTGGKGCVKVWDISQASG----------------------KNLVSTLECL-RDNYIRSCRLLPDGRTLIVGGEASTLTIWDLASSQPRIKAELTSNAPACYALAMSPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISPDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFSSQIFSLGYCPSGDWLAVGMENSNVEVLHQTKP--DKYQLHLHDSCVLSLKFAYSGSWFITTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATLYEVMF 468          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Nematostella
Match: EDO42310 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1W8])

HSP 1 Score: 285.419 bits (729), Expect = 3.386e-84
Identity = 148/294 (50.34%), Postives = 190/294 (64.63%), Query Frame = 2
Query: 1385 LAAALGRAGTSG------PLGPMGFDPALSMRGASLPL--------PMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQI 2221
            L A+ G  G  G      PL  +GFDP+   R  + PL        P  KP YSF +  +  M PVP  P+++     PR+ RQ+N L HGEVVCAVTI++  +HVYTGGKGCVKVWD+                        +  K L+++++CL +D+YIRS +L+PD RT+IVGGE+STLTIWDL S  PR K E+T +APACYALA+S + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+P G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQI
Sbjct:  405 LMASSGMPGAGGLGFGRSPL--VGFDPSGHSRLGASPLGPNLSGAPPGGKPAYSFHVAGDGQMQPVPFPPDALMGSNIPRHARQINQLNHGEVVCAVTISHPTRHVYTGGKGCVKVWDI----------------------SQASGKNLVSTLECL-RDNYIRSCRLLPDGRTLIVGGEASTLTIWDLASSQPRIKAELTSNAPACYALAMSPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISPDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFSSQI 668          

HSP 2 Score: 176.407 bits (446), Expect = 4.250e-46
Identity = 79/113 (69.91%), Postives = 96/113 (84.96%), Query Frame = 2
Query:   71 PPGQSFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLMSQ 409
            P GQ F F + ++CDRIKE+F ++Q QYHSLK E +K+  EKTEMQRHY+MYYEMSYGLNVEMHKQ+EI+KRL AI  Q+IPFLSQ+HQ QVAAAVERAKQVTM +LN+++ Q
Sbjct:   12 PSGQPFKFTVADSCDRIKEEFNFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNVEMHKQTEIAKRLNAICAQIIPFLSQDHQQQVAAAVERAKQVTMSELNAIIGQ 124          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Nematostella
Match: EDO49767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFR6])

HSP 1 Score: 72.4034 bits (176), Expect = 9.860e-14
Identity = 65/287 (22.65%), Postives = 113/287 (39.37%), Query Frame = 2
Query: 1784 LLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMG-----------------RADNRQI--SKYDFQSQIFSLG---------------YC----PSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQ-SNESSSVLSCDISADEKYIVTGSGD 2527
            LL ++D   +   I  I + PD + +I GG   ++ +WD    T +   ++       Y LA+S +  F  +   D  + +WD+   S++   +GH +  S + +TP    + +   D TV+ WD+                      +D R++  +  D   +I++L                YC    P   +   G E + V+I ++     E   L  H S + ++     G    S+G D  +  W +  G  L      S SV    +S D   IV+GS D
Sbjct:    5 LLRTID--GRSRTILGIAVTPDTKKIITGGADGSIRVWDY--ETGKELNKLLDHTKLVYTLALSPHADFLVSGAFDHTVKIWDMDTLSLVHTLKGHKNWVSGVLVTPDSKRIISSSYDKTVKIWDVETCAFVNSLDGHDGHVRGIAITSDGRRLVSASQDRTLRIWNLETFAHVSTLRGHSETVYCVCCSPDDKFAISGSEDTMVKIWDLESAK-EVRSLVGHTSDIFAVAVTPDGSKVISSGDDTQVKVWSLESGEELASLHGHSESVRIVTVSPDGLTIVSGSED 286          

HSP 2 Score: 51.2174 bits (121), Expect = 9.678e-7
Identity = 38/201 (18.91%), Postives = 81/201 (40.30%), Query Frame = 2
Query: 1820 YIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAW 2422
            ++  + + PD++ +I      T+ IWD+   T      +         +AI+++G+   +   D  + +W++   + +   +GH++   C+  +P      +G  D  V+ WD+           S     S IF++   P G  +    + +QV++ ++ +   E   L  H   V  +  +  G    S  +D     W
Sbjct:   99 WVSGVLVTPDSKRIISSSYDKTVKIWDV--ETCAFVNSLDGHDGHVRGIAITSDGRRLVSASQDRTLRIWNLETFAHVSTLRGHSETVYCVCCSPDDKFAISGSEDTMVKIWDLESAKEVR----SLVGHTSDIFAVAVTPDGSKVISSGDDTQVKVWSL-ESGEELASLHGHSESVRIVTVSPDGLTIVSGSEDATFKIW 292          

HSP 3 Score: 48.521 bits (114), Expect = 7.689e-6
Identity = 44/193 (22.80%), Postives = 80/193 (41.45%), Query Frame = 2
Query: 2048 MIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQ-SNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF*LRIFIATSSHSLCACAVLCVC 2623
            +++   G +     I +TP    + TGG D ++R WD  E G+  N+ +   D    +++L   P  D+L  G     V+I ++   +L  + L  H + V  +      K   S+  D  +  W +   A +         V    I++D + +V+ S D+   ++     L  F   S+    +  V CVC
Sbjct:    5 LLRTIDGRSRTILGIAVTPDTKKIITGGADGSIRVWDY-ETGKELNKLL---DHTKLVYTLALSPHADFLVSGAFDHTVKIWDMDTLSL-VHTLKGHKNWVSGVLVTPDSKRIISSSYDKTVKIWDVETCAFVNSLDGHDGHVRGIAITSDGRRLVSASQDRTLRIWN----LETFAHVSTLRGHSETVYCVC 188          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Nematostella
Match: EDO45346 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTA6])

