N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase

Overview
NameN(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase
Smed IDSMED30022982
Length (bp)2628
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase (SMED30022982) t-SNE clustered cells

Violin plots show distribution of expression levels for N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase (SMED30022982) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase (SMED30022982) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase (SMED30022982) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022982

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30022982SMESG000007172.1 Contig4915GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30022982SMESG000003786.1 Contig4915GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30022982SMESG000003786.1 SMESG000003788.1 SMESG000003787.1 dd_Smed_v4_3326_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022982SMESG000003786.1 SMESG000003788.1 SMESG000003787.1 dd_Smed_v4_3326_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022982SMESG000003786.1 SMESG000003788.1 SMESG000003787.1 dd_Smed_v4_3326_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022982SMESG000003786.1 SMESG000003788.1 SMESG000003787.1 dd_Smed_v4_3326_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022982SMESG000003786.1 Contig50806uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022982SMESG000003786.1 Contig50806newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022982SMESG000003788.1 SMESG000003787.1 Contig44785uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022982SMESG000003788.1 SMESG000003787.1 Contig44785newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30022982SMESG000003786.1 SMESG000003788.1 SMESG000003787.1 dd_Smed_v6_3326_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30022982SMESG000003786.1 SMESG000003788.1 SMESG000003787.1 dd_Smed_v4_3326_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022982SMESG000003787.1 SMED_15952_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30022982SMESG000003787.1 SMED_15952_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Human
Match: AGA (aspartylglucosaminidase [Source:HGNC Symbol;Acc:HGNC:318])

HSP 1 Score: 280.026 bits (715), Expect = 4.824e-86
Identity = 152/302 (50.33%), Postives = 198/302 (65.56%), Query Frame = 1
Query:  124 SSFQDIIVNTWPFTKATDAAWCELQMSGNVMKSVERGCTEAEYDLSIPTVGYGGSPNEKNVVALDAMIMNGDTMEVGAVASMPHVKNAIKVAHYVLKHTRHTLLVGNDAAEFAREMGFTWENLSTENSTELWNQWKLKNCQPNFRRNVSPNPKQNCGPYKPISKKLLDDNYRV-PGTVNEHHHDTIGMIAMNKSGSMAVGTSTNGAIFKVPGRVGDTAIPGSGGYVDSTIGGAVGTGDGDILMRFLLSYQAVEFMRQGLHPSKACVESLRRV-KQAGAWSGALVALNRAGEYGAACVGFSDY 1023
            SS   ++VNTWPF  AT+AAW  L   G+ + +VE GC   E +    +VG+GGSP+E     LDAMIM+G TM+VGAV  +  +KNAI VA  VL+HT HTLLVG  A  FA+ MGF  E+LST  S  L + W  +NCQPN+ RNV P+P + CGPYKP    +L  +  +   T ++  HDTIGM+ ++K+G +A GTSTNG  FK+ GRVGD+ IPG+G Y D T G A  TG+GDILMRFL SYQAVE+MR+G  P+ AC + + R+ K    + GA++  N  G YGAAC   S +
Sbjct:   24 SSPLPLVVNTWPFKNATEAAWRALASGGSALDAVESGCAMCEREQCDGSVGFGGSPDELGETTLDAMIMDGTTMDVGAVGDLRRIKNAIGVARKVLEHTTHTLLVGESATTFAQSMGFINEDLSTTASQALHSDWLARNCQPNYWRNVIPDPSKYCGPYKP--PGILKQDIPIHKETEDDRGHDTIGMVVIHKTGHIAAGTSTNGIKFKIHGRVGDSPIPGAGAYADDTAGAAAATGNGDILMRFLPSYQAVEYMRRGEDPTIACQKVISRIQKHFPEFFGAVICANVTGSYGAACNKLSTF 323          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Human
Match: H2BC13 (H2B clustered histone 13 [Source:HGNC Symbol;Acc:HGNC:4748])

HSP 1 Score: 167.548 bits (423), Expect = 6.485e-48
Identity = 78/87 (89.66%), Postives = 83/87 (95.40%), Query Frame = -1
Query: 1195 IYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 1455
            +Y+YKVL+QVHPDTGIS KAM IMNSFVND+FERIASEASRLAHYNK+STITSREIQT VRLLLPGELAKHAVSEGTKAVTKYT SK
Sbjct:   40 VYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 126          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Human
Match: H2BU1 (H2B.U histone 1 [Source:HGNC Symbol;Acc:HGNC:20514])

HSP 1 Score: 167.548 bits (423), Expect = 7.974e-48
Identity = 78/87 (89.66%), Postives = 83/87 (95.40%), Query Frame = -1
Query: 1195 IYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 1455
            IY+YKVL+QVHPDTGIS KAM IMNSFVND+FERIASEASRLAHYNK+STITSRE+QT VRLLLPGELAKHAVSEGTKAVTKYT SK
Sbjct:   40 IYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 126          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Human
Match: H2BU1 (H2B.U histone 1 [Source:HGNC Symbol;Acc:HGNC:20514])

HSP 1 Score: 167.548 bits (423), Expect = 7.974e-48
Identity = 78/87 (89.66%), Postives = 83/87 (95.40%), Query Frame = -1
Query: 1195 IYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 1455
            IY+YKVL+QVHPDTGIS KAM IMNSFVND+FERIASEASRLAHYNK+STITSRE+QT VRLLLPGELAKHAVSEGTKAVTKYT SK
Sbjct:   40 IYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 126          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Human
Match: H2BC21 (H2B clustered histone 21 [Source:HGNC Symbol;Acc:HGNC:4760])

HSP 1 Score: 166.007 bits (419), Expect = 2.377e-47
Identity = 78/87 (89.66%), Postives = 82/87 (94.25%), Query Frame = -1
Query: 1195 IYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 1455
            IY+YKVL+QVHPDTGIS KAM IMNSFVND+FERIA EASRLAHYNK+STITSREIQT VRLLLPGELAKHAVSEGTKAVTKYT SK
Sbjct:   40 IYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 126          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Celegans
Match: R04B3.2 (Putative N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase Glycosylasparaginase alpha chain Glycosylasparaginase beta chain [Source:UniProtKB/Swiss-Prot;Acc:Q21697])