HSP 1 Score: 72.4034 bits (176), Expect = 3.345e-13
Identity = 58/251 (23.11%), Postives = 98/251 (39.04%), Query Frame = 2
Query: 1823 IRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITI---SAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISK-YDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQN-LEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQ-SNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            I S+K  P    +       T+ +W      P  KGE T+         ++  S +G+       D  + VW +H Q  +     H +   C   +P G  + +G  D T++ WD     R     +   YD    + S+ + PSG  +A G   S V++ +I     L+ YQ   H   V S+ +  SG +  S   D  L    +  G   +          S   S + +Y  +GS D++  +++  F
Sbjct:   63 ILSVKFSPSGHLIASASRDKTVRLW-----VPSVKGESTVFKAHTATVRSVDFSGDGQSLLTASDDKSLKVWTVHRQKFLYSLNAHMNWVRCAKFSPDGRLIVSGSDDKTIKLWD-----RTSKDCVHTFYDPGGFVNSVEFHPSGTCIAAGGTDSTVKVWDIRMNKLLQHYQ--AHTGAVNSVSFHPSGNYLVSASSDTTLKILDLMEGRLFYTLHGHQGPATSVVFSRNGEYFASGSSDEQVMVWKTNF 301          

HSP 2 Score: 65.4698 bits (158), Expect = 4.604e-11
Identity = 44/176 (25.00%), Postives = 77/176 (43.75%), Query Frame = 2
Query: 2033 IHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDF---QSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSC-DISADEKYIVTGSGDKKATLYE 2548
            + + ++ +HF+GH D  + +D  P    L TG +D+++  W  +   RA       Y F   +  I S+ + PSG  +A       V +   S +  E      H + V S+ ++  G+   +   D  L  W +     L+  N   + + C   S D + IV+GS DK   L++
Sbjct:    5 LEDPTLERHFKGHRDTVTSVDFNPNMKQLVTGSMDSSLMIWHFKPHMRA-------YRFVGHKDAILSVKFSPSGHLIASASRDKTVRLWVPSVKG-ESTVFKAHTATVRSVDFSGDGQSLLTASDDKSLKVWTVHRQKFLYSLNAHMNWVRCAKFSPDGRLIVSGSDDKTIKLWD 172          

HSP 3 Score: 58.5362 bits (140), Expect = 7.501e-9
Identity = 44/177 (24.86%), Postives = 77/177 (43.50%), Query Frame = 2
Query: 1817 SYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACY--ALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEK--YQLTL 2335
            +++R  K  PD R ++ G +  T+ +WD  S         T   P  +  ++    +G       +D  + VWDI    +++H+Q H    + +   P GN L +   D T++  D+ E GR      + +  Q    S+ +  +G++ A G    QV +    K N +K  YQ  L
Sbjct:  145 NWVRCAKFSPDGRLIVSGSDDKTIKLWDRTS----KDCVHTFYDPGGFVNSVEFHPSGTCIAAGGTDSTVKVWDIRMNKLLQHYQAHTGAVNSVSFHPSGNYLVSASSDTTLKILDLME-GRL---FYTLHGHQGPATSVVFSRNGEYFASGSSDEQVMVW---KTNFDKVDYQEVL 310          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Nematostella
Match: EDO37614 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFB4])

HSP 1 Score: 68.1662 bits (165), Expect = 7.492e-12
Identity = 56/231 (24.24%), Postives = 92/231 (39.83%), Query Frame = 2
Query: 1823 IRSIKLVPDARTMIVGGESSTLTIWDLGSPTP-RSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNN----------------LWTGGLDNTVRCWDI-------REMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGAN 2443
            +R  +  P+++ +I G    T  IWD+    P R   ++  S  AC   A + +G       S+G +A+W+      I   +GH+ G    D +P   +                L +GG DN VR W I        E   A    + ++  QSQ++   + P+G  LA       V + N     +  + +T H   V    ++  GKW A+   D  L  W++    N
Sbjct:  101 VRVCRFSPNSQFLISGSADETFIIWDVLLKKPVRCVDKLESSVTAC---AFTPDGLHIITGTSEGKLAIWEAQKGKFITQVEGHDMGVGACDFSPTFGSAVPGLSDTSGSAPQFLLASGGNDNLVRLWTIYTASAFSEECHIASRCVLDQH--QSQVWDCCFSPNGKILASASGDKTVILWN-PLNGVALHTITGHSRYVTCCSFSPDGKWLATASGDRTLRLWQLTLTEN 325          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Medaka
Match: TLE3 (transducin-like enhancer protein 3-B [Source:NCBI gene;Acc:101168352])

HSP 1 Score: 480.715 bits (1236), Expect = 1.704e-156
Identity = 233/380 (61.32%), Postives = 284/380 (74.74%), Query Frame = 2
Query: 1436 GFDPALSMRGASLPLPMS-----KP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            GFDP   MR   LP  ++     KP YSF ++ +  M PVP  P+++  PG PR+ RQ+NTL HGEVVCAVTI+N  +HVYTGGKGCVK+WD+    +                      K  ++ +DCL +D+YIRS KL+PD RT+IVGGE+STLTIWDL S TPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L+ +K   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDISAD+KYIVTGSGDKKAT+YEV++
Sbjct:  388 GFDPHPHMRAPGLPAGLTSISGGKPAYSFHVSADGQMQPVPFPPDALIGPGIPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDISQPGS----------------------KSPVSQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLASQTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHTKP--DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY 738          

HSP 2 Score: 101.293 bits (251), Expect = 1.982e-21
Identity = 48/87 (55.17%), Postives = 61/87 (70.11%), Query Frame = 2
Query:   74 PGQ-SFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQE 331
            PGQ  F F + E+CDRIK++F ++Q QYHSLK EYDK+  EKTEMQRHY+M   +           +EI+KRL AIL Q++PFLSQE
Sbjct:   13 PGQPGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRHYVMVSAII----------TEIAKRLNAILAQIMPFLSQE 89          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Medaka
Match: TLE3 (transducin-like enhancer protein 3-B [Source:NCBI gene;Acc:101168352])