HSP 1 Score: 239.965 bits (611), Expect = 2.124e-71
Identity = 130/306 (42.48%), Postives = 189/306 (61.76%), Query Frame = 1
Query:  139 IIVNTWP---FTKATDAAWCELQMSGNVMKSVERGCTEAEYDLSIPTVGYGGSPNEKNVVALDAMIMNGDTMEVGAVASMPHVKNAIKVAHYVLKHTRHTLLVGNDAAEFAREMGFTWENLSTENSTELWNQWKLKNCQPNFRRNVSPNPKQNCGPYK--PISK-----KLLDDNYRVPGTVNEHHHDTIGMIAMNKSGSMAVGTSTNGAIFKVPGRVGDTAIPGSGGYVDSTIGGAVGTGDGDILMRFLLSYQAVEFMRQGLHPSKACVESLRRV-KQAGAWSGALVALNRAGEYGAACVGFSDY 1023
            +++ TW    F KAT  A     + G +   VE G +  E      TVGYGGSP+E     LD+++++ D M VGAVA++  +++A +VA  V+  T+HTLLVG  A +FA+ +GF  E+LSTE +    ++WK + CQPNF +NVSP+P  +CGPYK  P++K      L++ +      V + +HDTIGM+  +     + GTS+NGA FK+PGRVGD+ IPG+G Y +   GGA  TGDGD++MRFL S+ AV  M  G  PSKA  +++ R+ K    +SGA+VA+N  G  GA+C   + +
Sbjct:   25 MVITTWGSDGFKKATKNAVDATLLGGRMFGLVE-GLSTCEALQCDTTVGYGGSPDENGETCLDSLVIDADGMRVGAVANLHRIRDAARVAWGVMNFTKHTLLVGESATQFAKTLGFKEEDLSTEETKSWISKWKTEKCQPNFWKNVSPDPSSSCGPYKTNPLTKSMRYYSLVNQSDEAGYLVEKTNHDTIGMVVRDTENIFSAGTSSNGARFKIPGRVGDSPIPGAGAYANK-FGGAAATGDGDVMMRFLPSFFAVTQMELGTKPSKAAYKAITRILKVFPKFSGAVVAMNVKGRIGASCANINKF 328          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Celegans
Match: his-41 (Probable histone H2B 3 [Source:UniProtKB/Swiss-Prot;Acc:Q27484])

HSP 1 Score: 166.392 bits (420), Expect = 7.323e-48
Identity = 77/87 (88.51%), Postives = 84/87 (96.55%), Query Frame = -1
Query: 1195 IYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 1455
            +YIY+VL+QVHPDTG+S KAMSIMNSFVNDVFERIASEASRLAHYNK+STI+SREIQT VRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   37 VYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIASEASRLAHYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTSSK 123          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Celegans
Match: his-66 (Probable histone H2B 4 [Source:UniProtKB/Swiss-Prot;Acc:Q27876])

HSP 1 Score: 166.007 bits (419), Expect = 8.322e-48
Identity = 77/87 (88.51%), Postives = 84/87 (96.55%), Query Frame = -1
Query: 1195 IYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 1455
            +YIY+VL+QVHPDTG+S KAMSIMNSFVNDVFERIASEASRLAHYNK+STI+SREIQT VRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   37 VYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIASEASRLAHYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTSSK 123          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Celegans
Match: his-62 (Probable histone H2B 4 [Source:UniProtKB/Swiss-Prot;Acc:Q27876])

HSP 1 Score: 166.007 bits (419), Expect = 8.322e-48
Identity = 77/87 (88.51%), Postives = 84/87 (96.55%), Query Frame = -1
Query: 1195 IYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 1455
            +YIY+VL+QVHPDTG+S KAMSIMNSFVNDVFERIASEASRLAHYNK+STI+SREIQT VRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   37 VYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIASEASRLAHYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTSSK 123          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Celegans
Match: his-58 (Probable histone H2B 4 [Source:UniProtKB/Swiss-Prot;Acc:Q27876])

HSP 1 Score: 166.007 bits (419), Expect = 8.322e-48
Identity = 77/87 (88.51%), Postives = 84/87 (96.55%), Query Frame = -1
Query: 1195 IYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 1455
            +YIY+VL+QVHPDTG+S KAMSIMNSFVNDVFERIASEASRLAHYNK+STI+SREIQT VRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   37 VYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIASEASRLAHYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTSSK 123          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Fly
Match: CG1827 (gene:FBgn0033431 transcript:FBtr0339392)

HSP 1 Score: 296.204 bits (757), Expect = 8.185e-92
Identity = 150/303 (49.50%), Postives = 203/303 (67.00%), Query Frame = 1
Query:  139 IIVNTWPFTKATDAAWCELQMSGNVMK----SVERGCTEAEYDLSIPTVGYGGSPNEKNVVALDAMIMNGDTMEVGAVASMPHVKNAIKVAHYVLKHTRHTLLVGNDAAEFAREMGFTWENLSTENSTELWNQWKLKNCQPNFRRNVSPNPKQNCGPYKPISKKLL---DDNYRVPGTVNEHHHDTIGMIAMNKSGSMAVGTSTNGAIFKVPGRVGDTAIPGSGGYVDSTIGGAVGTGDGDILMRFLLSYQAVEFMRQGLHPSKACVESLRRV-KQAGAWSGALVALNRAGEYGAACVGFSDY 1023
            +++NTW FT A   AW  L+ S   ++    +V  GC++ E      TVGYGGSP+E     LDAM+M+G TM+VGAVA +  +K+AIKVA +VL+HT+HT+LVG+ A+ FA  MGF  E+L T  S ++W QW  +NCQPNF +NV P+PK +CGPYKP    L    +D  R    +   +HDTIGMIA++   ++  GTSTNGA  K+PGRVGD+ IPG+G Y D+ +G AV TGDGD++MRFL S  AVE MR G  P++A  E LRR+ K    + GAL+A++R G YGAAC G +++
Sbjct:   58 MVINTWNFTAANVLAWRILKQSKGGLRQTRNAVVEGCSKCEKLQCDRTVGYGGSPDELGETTLDAMVMDGATMDVGAVAGLRRIKDAIKVARHVLEHTQHTMLVGDAASAFANAMGFESESLVTPESKDMWLQWTAENCQPNFWKNVHPDPKVSCGPYKPRPTPLTRWKEDRARNEYEIGRKNHDTIGMIAIDVESNIHAGTSTNGARHKIPGRVGDSPIPGAGAYADNEVGAAVATGDGDVMMRFLPSLLAVETMRAGKPPAEAAQEGLRRILKHHKDFMGALIAVDRLGNYGAACYGLAEF 360          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Fly
Match: CG10474 (gene:FBgn0034427 transcript:FBtr0086561)

HSP 1 Score: 258.455 bits (659), Expect = 2.372e-78
Identity = 135/298 (45.30%), Postives = 187/298 (62.75%), Query Frame = 1
Query:  139 IIVNTWPFTKATDAAWCELQMS----GNVMKSVERGCTEAEYDLSIPTVGYGGSPNEKNVVALDAMIMNGDTMEVGAVASMPHVKNAIKVAHYVLKHTRHTLLVGNDAAEFAREMGFTWENLSTENSTELWNQWKLKNCQPNFRRNVSPNPKQNCGPYKPISKKLLDDNYRVPGTVN--EHHHDTIGMIAMNKSGSMAVGTSTNGAIFKVPGRVGDTAIPGSGGYVDSTIGGAVGTGDGDILMRFLLSYQAVEFMRQGLHPSKACVESLRRV-KQAGAWSGALVALNRAGEYGAACVG 1011
            +++NTWPF +A   AW  L +     G    +V  G +  E      TVGYGG+P+E+   +LDA++M+G TMEVGAV  +  +++AIKVA +VL+HT HTLLVG+ A EFA  MG  +E+L++E++ E    W   NCQPNF RNV P+P+ +CGPY+P+     D N +    +     +HDTI M A+++ G + VGTSTNG  + +PGRVGD +IPGS  Y D+ +G AV TGDGDILMRFL S  AVE MR G  P++A    ++R+ K    +  A++  NR G Y   C G
Sbjct:    1 MVINTWPFAEAKKEAWRLLNVKKGGLGQTRSAVVGGISMCEKLQCAKTVGYGGNPDERGDTSLDALLMDGGTMEVGAVGDLRRIRSAIKVAQHVLEHTLHTLLVGDGADEFANAMGLQYESLNSEDNIESLKNWTRHNCQPNFWRNVHPDPRTSCGPYQPLVT--WDPNAKQSDRIEIGPDNHDTITMAAIDEEGHIHVGTSTNGLRYTLPGRVGDASIPGSAAYADNEVGAAVTTGDGDILMRFLPSLLAVEAMRAGKTPAEAVELVIQRIQKHVKYFEVAVIVANRLGTYAVRCHG 296          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Fly
Match: CG4372 (gene:FBgn0034665 transcript:FBtr0071738)