HSP 1 Score: 481.871 bits (1239), Expect = 2.123e-156
Identity = 235/380 (61.84%), Postives = 285/380 (75.00%), Query Frame = 2
Query: 1436 GFDPALSMRGASLPLPMS-----KP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            GFDP   MR   LP  ++     KP YSF ++ +  M PVP  P+++  PG PR+ RQ+NTL HGEVVCAVTI+N  +HVYTGGKGCVK+WD+                         GSK  ++ +DCL +D+YIRS KL+PD RT+IVGGE+STLTIWDL S TPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L+ +K   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDISAD+KYIVTGSGDKKAT+YEV++
Sbjct:  433 GFDPHPHMRAPGLPAGLTSISGGKPAYSFHVSADGQMQPVPFPPDALIGPGIPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDI----------------------SQPGSKSPVSQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLASQTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHTKP--DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY 783          

HSP 2 Score: 176.792 bits (447), Expect = 2.301e-45
Identity = 99/194 (51.03%), Postives = 120/194 (61.86%), Query Frame = 2
Query:   74 PGQ-SFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLMSQGDEKYPKFHNGGNFGFGPEHFEFYKXXXXXXXXXXXXXXXXHGVNLPPGLPPSHQSG--PPGLQSAGVAG----LFGGLGS 634
            PGQ  F F + E+CDRIK++F ++Q QYHSLK EYDK+  EKTEMQRHY+MYYEMSYGLN+EMHKQ+EI+KRL AIL Q++PFLSQEHQ QVA AVERAKQVTM +LN+++  G    P      N     +  +              +    H  + PP   P H SG  PPGL     AG      G LGS
Sbjct:   13 PGQPGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNAILAQIMPFLSQEHQQQVAQAVERAKQVTMTELNAII--GVRGLP------NLPLTQQQLQ--------------AQHLSHAAHGPPVQLPPHPSGLQPPGLPPVTGAGSGLLALGALGS 184          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Medaka
Match: TLE4 (transducin-like enhancer protein 1 [Source:NCBI gene;Acc:100125463])

HSP 1 Score: 478.404 bits (1230), Expect = 1.776e-155
Identity = 230/381 (60.37%), Postives = 284/381 (74.54%), Query Frame = 2
Query: 1433 MGFDPALSMRGASLP-----LPMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            +GFDP   MR   +P     +P  KP YSF +  +  M PVP  P+++  PG PR+ RQ+NTL HGEVVCAVTI+N  +HVYTGGKGCVKVWD+                           K  ++ +DCL +D+YIRS +L+PD RT+IVGGE+STL+IWDL +PTPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L+++K   +KYQL LH+SCVLSL++A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDIS D+KYIVTGSGDKKAT+YEV++
Sbjct:  405 VGFDPHPHMRVPGMPPSLTGIPGGKPAYSFHVAADGQMQPVPFPPDALVGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGN----------------------KSPVSQLDCLNRDNYIRSCRLLPDGRTLIVGGEASTLSIWDLATPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVTKP--DKYQLHLHESCVLSLQFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY 756          

HSP 2 Score: 101.679 bits (252), Expect = 1.377e-21
Identity = 50/93 (53.76%), Postives = 63/93 (67.74%), Query Frame = 2
Query:   74 PGQSFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMY-YEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVA 349
            PGQ F F IPE+ DRIKE+F ++Q QYHSLK E +K+  EKTEMQRHY+M  + + +        Q+EI+KRL  I  QVIPFLSQE   +V 
Sbjct:   14 PGQPFKFTIPESLDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMVSFFLFFVPPPFFLHQTEIAKRLNTICAQVIPFLSQEVSMRVT 106          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Medaka
Match: ENSORLT00000002067.2 (transducin-like enhancer protein 4 [Source:NCBI gene;Acc:100125464])

HSP 1 Score: 475.322 bits (1222), Expect = 1.514e-154
Identity = 228/381 (59.84%), Postives = 284/381 (74.54%), Query Frame = 2
Query: 1433 MGFDPALSMRGASLP-----LPMSKP-YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            +GFDP   +R   LP     +P  KP YSF ++ +  M PVP  P+++  P  PR+ RQ+NTL HGEVVCAVTI+N  +HVYTGGKGCVKVWD+                           K  ++ +DCL +D+YIRS +L+PD RT+IVGGE+STL+IWDL +PTPR K E+T SAPACYALAIS + K CF+C SDG IAVWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVR WD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGME+S VE+L+++K   +KYQL LH+SCVLSL++A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCDIS D+KYIVTGSGDKKAT+YEV++
Sbjct:  385 VGFDPHHQIRVPGLPPNLSGIPGGKPAYSFHVSADGQMQPVPFPPDALIGPNIPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGN----------------------KTPVSQLDCLNRDNYIRSCRLLPDGRTLIVGGEASTLSIWDLATPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMENSNVEVLHVTKP--DKYQLHLHESCVLSLRFAHCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISIDDKYIVTGSGDKKATVYEVIY 736          

HSP 2 Score: 136.346 bits (342), Expect = 1.570e-32
Identity = 63/93 (67.74%), Postives = 73/93 (78.49%), Query Frame = 2
Query:   59 PTRPP----PGQSFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLS 325
            P R P    PGQ F F + E+CDRIKE+F ++Q QYHSLK E +K+  EKTEMQRHY+MYYEMSYGLN+EMHKQ+EI KRL AI  QVIPFLS
Sbjct:   11 PARHPVPHQPGQPFKFTVTESCDRIKEEFQFLQAQYHSLKMECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNAICAQVIPFLS 103          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Medaka
Match: tle2b (transducin-like enhancer protein 4 [Source:NCBI gene;Acc:101157442])