HSP 1 Score: 238.81 bits (608), Expect = 2.024e-70
Identity = 115/306 (37.58%), Postives = 185/306 (60.46%), Query Frame = 1
Query:  124 SSFQDIIVNTWPFTKATDAAWCELQMS-GNVMKSVERGCTEAEYDLSIPTVGYGGSPNEKNVVALDAMIMNGDTMEVGAVASMPHVKNAIKVAHYVLKHTRHTLLVGNDAAEFAREMGFTWENLSTENSTELWNQWKLKNCQPNFRRNVSPNPKQNCGPYKPISKKLLDDNYRVPGTVNEHHHDTIGMIAMNKSGSMAVGTSTNGAIFKVPGRVGDTAIPGSGGYVDSTIGGAVGTGDGDILMRFLLSYQAVEFMRQGLHPSKACVESLRR-VKQAGAWSGALVALNRAGEYGAACVGFSDYYISI 1035
            +  Q ++++TW +T A   AW  LQ       ++V +GC   +       +    SP+ +  + L+A IM+G+++E GAVA M  V+NAI VA  VLK+T+H++LVG  A +FAR +G+  E L+   +  +  +W+   CQPNF R+V P+P +NCGPY P+ + +          + +  HD +  +A++  G   V + ++GA F++PGRVGD+A+PG+G Y D+ +GGAV +GDGD+LMR L ++ AVE MR G  P KA    ++R ++    ++GA+V +NR G Y AAC G  +++  +
Sbjct:   49 TEIQSLLISTWNYTDANLQAWSVLQQGPRRTRQAVIQGCMACQNQRCGRLLTGRSSPDTEGALTLEAAIMDGESLEYGAVAGMNGVRNAILVADAVLKYTKHSVLVGKSATKFARSLGYKEEYLTDARTRNVLKKWRSNGCQPNFWRDVHPSPAENCGPYSPLPEHMHQHPMHQEYAIIQGQHDQLAFLALDAEGKFHVASQSSGAQFRIPGRVGDSAVPGAGIYADNEVGGAVASGDGDVLMRHLPAFLAVEAMRAGKEPDKAAELVVQRLLRHNTEFNGAVVVVNRRGIYAAACAGLDEFHFVV 354          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Fly
Match: His2B:CG33888 (gene:FBgn0053888 transcript:FBtr0091892)

HSP 1 Score: 169.474 bits (428), Expect = 6.971e-49
Identity = 80/87 (91.95%), Postives = 84/87 (96.55%), Query Frame = -1
Query: 1195 IYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 1455
            IYIYKVL+QVHPDTGIS KAMSIMNSFVND+FERIA+EASRLAHYNK+STITSREIQT VRLLLPGELAKHAVSEGTKAVTKYT SK
Sbjct:   37 IYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Fly
Match: His2B:CG33904 (gene:FBgn0053904 transcript:FBtr0091908)

HSP 1 Score: 169.474 bits (428), Expect = 6.971e-49
Identity = 80/87 (91.95%), Postives = 84/87 (96.55%), Query Frame = -1
Query: 1195 IYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 1455
            IYIYKVL+QVHPDTGIS KAMSIMNSFVND+FERIA+EASRLAHYNK+STITSREIQT VRLLLPGELAKHAVSEGTKAVTKYT SK
Sbjct:   37 IYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Zebrafish
Match: aga (aspartylglucosaminidase [Source:ZFIN;Acc:ZDB-GENE-040426-2311])

HSP 1 Score: 317.005 bits (811), Expect = 2.219e-100
Identity = 153/299 (51.17%), Postives = 206/299 (68.90%), Query Frame = 1
Query:  139 IIVNTWPFTKATDAAWCELQMSGNVMKSVERGCTEAEYDLSIPTVGYGGSPNEKNVVALDAMIMNGDTMEVGAVASMPHVKNAIKVAHYVLKHTRHTLLVGNDAAEFAREMGFTWENLSTENSTELWNQWKLKNCQPNFRRNVSPNPKQNCGPYKPISKKLLDDNYRVPGTVNEHHHDTIGMIAMNKSGSMAVGTSTNGAIFKVPGRVGDTAIPGSGGYVDSTIGGAVGTGDGDILMRFLLSYQAVEFMRQGLHPSKACVESLRRVKQ-AGAWSGALVALNRAGEYGAAC---VGFSDY 1023
            +++NTW F  A  AAW  L+  G+V+ +VERGC   E      +VG+GGSP+E+    LDAMIMNGDTMEVGAVA +  VKNA+ VA  V++HT HT +VG  A  FA+ MGFT E+LST  S  +++QW  +NCQPN+R+NVSP+P ++CGPYKP +K+ +  + R  G  +   HDTIGM+ + + G +A  TSTNGA  K+PGRVGD+ + G+G Y DST+GGA  TGDGDI+MRFL S+ AVE MR G  P+ AC  ++ R+K+    + GA++  N AG+YGAAC    GFS +
Sbjct:   21 LVINTWRFEDAAGAAWKALEKGGSVLDAVERGCAYCELVQCDGSVGFGGSPDERGETTLDAMIMNGDTMEVGAVADLRRVKNAVGVARAVMEHTEHTFIVGESATIFAQNMGFTSEDLSTNKSIAIFSQWLQQNCQPNYRKNVSPDPSKSCGPYKPKAKQWMPKHPR--GNFDPRSHDTIGMVVIGRKGQVAAATSTNGATHKIPGRVGDSPVAGAGAYADSTVGGAAATGDGDIMMRFLPSFLAVELMRNGAQPTVACRTAINRIKKYYPDFFGAVICANTAGDYGAACNKRPGFSQF 317          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Zebrafish
Match: aga (aspartylglucosaminidase [Source:ZFIN;Acc:ZDB-GENE-040426-2311])