HSP 1 Score: 472.241 bits (1214), Expect = 1.530e-153
Identity = 219/354 (61.86%), Postives = 272/354 (76.84%), Query Frame = 2
Query: 1496 YSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            YSF ++ +  M PVP  P+++  PG PR+ RQ++TL HGEVVCAVTI+ + +HVYTGGKGCVKVWD+    +                      K  +  +DCL +D+YIRS K++PD RT+IVGGE+STL+IWDL +PTPR K E+T SAPACYALAIS + K CF+C SDG I VWD+HNQ++++ FQGH DGASCIDI+  G  LWTGGLDNTVRCWD+RE      RQ+ ++DF SQIFSLGYCP+G+WLAVGMESS VE+L++SK   +KYQL LH+SCVLSLK+A  GKWF STGKD+LLNAWR PYGA++FQS ESSSVLSCD+S D+KYIVTGSGDKKAT+YEV++
Sbjct:  390 YSFHVSADGQMQPVPFPPDALLGPGIPRHARQIHTLSHGEVVCAVTISTSTRHVYTGGKGCVKVWDISQPGS----------------------KSPMAQLDCLNRDNYIRSCKILPDGRTLIVGGEASTLSIWDLATPTPRIKAELTSSAPACYALAISPDNKVCFSCCSDGNIVVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRCWDLRE-----GRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVSKP--DKYQLHLHESCVLSLKFAFCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDVSPDDKYIVTGSGDKKATVYEVVY 714          

HSP 2 Score: 101.293 bits (251), Expect = 1.732e-21
Identity = 46/62 (74.19%), Postives = 53/62 (85.48%), Query Frame = 2
Query:  224 YYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLMSQ 409
            YYEMSYGLN+EMHKQ+EI KRL AI  Q+IPFLSQEHQ QV  AVERAKQVTM +LN+++ Q
Sbjct:    9 YYEMSYGLNIEMHKQAEIVKRLSAICAQIIPFLSQEHQQQVVQAVERAKQVTMAELNAIIGQ 70          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Planmine SMEST
Match: SMESG000026880.1 (SMESG000026880.1)

HSP 1 Score: 1406.73 bits (3640), Expect = 0.000e+0
Identity = 835/835 (100.00%), Postives = 835/835 (100.00%), Query Frame = 2
Query:   53 MFPTRPPPGQSFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLMSQGDEKYPKFHNGGNFGFGPEHFEFYKXXXXXXXXXXXXXXXXHGVNLPPGLPPSHQSGPPGLQSAGVAGLFGGLGSLTGPHTNPMVAAVAAGHITPXXXXXXXXXXXXXXXXXXXXLMFQQRHTSSPCLDSQDKHRSISRSPMDCKRPRLEKIEDEKSEPXXXXXXXXXXXXXXXXXSKQPKENGDIKREAINLTEKASTPAKSGSPNSNDGMCQHPXXXXXXXXXXXDNHQSLTGSNDTPFRLDAIMPTSLNSFFTNSLFXXXXXXXXXXVPDIXXXXXXXXXXXXXXXXXXFPFGMPPFSXXXXXXXXXXXXXXXXXXXXXXXSLAAALGRAGTSGPLGPMGFDPALSMRGASLPLPMSKPYSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            MFPTRPPPGQSFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLMSQGDEKYPKFHNGGNFGFGPEHFEFYKQMQASQLSSSASGMAGHGVNLPPGLPPSHQSGPPGLQSAGVAGLFGGLGSLTGPHTNPMVAAVAAGHITPAAAALKHEAEKAEEEKKRAALMFQQRHTSSPCLDSQDKHRSISRSPMDCKRPRLEKIEDEKSEPDVVVDDNDDMVNMNGDNSKQPKENGDIKREAINLTEKASTPAKSGSPNSNDGMCQHPLSKLNNKNLSNDNHQSLTGSNDTPFRLDAIMPTSLNSFFTNSLFPPSISSSGGSVPDINATMAALASSANSNASPAFPFGMPPFSHPNMAAVAAAAGMHGPPGPHTGMSLAAALGRAGTSGPLGPMGFDPALSMRGASLPLPMSKPYSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQSATAGGSSSGAPTPPNSSGSTISSGSKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF
Sbjct:    1 MFPTRPPPGQSFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLMSQGDEKYPKFHNGGNFGFGPEHFEFYKQMQASQLSSSASGMAGHGVNLPPGLPPSHQSGPPGLQSAGVAGLFGGLGSLTGPHTNPMVAAVAAGHITPAAAALKHEAEKAEEEKKRAALMFQQRHTSSPCLDSQDKHRSISRSPMDCKRPRLEKIEDEKSEPDVVVDDNDDMVNMNGDNSKQPKENGDIKREAINLTEKASTPAKSGSPNSNDGMCQHPLSKLNNKNLSNDNHQSLTGSNDTPFRLDAIMPTSLNSFFTNSLFPPSISSSGGSVPDINATMAALASSANSNASPAFPFGMPPFSHPNMAAVAAAAGMHGPPGPHTGMSLAAALGRAGTSGPLGPMGFDPALSMRGASLPLPMSKPYSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQSATAGGSSSGAPTPPNSSGSTISSGSKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 835          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Planmine SMEST
Match: SMESG000026880.1 (SMESG000026880.1)