HSP 1 Score: 314.309 bits (804), Expect = 2.483e-99
Identity = 151/299 (50.50%), Postives = 205/299 (68.56%), Query Frame = 1
Query:  139 IIVNTWPFTKATDAAWCELQMSGNVMKSVERGCTEAEYDLSIPTVGYGGSPNEKNVVALDAMIMNGDTMEVGAVASMPHVKNAIKVAHYVLKHTRHTLLVGNDAAEFAREMGFTWENLSTENSTELWNQWKLKNCQPNFRRNVSPNPKQNCGPYKPISKKLLDDNYRVPGTVNEHHHDTIGMIAMNKSGSMAVGTSTNGAIFKVPGRVGDTAIPGSGGYVDSTIGGAVGTGDGDILMRFLLSYQAVEFMRQGLHPSKACVESLRRVKQ-AGAWSGALVALNRAGEYGAAC---VGFSDY 1023
            +++NTW F  A  AAW  L+   +V+ +VERGC   E      +VG+GGSP+E+    LDAMIMNGDTMEVGAVA +  VKNA+ VA  V++H+ HT +VG  A  FA+ MGFT E+LST  S  +++QW  +NCQPN+R+NVSP+P ++CGPYKP +K+ +  + R  G  +   HDTIGM+ + + G +A  TSTNGA  K+PGRVGD+ + G+G Y DST+GGA  TGDGDI+MRFL S+ AVE MR G  P+ AC  ++ R+K+    + GA++  N AG+YGAAC    GFS +
Sbjct:   21 LVINTWRFEDAAGAAWKALEKGSSVLDAVERGCAYCELVQCDGSVGFGGSPDERGETTLDAMIMNGDTMEVGAVADLRRVKNAVGVARAVMEHSEHTFIVGESATIFAQNMGFTSEDLSTNKSIAIFSQWLQQNCQPNYRKNVSPDPSKSCGPYKPKAKQWMSKHPR--GNFDPRSHDTIGMVVIGRQGQVAAATSTNGATHKIPGRVGDSPVAGAGAYADSTVGGAAATGDGDIMMRFLPSFLAVELMRNGAQPTVACRTAINRIKKYYPDFFGAVICANTAGDYGAACNKRPGFSQF 317          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Zebrafish
Match: si:ch211-190p8.2 (si:ch211-190p8.2 [Source:ZFIN;Acc:ZDB-GENE-070424-145])

HSP 1 Score: 166.777 bits (421), Expect = 6.439e-48
Identity = 78/87 (89.66%), Postives = 84/87 (96.55%), Query Frame = -1
Query: 1195 IYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 1455
            +YIYKVL+QVHPDTGIS +AMSIMNSFVNDVFERIA+EASRLAHYNK+STITSRE+QT VRLLLPGELAKHAVSEGTKAVTKYT SK
Sbjct:   32 VYIYKVLKQVHPDTGISSRAMSIMNSFVNDVFERIATEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 118          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Zebrafish
Match: zgc:194989 (zgc:194989 [Source:ZFIN;Acc:ZDB-GENE-080723-3])

HSP 1 Score: 166.007 bits (419), Expect = 1.520e-47
Identity = 78/87 (89.66%), Postives = 82/87 (94.25%), Query Frame = -1
Query: 1195 IYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 1455
            IY+YKVL+QVHPDTGIS KAM IMNSFVND+FERIA EASRLAHYNK+STITSREIQT VRLLLPGELAKHAVSEGTKAVTKYT SK
Sbjct:   38 IYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 124          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Zebrafish
Match: hist2h2l (histone 2, H2, like [Source:NCBI gene;Acc:386920])

HSP 1 Score: 166.007 bits (419), Expect = 1.770e-47
Identity = 78/87 (89.66%), Postives = 82/87 (94.25%), Query Frame = -1
Query: 1195 IYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 1455
            IY+YKVL+QVHPDTGIS KAM IMNSFVND+FERIA EASRLAHYNK+STITSREIQT VRLLLPGELAKHAVSEGTKAVTKYT SK
Sbjct:   40 IYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 126          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Xenopus
Match: lurap1l (leucine rich adaptor protein 1-like [Source:Xenbase;Acc:XB-GENE-958293])

HSP 1 Score: 320.472 bits (820), Expect = 1.813e-101
Identity = 151/303 (49.83%), Postives = 214/303 (70.63%), Query Frame = 1
Query:  139 IIVNTWPFTKATDAAWCELQMSGNVMKSVERGCTEAEYDLSIPTVGYGGSPNEKNVVALDAMIMNGDTMEVGAVASMPHVKNAIKVAHYVLKHTRHTLLVGNDAAEFAREMGFTWENLSTENSTELWNQWKLKNCQPNFRRNVSPNPKQNCGPYKPISKKLLDDNYRVPGTVNEHHHDTIGMIAMNKSGSMAVGTSTNGAIFKVPGRVGDTAIPGSGGYVDSTIGGAVGTGDGDILMRFLLSYQAVEFMRQGLHPSKACVESLRRVKQAGA-WSGALVALNRAGEYGAAC---VGFSDYYISI 1035
            +++NTWPF  AT+AAW  L+  G+V+ +VE+GC + E D    +VGYGGSP+E     LDAMIMNG+TME+GAVA +  +KNAI VA  V++HT+HT LVG  A+ FA  MGF  E+L+T +S  + ++W  ++CQPN+ +NV P+  ++CGPY P      +    +   +N H+HDTIGMIA++K+G++AVGTSTNGA  K+PGRVGD+ IPG+G Y DS +GGA  TGDGDI+MRFL SYQAVE+MR G  P+ AC +++ R+++    + GA++  N  G YGAAC    GF +++ ++
Sbjct:   29 LVINTWPFRNATEAAWRVLEAGGSVLDAVEKGCAQCEIDQCDGSVGYGGSPDENGETTLDAMIMNGNTMEIGAVAQLRRIKNAIGVARAVMEHTKHTFLVGESASLFAESMGFMREDLTTNHSRSIHSKWLDQSCQPNYWKNVVPDALKSCGPYHPFKGVKNEKQSPLQQKINVHNHDTIGMIAIDKAGNVAVGTSTNGATHKIPGRVGDSPIPGAGAYADSVVGGAAATGDGDIMMRFLPSYQAVEYMRMGSDPTAACQKAIGRIQKYFPNFFGAVICANSTGSYGAACNKIPGFKEFHFTV 331          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Xenopus
Match: lurap1l (leucine rich adaptor protein 1-like [Source:Xenbase;Acc:XB-GENE-958293])

HSP 1 Score: 310.842 bits (795), Expect = 4.784e-98
Identity = 146/290 (50.34%), Postives = 204/290 (70.34%), Query Frame = 1
Query:  139 IIVNTWPFTKATDAAWCELQMSGNVMKSVERGCTEAEYDLSIPTVGYGGSPNEKNVVALDAMIMNGDTMEVGAVASMPHVKNAIKVAHYVLKHTRHTLLVGNDAAEFAREMGFTWENLSTENSTELWNQWKLKNCQPNFRRNVSPNPKQNCGPYKPISKKLLDDNYRVPGTVNEHHHDTIGMIAMNKSGSMAVGTSTNGAIFKVPGRVGDTAIPGSGGYVDSTIGGAVGTGDGDILMRFLLSYQAVEFMRQGLHPSKACVESLRRVKQAGA-WSGALVALNRAGEYGAAC 1005
            +++NTWPF  AT+AAW  L+  G+V+ +VE+GC + E D    +VGYGGSP+E     LDAMIMNG+TME+GAVA +  +KNAI VA  V++HT+HT LVG  A+ FA  MGF  E+L+T +S  + ++W  ++CQPN+ +NV P+  ++CGPY P      +    +   +N H+HDTIGMIA++K+G++AVGTSTNGA  K+PGRVGD+ IPG+G Y DS +GGA  TGDGDI+MRFL SYQAVE+MR G  P+ AC +++ R+++    + GA++  N  G Y   C
Sbjct:   29 LVINTWPFRNATEAAWRVLEAGGSVLDAVEKGCAQCEIDQCDGSVGYGGSPDENGETTLDAMIMNGNTMEIGAVAQLRRIKNAIGVARAVMEHTKHTFLVGESASLFAESMGFMREDLTTNHSRSIHSKWLDQSCQPNYWKNVVPDALKSCGPYHPFKGVKNEKQSPLQQKINVHNHDTIGMIAIDKAGNVAVGTSTNGATHKIPGRVGDSPIPGAGAYADSVVGGAAATGDGDIMMRFLPSYQAVEYMRMGSDPTAACQKAIGRIQKYFPNFFGAVICANSTGSYVTIC 318          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Xenopus
Match: abcb11.2 (ATP binding cassette subfamily B member 11, gene 2 [Source:Xenbase;Acc:XB-GENE-988819])