HSP 1 Score: 1375.92 bits (3560), Expect = 0.000e+0
Identity = 824/835 (98.68%), Postives = 824/835 (98.68%), Query Frame = 2
Query:   53 MFPTRPPPGQSFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLMSQGDEKYPKFHNGGNFGFGPEHFEFYKXXXXXXXXXXXXXXXXHGVNLPPGLPPSHQSGPPGLQSAGVAGLFGGLGSLTGPHTNPMVAAVAAGHITPXXXXXXXXXXXXXXXXXXXXLMFQQRHTSSPCLDSQDKHRSISRSPMDCKRPRLEKIEDEKSEPXXXXXXXXXXXXXXXXXSKQPKENGDIKREAINLTEKASTPAKSGSPNSNDGMCQHPXXXXXXXXXXXDNHQSLTGSNDTPFRLDAIMPTSLNSFFTNSLFXXXXXXXXXXVPDIXXXXXXXXXXXXXXXXXXFPFGMPPFSXXXXXXXXXXXXXXXXXXXXXXXSLAAALGRAGTSGPLGPMGFDPALSMRGASLPLPMSKPYSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            MFPTRPPPGQSFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQ           QGDEKYPKFHNGGNFGFGPEHFEFYKQMQASQLSSSASGMAGHGVNLPPGLPPSHQSGPPGLQSAGVAGLFGGLGSLTGPHTNPMVAAVAAGHITPAAAALKHEAEKAEEEKKRAALMFQQRHTSSPCLDSQDKHRSISRSPMDCKRPRLEKIEDEKSEPDVVVDDNDDMVNMNGDNSKQPKENGDIKREAINLTEKASTPAKSGSPNSNDGMCQHPLSKLNNKNLSNDNHQSLTGSNDTPFRLDAIMPTSLNSFFTNSLFPPSISSSGGSVPDINATMAALASSANSNASPAFPFGMPPFSHPNMAAVAAAAGMHGPPGPHTGMSLAAALGRAGTSGPLGPMGFDPALSMRGASLPLPMSKPYSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQSATAGGSSSGAPTPPNSSGSTISSGSKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF
Sbjct:    1 MFPTRPPPGQSFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQ-----------QGDEKYPKFHNGGNFGFGPEHFEFYKQMQASQLSSSASGMAGHGVNLPPGLPPSHQSGPPGLQSAGVAGLFGGLGSLTGPHTNPMVAAVAAGHITPAAAALKHEAEKAEEEKKRAALMFQQRHTSSPCLDSQDKHRSISRSPMDCKRPRLEKIEDEKSEPDVVVDDNDDMVNMNGDNSKQPKENGDIKREAINLTEKASTPAKSGSPNSNDGMCQHPLSKLNNKNLSNDNHQSLTGSNDTPFRLDAIMPTSLNSFFTNSLFPPSISSSGGSVPDINATMAALASSANSNASPAFPFGMPPFSHPNMAAVAAAAGMHGPPGPHTGMSLAAALGRAGTSGPLGPMGFDPALSMRGASLPLPMSKPYSFLINDNHNMAPVPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQSATAGGSSSGAPTPPNSSGSTISSGSKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 824          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Planmine SMEST
Match: SMESG000073091.1 (SMESG000073091.1)

HSP 1 Score: 317.39 bits (812), Expect = 3.693e-94
Identity = 167/372 (44.89%), Postives = 244/372 (65.59%), Query Frame = 2
Query: 1496 YSFLINDNHNMAP--VPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLG-SPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYC---------PSGDWLAVGMESSQVEILNISKQNL------EKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 2557
            Y++++  N ++ P  +PI+  + +S  YP+++R L +  HGEVVCAV ++   + V++GGKG +K+WD+      GSSS A   P              + S+ CL  DSYIRSIKL+ +    ++GGE++ + IWD+  S +P  KGE+ I APACYAL ++ +GK CF+C+SDG IA+ DIHNQ++I  FQ H +GASCI+I+  G  LWTGGLD+ VR WDIR+ G    R++   +F +QIFS+G           P  DWLAVG+E+S ++++ +S   +      E Y+L LHD+CVLSL++A    WF +T KDHL+NA   P G N+ Q+ E+ SVL+ DIS+D+KY+VTGSGD+KATLY+V++
Sbjct:  458 YNYVVKPNGSVEPRLMPIDTIT-NSNQYPQHLRHLASFNHGEVVCAVAMH--QQTVFSGGKGTLKLWDINDNVIRGSSSPASRDP--------------VASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCG----RELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 807          

HSP 2 Score: 188.734 bits (478), Expect = 2.937e-49
Identity = 90/149 (60.40%), Postives = 112/149 (75.17%), Query Frame = 2
Query:   53 MFPTRPP----PGQSFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLMSQGDE-KYPKFHNGGNFGFGPEHFEFYK 484
            MFP R P     G S+   IPE CDRIKE+F+Y QQQ H+   E +K++QE++EMQR  IMYYEM++GLN+EMH+Q EI+KRL AIL Q+IP+LSQEHQ Q++ A+ERAKQVTM +LNS M   +E K  KF NGGNFGF P+  EFYK
Sbjct:    1 MFPNRAPVPPGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELNSAMMHTEEAKCSKFFNGGNFGF-PDQLEFYK 148          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Planmine SMEST
Match: SMESG000024482.1 (SMESG000024482.1)

HSP 1 Score: 82.4185 bits (202), Expect = 5.537e-16
Identity = 53/204 (25.98%), Postives = 98/204 (48.04%), Query Frame = 2
Query: 1823 IRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYA--LAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKY-DFQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWR 2425
            +RS+ +  D   M+ G +  T+ +W +     R K   +++    +   +  S++G+   +   D  I +WD HNQ  I  FQ H      +   P G+ + +GG D+ V  WDIR      N+ +  Y    S + ++ + PSG++L    + S ++I ++ +  L  Y +  H+  +L   ++  G+ FAS G DH +  W+
Sbjct:  101 VRSVDISCDNLEMVTGSDDKTIKVWKMH----RQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRM-----NKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRL-LYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQ 294          

HSP 2 Score: 61.2326 bits (147), Expect = 2.465e-9
Identity = 41/168 (24.40%), Postives = 72/168 (42.86%), Query Frame = 2
Query: 2057 HFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDF---QSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSC-DISADEKYIVTGSGDKKATLYE 2548
            HF+GH D  +C+D  P  + L +GG+D+ +  W+ +   RA       Y F   +  I S+ + P+G  +A       V +   S +  E      H + V S+  +       +   D  +  W+M      +  NE  + + C   S+D + I + S DK   L++
Sbjct:    9 HFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRA-------YRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKG-ESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWD 168          
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Planmine SMEST
Match: SMESG000010494.1 (SMESG000010494.1)

HSP 1 Score: 75.0998 bits (183), Expect = 8.397e-14
Identity = 35/115 (30.43%), Postives = 55/115 (47.83%), Query Frame = 2
Query: 1820 YIRSIKLVPDARTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIR 2164
            ++R I   PD    I G +   L IW++ +   R    +T        + IS    + F+C  D  +  WD+    +I+H+ GH     C+D+ P  + L TGG D+ VR WD+R
Sbjct:  139 WVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRL--SLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMR 251          

HSP 2 Score: 50.0618 bits (118), Expect = 6.443e-6
Identity = 44/202 (21.78%), Postives = 86/202 (42.57%), Query Frame = 2
Query: 1964 LAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYD-FQSQIFSLGYCPSGDWLAVGMESSQVEILNISKQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANL-FQSNESSSVLSCDISADEKYIVTGSGD--KKATLYEVLF 2557
            ++ S + ++      D  + +W++ N  +     GH  G   + I+ +   +++ G D TV+CWD+ +     N+ I  Y    S ++ L   P  D L  G   S V + ++ +  +  + L+ H   V S++  ++     S   D  +  W +         +N   +V S  I     + ++GS D  K+ +L E  F
Sbjct:  143 ISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQ-----NKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDM-RTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLTNHKKAVRSVFIHPITDHFMSGSADGIKQFSLPEGQF 338          
The following BLAST results are available for this feature:
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TLE34.075e-16061.42TLE family member 3, transcriptional corepressor [... [more]
TLE36.277e-15961.20TLE family member 3, transcriptional corepressor [... [more]
TLE39.450e-15961.42TLE family member 3, transcriptional corepressor [... [more]
TLE31.296e-15861.72TLE family member 3, transcriptional corepressor [... [more]
TLE31.514e-15861.72TLE family member 3, transcriptional corepressor [... [more]
back to top
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-372.748e-10748.13Transcription factor unc-37 [Source:UniProtKB/Swi... [more]
unc-372.748e-10748.13Transcription factor unc-37 [Source:UniProtKB/Swi... [more]
plrg-19.984e-1222.13PLeiotropic ReGulator (Vertebrate) homolog [Sourc... [more]
plrg-11.040e-1122.13PLeiotropic ReGulator (Vertebrate) homolog [Sourc... [more]
plrg-11.040e-1122.13PLeiotropic ReGulator (Vertebrate) homolog [Sourc... [more]
back to top
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gro2.247e-15660.63gene:FBgn0001139 transcript:FBtr0084962[more]
gro2.247e-15660.63gene:FBgn0001139 transcript:FBtr0084965[more]
gro2.247e-15660.63gene:FBgn0001139 transcript:FBtr0084964[more]
gro2.247e-15660.63gene:FBgn0001139 transcript:FBtr0084963[more]
gro2.247e-15660.63gene:FBgn0001139 transcript:FBtr0302951[more]
back to top
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tle3b2.121e-15762.11TLE family member 3, transcriptional corepressor b... [more]
tle3b3.001e-15762.11TLE family member 3, transcriptional corepressor b... [more]
tle3b3.001e-15762.11TLE family member 3, transcriptional corepressor b... [more]
tle2b9.695e-15561.58TLE family member 2, transcriptional corepressor b... [more]
tle3a5.275e-15461.93TLE family member 3, transcriptional corepressor a... [more]
back to top
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbxw46.052e-15660.37F-box and WD repeat domain containing 4 [Source:Xe... [more]
fbxw48.217e-15660.47F-box and WD repeat domain containing 4 [Source:Xe... [more]
tle11.862e-15561.10transducin like enhancer of split 1 [Source:NCBI g... [more]
fbxw42.004e-15560.63F-box and WD repeat domain containing 4 [Source:Xe... [more]
fbxw42.043e-15560.37F-box and WD repeat domain containing 4 [Source:Xe... [more]
back to top
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tle33.321e-15961.20transducin-like enhancer of split 3 [Source:MGI Sy... [more]
Tle34.898e-15961.20transducin-like enhancer of split 3 [Source:MGI Sy... [more]
Tle38.805e-15961.42transducin-like enhancer of split 3 [Source:MGI Sy... [more]
Tle38.898e-15961.72transducin-like enhancer of split 3 [Source:MGI Sy... [more]
Tle39.145e-15961.72transducin-like enhancer of split 3 [Source:MGI Sy... [more]
back to top
BLAST of transducin-like enhancer protein 3 isoform X4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08122|TLE3_MOUSE9.068e-15861.72Transducin-like enhancer protein 3 OS=Mus musculus... [more]
sp|Q04726|TLE3_HUMAN9.363e-15861.72Transducin-like enhancer protein 3 OS=Homo sapiens... [more]
sp|Q9JIT3|TLE3_RAT2.437e-15761.94Transducin-like enhancer protein 3 OS=Rattus norve... [more]
sp|O13168|TLE3B_DANRE2.265e-15662.11Transducin-like enhancer protein 3-B OS=Danio reri... [more]
sp|Q04727|TLE4_HUMAN4.252e-15560.63Transducin-like enhancer protein 4 OS=Homo sapiens... [more]
back to top
BLAST of transducin-like enhancer protein 3 isoform X4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HTK53.317e-16163.28transducin-like enhancer protein 4 isoform X5 OS=L... [more]
A0A1S3HWD73.341e-16163.28transducin-like enhancer protein 4 isoform X4 OS=L... [more]
A0A1S3HTL25.391e-16163.28transducin-like enhancer protein 4 isoform X7 OS=L... [more]
A0A1S3HTM65.519e-16163.28transducin-like enhancer protein 4 isoform X3 OS=L... [more]
A0A1S3HUZ76.118e-16163.28transducin-like enhancer protein 4 isoform X1 OS=L... [more]
back to top
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000040766.19.966e-15761.39pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
tle3a7.564e-15461.39TLE family member 3, transcriptional corepressor a... [more]
tle2a1.001e-15260.87TLE family member 2, transcriptional corepressor a... [more]