HSP 1 Score: 167.933 bits (424), Expect = 4.733e-48
Identity = 79/87 (90.80%), Postives = 83/87 (95.40%), Query Frame = -1
Query: 1195 IYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 1455
            IY+YKVL+QVHPDTGIS KAMSIMNSFVNDVFERIA EASRLAHYNK+STITSREIQT VRLLLPGELAKHAVSEGTKAVTKYT +K
Sbjct:   40 IYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK 126          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Xenopus
Match: ENSXETT00000016353.1 (histone H2B 1.1-like [Source:NCBI gene;Acc:100485134])

HSP 1 Score: 167.933 bits (424), Expect = 4.733e-48
Identity = 79/87 (90.80%), Postives = 83/87 (95.40%), Query Frame = -1
Query: 1195 IYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 1455
            IY+YKVL+QVHPDTGIS KAMSIMNSFVNDVFERIA EASRLAHYNK+STITSREIQT VRLLLPGELAKHAVSEGTKAVTKYT +K
Sbjct:   40 IYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK 126          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Xenopus
Match: phc2 (polyhomeotic homolog 2 [Source:Xenbase;Acc:XB-GENE-996998])

HSP 1 Score: 167.933 bits (424), Expect = 4.733e-48
Identity = 79/87 (90.80%), Postives = 83/87 (95.40%), Query Frame = -1
Query: 1195 IYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 1455
            IY+YKVL+QVHPDTGIS KAMSIMNSFVNDVFERIA EASRLAHYNK+STITSREIQT VRLLLPGELAKHAVSEGTKAVTKYT +K
Sbjct:   40 IYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK 126          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Mouse
Match: Aga (aspartylglucosaminidase [Source:MGI Symbol;Acc:MGI:104873])

HSP 1 Score: 271.937 bits (694), Expect = 3.765e-83
Identity = 153/295 (51.86%), Postives = 195/295 (66.10%), Query Frame = 1
Query:  124 SSFQDIIVNTWPFTKATDAAWCELQMSGNVMKSVERGCTEAEYDLSIPTVGYGGSPNEKNVVALDAMIMNGDTMEVGAVASMPHVKNAIKVAHYVLKHTRHTLLVGNDAAEFAREMGFTWENLSTENSTELWNQWKLKNCQPNFRRNVSPNPKQNCGPYKPISKKLLDDNYRVPGTVNEHHHDTIGMIAMNKSGSMAVGTSTNGAIFKVPGRVGDTAIPGSGGYVDSTIGGAVGTGDGDILMRFLLSYQAVEFMRQGLHPSKACVESLRRV-KQAGAWSGALVALNRAGEYGAAC 1005
            SS   ++VNTWPF  AT+AAW  L   G+ + +VE GC   E +    TVG+GGSP+E     LDAMIM+G  M+VGAV  +  +KNAI VA  VL+HT HTLLVG+ A +FA  MGFT E+LST+ S +L + W  +NCQPN+ RNV P+P + CGPYKP S  L          V+ H HDTIGM+ ++K+G  A GTSTNG  FK+PGRVGD+ IPG+G Y D T G A  TGDGD L+RFL SYQAVE+MR G  P+ AC + + R+ K    + GA++  +  G YGAAC
Sbjct:   24 SSPLPLVVNTWPFKNATEAAWWTLLSGGSALDAVENGCAVCEKEQCDGTVGFGGSPDEGGETTLDAMIMDGTAMDVGAVGGLRRIKNAIGVARRVLEHTTHTLLVGDSATKFAESMGFTNEDLSTKTSRDLHSDWLSRNCQPNYWRNVIPDPSKYCGPYKP-SGFLKQSISPHKEEVDIHSHDTIGMVVIHKTGHTAAGTSTNGIKFKIPGRVGDSPIPGAGAYADDTAGAAAATGDGDTLLRFLPSYQAVEYMRGGDDPAIACQKVILRIQKYYPNFFGAVICASVNGSYGAAC 317          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Mouse
Match: Aga (aspartylglucosaminidase [Source:MGI Symbol;Acc:MGI:104873])

HSP 1 Score: 248.44 bits (633), Expect = 1.288e-74
Identity = 146/295 (49.49%), Postives = 187/295 (63.39%), Query Frame = 1
Query:  124 SSFQDIIVNTWPFTKATDAAWCELQMSGNVMKSVERGCTEAEYDLSIPTVGYGGSPNEKNVVALDAMIMNGDTMEVGAVASMPHVKNAIKVAHYVLKHTRHTLLVGNDAAEFAREMGFTWENLSTENSTELWNQWKLKNCQPNFRRNVSPNPKQNCGPYKPISKKLLDDNYRVPGTVNEHHHDTIGMIAMNKSGSMAVGTSTNGAIFKVPGRVGDTAIPGSGGYVDSTIGGAVGTGDGDILMRFLLSYQAVEFMRQGLHPSKACVESLRRV-KQAGAWSGALVALNRAGEYGAAC 1005
            SS   ++VNTWPF  AT+AAW  L   G+ + +VE GC   E +    TVG+GGSP+E     LDAMIM+G  M+VGAV  +  +KNAI VA  VL+HT HTLLVG+ A +FA  MGFT E+LST+ S +L + W  +NCQPN+ RNV P+P + CGPYKP S  L          V+ H HDTIGM+ ++K+G  A GTSTN          GD+ IPG+G Y D T G A  TGDGD L+RFL SYQAVE+MR G  P+ AC + + R+ K    + GA++  +  G YGAAC
Sbjct:   24 SSPLPLVVNTWPFKNATEAAWWTLLSGGSALDAVENGCAVCEKEQCDGTVGFGGSPDEGGETTLDAMIMDGTAMDVGAVGGLRRIKNAIGVARRVLEHTTHTLLVGDSATKFAESMGFTNEDLSTKTSRDLHSDWLSRNCQPNYWRNVIPDPSKYCGPYKP-SGFLKQSISPHKEEVDIHSHDTIGMVVIHKTGHTAAGTSTN----------GDSPIPGAGAYADDTAGAAAATGDGDTLLRFLPSYQAVEYMRGGDDPAIACQKVILRIQKYYPNFFGAVICASVNGSYGAAC 307          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Mouse
Match: H2bc1 (H2B clustered histone 1 [Source:MGI Symbol;Acc:MGI:2448375])