tle2b5.807e-15061.58TLE family member 2, transcriptional corepressor b... [more]
tle2b3.237e-14158.76TLE family member 2, transcriptional corepressor b... [more]
back to top
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002530.11.390e-15960.89pep scaffold:Pmarinus_7.0:GL486002:914:6103:1 gene... [more]
ENSPMAT00000002471.15.194e-15660.37pep scaffold:Pmarinus_7.0:GL476407:90601:137795:1 ... [more]
ENSPMAT00000002582.11.152e-15460.99pep scaffold:Pmarinus_7.0:GL476407:354021:372810:-... [more]
POC1A2.773e-1522.22POC1 centriolar protein A [Source:HGNC Symbol;Acc:... [more]
plrg18.507e-1522.95pleiotropic regulator 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TAF52.672e-1223.04Subunit (90 kDa) of TFIID and SAGA complexes; invo... [more]
TUP19.414e-1224.64General repressor of transcription; forms complex ... [more]
PRP463.085e-925.00Member of the NineTeen Complex (NTC); this complex... [more]
LST89.503e-818.82Protein required for the transport of Gap1p; requi... [more]
ASC16.645e-720.63G-protein beta subunit and guanine dissociation in... [more]
back to top
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO292809.366e-15458.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO423103.386e-8450.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO497679.860e-1422.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453463.345e-1323.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376147.492e-1224.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TLE31.704e-15661.32transducin-like enhancer protein 3-B [Source:NCBI ... [more]
TLE32.123e-15661.84transducin-like enhancer protein 3-B [Source:NCBI ... [more]
TLE41.776e-15560.37transducin-like enhancer protein 1 [Source:NCBI ge... [more]
ENSORLT00000002067.21.514e-15459.84transducin-like enhancer protein 4 [Source:NCBI ge... [more]
tle2b1.530e-15361.86transducin-like enhancer protein 4 [Source:NCBI ge... [more]
back to top
BLAST of transducin-like enhancer protein 3 isoform X4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026880.10.000e+0100.00SMESG000026880.1[more]
SMESG000026880.10.000e+098.68SMESG000026880.1[more]
SMESG000073091.13.693e-9444.89SMESG000073091.1[more]
SMESG000024482.15.537e-1625.98SMESG000024482.1[more]
SMESG000010494.18.397e-1430.43SMESG000010494.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022991 ID=SMED30022991|Name=transducin-like enhancer protein 3 isoform X4|organism=Schmidtea mediterranea sexual|type=transcript|length=2980bp
CTTATTTGGCGTTTCTTCCATATTATTTAAACTATATTTAATTTAGTCAA
TCATGTTTCCAACTAGACCTCCTCCTGGTCAATCATTTAACTTTAAAATT
CCCGAAGCATGCGATAGAATAAAGGAGGATTTCGCTTACATGCAACAACA
GTATCACAGTTTAAAATGTGAATATGATAAAGTGTTACAAGAGAAAACGG
AAATGCAGCGGCATTATATTATGTATTATGAAATGTCATATGGGTTAAAT
GTTGAAATGCACAAGCAGAGTGAAATATCAAAACGACTCGGTGCTATACT
TGTTCAAGTGATTCCGTTCCTATCTCAAGAACATCAAACCCAAGTCGCAG
CCGCAGTGGAAAGAGCTAAACAAGTAACAATGCCTGATTTAAATTCTCTT
ATGTCTCAAGGAGATGAAAAATATCCAAAATTTCATAACGGAGGCAATTT
TGGATTCGGACCCGAGCATTTCGAATTCTACAAACAAATGCAAGCCAGTC
AGCTCTCGTCCAGCGCATCGGGAATGGCTGGTCATGGAGTGAATCTTCCA
CCGGGCTTACCGCCTTCTCATCAATCGGGCCCTCCGGGATTGCAATCAGC
CGGTGTTGCCGGCTTGTTCGGCGGTCTAGGTAGCCTCACTGGGCCACATA
CGAATCCTATGGTAGCAGCTGTGGCAGCGGGGCACATTACACCAGCAGCA
GCTGCTTTGAAACACGAAGCGGAAAAAGCGGAAGAGGAGAAAAAGCGTGC
AGCACTTATGTTTCAACAGAGACACACCTCGTCCCCATGTCTCGATTCCC
AAGATAAACACAGGAGTATTAGTCGATCTCCGATGGATTGCAAACGACCG
AGATTAGAGAAAATAGAAGACGAAAAAAGTGAACCAGATGTTGTGGTCGA
TGACAATGACGATATGGTAAATATGAACGGTGATAATTCAAAACAACCCA
AAGAAAATGGCGACATCAAAAGAGAAGCTATAAACCTAACAGAAAAAGCG
TCAACTCCAGCCAAATCAGGAAGTCCAAATAGCAACGATGGAATGTGCCA
ACATCCTTTATCAAAATTAAACAACAAGAATCTCTCTAATGACAATCATC
AAAGTCTTACAGGTTCAAACGATACTCCTTTTCGATTAGACGCTATCATG
CCAACGAGTTTGAATAGTTTCTTTACCAATTCTCTGTTTCCTCCATCTAT
ATCGTCATCTGGAGGATCTGTCCCAGACATTAATGCGACAATGGCTGCAT
TAGCATCATCAGCCAATAGCAATGCATCTCCTGCATTTCCTTTTGGAATG
CCACCGTTTTCTCATCCCAATATGGCGGCTGTAGCCGCTGCTGCTGGAAT
GCACGGCCCACCTGGCCCGCATACCGGAATGAGTCTAGCTGCTGCGCTTG
GACGTGCCGGTACCAGTGGACCGCTTGGCCCAATGGGATTTGACCCTGCT
TTATCAATGCGCGGTGCTAGTTTGCCCCTTCCGATGTCCAAACCATACTC
TTTTCTAATCAACGATAATCATAATATGGCTCCAGTGCCTATCAATCCAG
AAAGTGTCCATAGTCCCGGATATCCCAGAAATGTCCGACAGTTAAACACA
CTGCTACATGGTGAGGTAGTTTGCGCAGTCACTATAAATAATGCAATGAA
ACATGTGTATACTGGAGGGAAAGGGTGTGTTAAAGTTTGGGATATGCAAT
CTGCCACTGCAGGCGGTTCCAGTTCTGGAGCTCCTACTCCGCCAAACAGT
AGCGGCAGTACAATTTCATCTGGATCAAAGTTGTTGCTCAACTCCATGGA
TTGTCTACAGAAAGATAGTTACATTCGATCGATAAAACTTGTTCCCGATG
CCCGTACTATGATCGTTGGGGGAGAATCGAGCACTCTAACGATTTGGGAT
CTTGGTTCACCAACTCCTCGCTCTAAAGGTGAAATCACTATATCGGCTCC
AGCTTGTTATGCTTTAGCTATTTCAGCAAATGGTAAATTCTGTTTCAACT
GCTACTCCGATGGCTATATCGCTGTTTGGGACATTCATAATCAATCGATG
ATAAAACACTTTCAAGGTCACAATGACGGCGCTTCATGTATTGACATTAC
GCCAAAAGGGAACAATTTATGGACGGGTGGTCTCGATAATACTGTCCGGT
GTTGGGATATCAGAGAAATGGGTCGCGCTGACAATCGACAAATCAGTAAA
TATGATTTCCAATCTCAGATATTCTCTCTCGGCTACTGTCCGTCTGGAGA
CTGGCTTGCAGTCGGTATGGAATCTAGCCAGGTGGAAATTCTGAACATCT
CCAAACAGAATTTGGAAAAATATCAACTCACACTCCATGACAGTTGCGTA
CTATCTCTCAAATACGCCGCATCCGGCAAATGGTTCGCCAGCACAGGAAA
AGATCATTTGTTGAACGCATGGCGAATGCCTTATGGAGCCAATCTCTTTC
AGTCCAATGAGAGCTCATCAGTTCTGAGTTGCGATATATCTGCTGACGAG
AAATATATAGTAACCGGATCAGGGGACAAGAAAGCCACCTTGTATGAGGT
GTTATTCTAGTTGAGAATATTTATTGCCACATCAAGCCATAGCTTGTGCG
CTTGTGCTGTGCTGTGTGTGTGTATGTATTCGCGAGTGTGTGTGTGAGAG
ATGGGTGTAATATAATTGATTATCAATATTATTATTTCGATTACTCTGTA
AATCAAAACGATCATCCGTTTTGTGTACATATTTGAGTCTTCTCTTTACG
CGCTTGTGTGATTATTATTCATTGGTATATACATATATATAATGCCGGGA
GGAAATGTGATTTTACTTGGTTTGCATTTATTGATATTTATTGACTGTGT
TCTCATGTGTGTGTGTGTGTGCTCGTGTTTCGGTCGGTGGGGTAACGATA
TCAAGATTCTGTTGATAATGATAATAATAATGATGATAATAATGTATGTT
TAGTTTAACTTTTCATTGACGAATAAATAT
back to top

protein sequence of SMED30022991-orf-1

>SMED30022991-orf-1 ID=SMED30022991-orf-1|Name=SMED30022991-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=836bp
MFPTRPPPGQSFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTE
MQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAA
AVERAKQVTMPDLNSLMSQGDEKYPKFHNGGNFGFGPEHFEFYKQMQASQ
LSSSASGMAGHGVNLPPGLPPSHQSGPPGLQSAGVAGLFGGLGSLTGPHT
NPMVAAVAAGHITPAAAALKHEAEKAEEEKKRAALMFQQRHTSSPCLDSQ
DKHRSISRSPMDCKRPRLEKIEDEKSEPDVVVDDNDDMVNMNGDNSKQPK
ENGDIKREAINLTEKASTPAKSGSPNSNDGMCQHPLSKLNNKNLSNDNHQ
SLTGSNDTPFRLDAIMPTSLNSFFTNSLFPPSISSSGGSVPDINATMAAL
ASSANSNASPAFPFGMPPFSHPNMAAVAAAAGMHGPPGPHTGMSLAAALG
RAGTSGPLGPMGFDPALSMRGASLPLPMSKPYSFLINDNHNMAPVPINPE
SVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQS
ATAGGSSSGAPTPPNSSGSTISSGSKLLLNSMDCLQKDSYIRSIKLVPDA
RTMIVGGESSTLTIWDLGSPTPRSKGEITISAPACYALAISANGKFCFNC
YSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRC
WDIREMGRADNRQISKYDFQSQIFSLGYCPSGDWLAVGMESSQVEILNIS
KQNLEKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQ
SNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR009146Groucho_enhance
IPR001680WD40_repeat
IPR005617Groucho/TLE_N
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006351transcription, DNA-templated
GO:0007275multicellular organism development
GO:0007283spermatogenesis
GO:0016055Wnt signaling pathway
GO:0030154cell differentiation
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 216..236
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 246..277
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 240..304
IPR009146Groucho/transducin-like enhancerPRINTSPR01850GROUCHOFAMLYcoord: 796..815
score: 79.75
coord: 816..835
score: 78.25
coord: 732..754
score: 59.57
IPR009146Groucho/transducin-like enhancerPANTHERPTHR10814TRANSDUCIN-LIKE ENHANCER PROTEINcoord: 10..834
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 663..702
e-value: 2.1E-7
score: 40.6
coord: 621..660
e-value: 2.4
score: 14.6
coord: 710..748
e-value: 20.0
score: 8.8
coord: 752..791
e-value: 0.11
score: 21.6
coord: 581..616
e-value: 0.99
score: 17.0
coord: 510..547
e-value: 0.48
score: 19.0
coord: 795..832
e-value: 0.53
score: 18.8
IPR001680WD40 repeatPFAMPF00400WD40coord: 667..702
e-value: 0.0099
score: 16.7
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 670..711
score: 13.215
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 759..800
score: 8.804
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 476..835
e-value: 1.1E-112
score: 378.2
IPR005617Groucho/TLE, N-terminal Q-rich domainPFAMPF03920TLE_Ncoord: 1..120
e-value: 7.2E-59
score: 197.6
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 584..835
score: 27.368
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 503..832