HSP 1 Score: 168.318 bits (425), Expect = 2.447e-48
Identity = 80/87 (91.95%), Postives = 83/87 (95.40%), Query Frame = -1
Query: 1195 IYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 1455
            IYIYKVL+QVHPDTGIS KAMSIMNSFV D+FERIASEASRLAHYNK+STITSREIQT VRLLLPGELAKHAVSEGTKAVTKYT SK
Sbjct:   41 IYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 127          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Mouse
Match: H2bc11 (H2B clustered histone 11 [Source:MGI Symbol;Acc:MGI:2448388])

HSP 1 Score: 167.933 bits (424), Expect = 4.196e-48
Identity = 78/87 (89.66%), Postives = 83/87 (95.40%), Query Frame = -1
Query: 1195 IYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 1455
            +Y+YKVL+QVHPDTGIS KAM IMNSFVND+FERIASEASRLAHYNK+STITSREIQT VRLLLPGELAKHAVSEGTKAVTKYT SK
Sbjct:   40 VYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 126          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Mouse
Match: Hist1h2br (histone cluster 1 H2br [Source:MGI Symbol;Acc:MGI:3710645])

HSP 1 Score: 167.933 bits (424), Expect = 4.196e-48
Identity = 78/87 (89.66%), Postives = 83/87 (95.40%), Query Frame = -1
Query: 1195 IYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 1455
            +Y+YKVL+QVHPDTGIS KAM IMNSFVND+FERIASEASRLAHYNK+STITSREIQT VRLLLPGELAKHAVSEGTKAVTKYT SK
Sbjct:   40 VYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 126          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. UniProt/SwissProt
Match: sp|B4NWI1|ASPG1_DROYA (Putative N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase GE19290 OS=Drosophila yakuba OX=7245 GN=GE19290 PE=3 SV=1)

HSP 1 Score: 298.901 bits (764), Expect = 7.938e-92
Identity = 152/309 (49.19%), Postives = 204/309 (66.02%), Query Frame = 1
Query:  121 SSSFQDIIVNTWPFTKATDAAWCELQMSGNVMK----SVERGCTEAEYDLSIPTVGYGGSPNEKNVVALDAMIMNGDTMEVGAVASMPHVKNAIKVAHYVLKHTRHTLLVGNDAAEFAREMGFTWENLSTENSTELWNQWKLKNCQPNFRRNVSPNPKQNCGPYKPISKKLL---DDNYRVPGTVNEHHHDTIGMIAMNKSGSMAVGTSTNGAIFKVPGRVGDTAIPGSGGYVDSTIGGAVGTGDGDILMRFLLSYQAVEFMRQGLHPSKACVESLRR-VKQAGAWSGALVALNRAGEYGAACVGFSDY 1023
            +S    +++NTW FT A   AW  L+ S   ++    +V  GC++ E      TVGYGGSP+E     LDAM+M+G TMEVGAVA +  +K+AIKVA +VL+HT+HT+LVG+ A+ FA  MGF  E+L T  S ++W QW  +NCQPNF +NV P+PK +CGPYKP    L    +D  R    +   +HDTIGMIA++   ++  GTSTNGA  K+PGRVGD+ IPG+G Y D+ +G AV TGDGD++MRFL S  AVE MR G  P+ A  ESLRR ++    + GAL+A++R G YGAAC G  ++
Sbjct:   55 ASELLPMVINTWNFTAANVLAWRILKQSKGGLRQTRNAVVEGCSKCEKLQCDRTVGYGGSPDELGETTLDAMVMDGATMEVGAVAGLRRIKDAIKVARHVLEHTQHTMLVGDAASAFANAMGFESESLVTPESKDMWLQWTAENCQPNFWKNVHPDPKVSCGPYKPRPTPLTRWKEDRARNEYEIGRKNHDTIGMIAIDVESNIHAGTSTNGARHKIPGRVGDSPIPGAGAYADNEVGAAVATGDGDVMMRFLPSLLAVEAMRAGKPPADAAEESLRRIIRHHKDFMGALIAVDRLGRYGAACYGLDEF 363          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. UniProt/SwissProt
Match: sp|O02467|ASPG_SPOFR (N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase (Fragment) OS=Spodoptera frugiperda OX=7108 PE=1 SV=1)

HSP 1 Score: 294.664 bits (753), Expect = 2.931e-91
Identity = 142/297 (47.81%), Postives = 204/297 (68.69%), Query Frame = 1
Query:  139 IIVNTWPFTKATDAAWCELQMSGNVMKSVERGCTEAEYDLSIPTVGYGGSPNEKNVVALDAMIMNGDTMEVGAVASMPHVKNAIKVAHYVLKHTRHTLLVGNDAAEFAREMGFTWENLSTENSTELWNQWKL-KNCQPNFRRNVSPNPKQNCGPYKPISKKLLDDNYRVPGTVNEHHHDTIGMIAMNKSGSMAVGTSTNGAIFKVPGRVGDTAIPGSGGYVDSTIGGAVGTGDGDILMRFLLSYQAVEFMRQGLHPSKACVESLRRVK-QAGAWSGALVALNRAGEYGAACVGFSDY 1023
            I++ TW FT A+  AW  L+  G  + +VE+G    E +    TVGYGGSP+E     LDA IM+G TM VGAVA++  +K+AI VA +V+++T H+ L G  A +FA EMGF  E+LST+ S ELW++W+  K CQPNFR+NV P+P+++CGPY    +  +D  +     V++++HDTIGM+A++  G +A GTSTNGA FK+PGRVGD+ IPG+G Y D+T+GGA  TG+GD +MRFL S+ AVE MR+G  P+ A   +++R+      + GA++AL++ G+YGAAC G   +
Sbjct:    6 IVITTWSFTNASQKAWEVLKDEGKALDAVEQGGIVCENEQCDRTVGYGGSPDEDGETTLDAFIMDGSTMNVGAVAALRRIKSAISVARHVMEYTTHSFLAGELATKFAVEMGFKEESLSTDESRELWSKWRFEKQCQPNFRKNVKPDPRKHCGPYHK-KRNFVDYIHPEVFVVDQYNHDTIGMVAVDSKGDVAAGTSTNGAKFKIPGRVGDSPIPGAGAYADNTVGGAAATGNGDTMMRFLPSFLAVEEMRRGASPANAAKTAIKRISAHHPDFMGAVIALSKNGQYGAACNGIETF 301          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. UniProt/SwissProt
Match: sp|Q8MR45|ASPG1_DROME (Putative N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase CG1827 OS=Drosophila melanogaster OX=7227 GN=CG1827 PE=2 SV=1)

HSP 1 Score: 296.204 bits (757), Expect = 8.205e-91
Identity = 150/303 (49.50%), Postives = 203/303 (67.00%), Query Frame = 1
Query:  139 IIVNTWPFTKATDAAWCELQMSGNVMK----SVERGCTEAEYDLSIPTVGYGGSPNEKNVVALDAMIMNGDTMEVGAVASMPHVKNAIKVAHYVLKHTRHTLLVGNDAAEFAREMGFTWENLSTENSTELWNQWKLKNCQPNFRRNVSPNPKQNCGPYKPISKKLL---DDNYRVPGTVNEHHHDTIGMIAMNKSGSMAVGTSTNGAIFKVPGRVGDTAIPGSGGYVDSTIGGAVGTGDGDILMRFLLSYQAVEFMRQGLHPSKACVESLRRV-KQAGAWSGALVALNRAGEYGAACVGFSDY 1023
            +++NTW FT A   AW  L+ S   ++    +V  GC++ E      TVGYGGSP+E     LDAM+M+G TM+VGAVA +  +K+AIKVA +VL+HT+HT+LVG+ A+ FA  MGF  E+L T  S ++W QW  +NCQPNF +NV P+PK +CGPYKP    L    +D  R    +   +HDTIGMIA++   ++  GTSTNGA  K+PGRVGD+ IPG+G Y D+ +G AV TGDGD++MRFL S  AVE MR G  P++A  E LRR+ K    + GAL+A++R G YGAAC G +++
Sbjct:   58 MVINTWNFTAANVLAWRILKQSKGGLRQTRNAVVEGCSKCEKLQCDRTVGYGGSPDELGETTLDAMVMDGATMDVGAVAGLRRIKDAIKVARHVLEHTQHTMLVGDAASAFANAMGFESESLVTPESKDMWLQWTAENCQPNFWKNVHPDPKVSCGPYKPRPTPLTRWKEDRARNEYEIGRKNHDTIGMIAIDVESNIHAGTSTNGARHKIPGRVGDSPIPGAGAYADNEVGAAVATGDGDVMMRFLPSLLAVETMRAGKPPAEAAQEGLRRILKHHKDFMGALIAVDRLGNYGAACYGLAEF 360          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. UniProt/SwissProt
Match: sp|B4HT15|ASPG1_DROSE (Putative N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase GM21137 OS=Drosophila sechellia OX=7238 GN=GM21137 PE=3 SV=1)

HSP 1 Score: 294.664 bits (753), Expect = 3.163e-90
Identity = 149/303 (49.17%), Postives = 203/303 (67.00%), Query Frame = 1
Query:  139 IIVNTWPFTKATDAAWCELQMSGNVMK----SVERGCTEAEYDLSIPTVGYGGSPNEKNVVALDAMIMNGDTMEVGAVASMPHVKNAIKVAHYVLKHTRHTLLVGNDAAEFAREMGFTWENLSTENSTELWNQWKLKNCQPNFRRNVSPNPKQNCGPYKPISKKLL---DDNYRVPGTVNEHHHDTIGMIAMNKSGSMAVGTSTNGAIFKVPGRVGDTAIPGSGGYVDSTIGGAVGTGDGDILMRFLLSYQAVEFMRQGLHPSKACVESLRRV-KQAGAWSGALVALNRAGEYGAACVGFSDY 1023
            +++NTW FT A   AW  L+ S   ++    +V  GC++ E      TVGYGGSP+E     LDAM+M+G TM+VGAVA +  +K+AIKVA +VL+HT+HT+LVG+ A+ FA  MGF  E+L T  S ++W QW  +NCQPNF +NV P+PK +CGPYKP    L    +D  R    +   +HDTIGMIA++   ++  GTSTNGA  K+PGRVGD+ IPG+G Y D+ +G AV TGDGD++MRFL S  AVE MR G  P++A  + LRR+ K    + GAL+A++R G YGAAC G +++
Sbjct:   58 MVINTWNFTAANVLAWRILKQSKGGLRQTRNAVVEGCSKCEKLQCDRTVGYGGSPDELGETTLDAMVMDGATMDVGAVAGLRRIKDAIKVARHVLEHTQHTMLVGDAASAFANAMGFESESLVTPESKDMWLQWTAENCQPNFWKNVHPDPKVSCGPYKPRPTPLTRWKEDRARNEYEIGRKNHDTIGMIAIDVENNIHAGTSTNGANHKIPGRVGDSPIPGAGAYADNEVGAAVATGDGDVMMRFLPSLLAVEAMRAGKPPAEAAQKGLRRILKHQKDFMGALIAVDRLGNYGAACYGLAEF 360          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. UniProt/SwissProt
Match: sp|B3N6Y7|ASPG1_DROER (Putative N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase GG24090 OS=Drosophila erecta OX=7220 GN=GG24090 PE=3 SV=1)

HSP 1 Score: 293.508 bits (750), Expect = 9.269e-90
Identity = 149/303 (49.17%), Postives = 201/303 (66.34%), Query Frame = 1
Query:  139 IIVNTWPFTKATDAAWCELQMSGNVMK----SVERGCTEAEYDLSIPTVGYGGSPNEKNVVALDAMIMNGDTMEVGAVASMPHVKNAIKVAHYVLKHTRHTLLVGNDAAEFAREMGFTWENLSTENSTELWNQWKLKNCQPNFRRNVSPNPKQNCGPYKPISKKLL---DDNYRVPGTVNEHHHDTIGMIAMNKSGSMAVGTSTNGAIFKVPGRVGDTAIPGSGGYVDSTIGGAVGTGDGDILMRFLLSYQAVEFMRQGLHPSKACVESLRRV-KQAGAWSGALVALNRAGEYGAACVGFSDY 1023
            +++NTW FT A   AW  L+ S   ++    +V  GC++ E      TVGYGGSP+E     LDAM+M+G TM+VGAVA +  +K+AIKVA +VL+HT+HT+LVG+ A+ FA  MGF  E+L T  S ++W QW  +NCQPNF +NV P+PK +CGPYKP    L    +D  R    +   +HDTIGMIA++   ++  GTSTNGA  K+PGRVGD+ IPG+G Y D+ +G AV TGDGD++MRFL S  AVE MR G  P++A  E LRR+ K    + GAL+A++R G Y AAC G  ++
Sbjct:   61 MVINTWKFTAANVLAWRILKQSKGGLRQTRNAVVEGCSKCEKLQCDRTVGYGGSPDELGETTLDAMVMDGATMDVGAVAGLRRIKDAIKVARHVLEHTQHTMLVGDAASAFANAMGFESESLITPESKDMWLQWTAENCQPNFWKNVHPDPKVSCGPYKPRPTPLTRWKEDRARNEYEIGRKNHDTIGMIAIDVESNIHAGTSTNGARHKIPGRVGDSPIPGAGAYADNEVGAAVATGDGDVMMRFLPSLLAVEAMRAGKPPAEAAQEGLRRILKYHKDFMGALIAVDRLGNYAAACYGLDEF 363          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. TrEMBL
Match: A0A4S2M511 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002666 PE=4 SV=1)

HSP 1 Score: 368.622 bits (945), Expect = 8.483e-117
Identity = 178/316 (56.33%), Postives = 227/316 (71.84%), Query Frame = 1
Query:  121 SSSFQDIIVNTWPFTKATDAAWCELQMS---------GNVMKSVERGCTEAEYDLSIPTVGYGGSPNEKNVVALDAMIMNGDTMEVGAVASMPHVKNAIKVAHYVLKHTRHTLLVGNDAAEFAREMGFTWENLSTENSTELWNQWKLKNCQPNFRRNVS--PNPKQNCGPYKPISKKLLDDNYRVPGTVNEHHHDTIGMIAMNKSGSMAVGTSTNGAIFKVPGRVGDTAIPGSGGYVDSTIGGAVGTGDGDILMRFLLSYQAVEFMRQGLHPSKACVESLRRVKQAGAWSGALVALNRAGEYGAACVGFSDYYISI 1035
            S  F  I+V TWPFTK TDAAW  L            G  M +V  GCT AE D SI TVGYGGSP+E+    LDAM+M+G TMEVGAVA +P ++ A +VA  VL  T HTLLVG  AAEFA+  GF+ E + T +S ELW +W+  NCQPN+RR+ +  P+P  + GPYKP+ K       R    ++E HHDTIGMIA+++ GSMAVG ST+GA+ K+PGRVGD+ IPG+GGYVD+ +GGAVGTGDGD++MRFLL++Q V+FMRQGL+P++ACV+SL+ VK A  W GALVALN +GEYGAACVG   ++I++
Sbjct:    4 SQYFDPIVVTTWPFTKPTDAAWEILSSESVSQGNTVFGTAMDAVVEGCTVAEDDRSIKTVGYGGSPDEEGHTTLDAMVMDGRTMEVGAVAGLPQIRRATQVAREVLHSTYHTLLVGEKAAEFAKSRGFSAEPMETPDSQELWQRWRANNCQPNYRRSGAWDPDPATSGGPYKPVFKSYHQTQPREGNLIDEDHHDTIGMIALDRYGSMAVGVSTSGAVHKIPGRVGDSPIPGAGGYVDNDVGGAVGTGDGDVMMRFLLTFQVVQFMRQGLNPTEACVKSLQSVKHALPWRGALVALNISGEYGAACVGIEKFHINL 319          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. TrEMBL
Match: A0A183A970 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS3505 PE=4 SV=1)

HSP 1 Score: 363.229 bits (931), Expect = 1.512e-114
Identity = 190/344 (55.23%), Postives = 235/344 (68.31%), Query Frame = 1
Query:   85 IGVLLFFGIIGMSSSFQDIIVNTWPFTKATDAAWCELQMS---------GNVMKSVERGCTEAEYDLSIPTVGYGGSPNEKNVVALDAMIMNGDTMEVGAVASMPHVKNAIKVAHYVLKHTRHTLLVGNDAAEFAREMGFTWENLSTENSTELWNQWKLKNCQPNFRRNVS--PNPKQNCGPYKPISKKLLDDNYRVPGTVNEHHHDTIGMIAMNKSGSMAVGTSTNGAIFKVPGRVGDTAIPGSGGYVDSTIGGAVGTGDGDILMRFLLSYQAVEFMRQGLHPSKACVESLRRVKQAGAWSGALVALNRAGEYGAACVGFSDYYISIXXXXXXXXXXXXKINC 1083
            I ++ F   I  S S   I+V TWPFTKATDAAW  L  +         G  + +V  GC+ AE D  I +VGYG SP+E+    LDAM+M+GDTM VGAVA+MP++++A +VA  VL  T+HTLL G+ AA+FA   G+T E+L T  S ELW +WK   CQPN+R   S  P+P   CGPY P          R  GTVNE  HDTIGMIAM+  GSMAVG ST+GAI K+PGRVGDT IPGSGGYVDS IGGAVGTGDGD+LMRF LS+Q V +MRQG  P +AC  SL+ VKQ G WSGALVA+N+ G+YGAACVGF  + ++IR+V+T N++  + I C
Sbjct:    9 IFLVKFVSGISSSQSKHVIVVCTWPFTKATDAAWEVLSQNVLIHNESRVGTAVNAVVAGCSNAEEDRIITSVGYGCSPDEEGHTTLDAMVMDGDTMNVGAVAAMPYIRHAAQVAREVLYTTKHTLLAGHQAAKFAITRGYTPESLDTPESKELWRKWKANKCQPNYREPSSWIPDPSAQCGPYGPKWTAFQKTANRPKGTVNEQQHDTIGMIAMDAHGSMAVGLSTSGAIHKIPGRVGDTPIPGSGGYVDSEIGGAVGTGDGDVLMRFALSFQTVFYMRQGTSPEEACKLSLKSVKQEGVWSGALVAMNKTGQYGAACVGFGKFQMAIRSVQTGNSSTVLTIEC 352          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. TrEMBL
Match: A0A4E0RSN4 (Beta N acetylglucosaminyl L asparaginase OS=Fasciola hepatica OX=6192 GN=D915_004947 PE=4 SV=1)

HSP 1 Score: 353.984 bits (907), Expect = 6.161e-111
Identity = 175/325 (53.85%), Postives = 228/325 (70.15%), Query Frame = 1
Query:  142 IVNTWPFTKATDAAWCEL---------QMSGNVMKSVERGCTEAEYDLSIPTVGYGGSPNEKNVVALDAMIMNGDTMEVGAVASMPHVKNAIKVAHYVLKHTRHTLLVGNDAAEFAREMGFTWENLSTENSTELWNQWKLKNCQPNFRRNVS--PNPKQNCGPYKPISKKLLDDNYRVPGTVNEHHHDTIGMIAMNKSGSMAVGTSTNGAIFKVPGRVGDTAIPGSGGYVDSTIGGAVGTGDGDILMRFLLSYQAVEFMRQGLHPSKACVESLRRVKQAGAWSGALVALNRAGEYGAACVGFSDYYISIXXXXXXXXXXXXKINC 1083
            +++TWPFTKATDAAW  L         Q +   + +V  GC++AE D +I +VGYG SP+E+    LDAM+++GDTM VGAVA+MP+++ A +VA  VL  T+H+L+VG  A+EFA   G+  ++L T  S ELWN+WK  NCQPN+R   +  P+P+  CGPY P          R  GTV+E HHDTIGMIA++  GSMAVG ST+GAI K+PGRVGDT IPGSGGYVDS +GGAVGTGDGD+LMRF LS+QAV +MR G+ P  AC  SL+ VKQ   WSGALVALN  G YGAACVGF  +  ++R+  T N+++ + ++C
Sbjct:   29 VISTWPFTKATDAAWEVLSQRIYINGEQTTSTAVNAVVAGCSQAEEDRTITSVGYGCSPDEEGHTTLDAMVIDGDTMNVGAVAAMPYIRQAAQVAREVLYTTKHSLIVGIKASEFAVSRGYQKQSLDTPESIELWNKWKAANCQPNYREPSTWIPDPQTQCGPYGPKWTAQYQTGDRPEGTVDEDHHDTIGMIAIDAYGSMAVGLSTSGAIHKIPGRVGDTPIPGSGGYVDSEVGGAVGTGDGDVLMRFSLSFQAVSYMRNGISPEDACAMSLKSVKQTEKWSGALVALNATGHYGAACVGFGKFQFALRSENTGNSSIVLTVDC 353          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. TrEMBL
Match: A0A504YS82 (N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase OS=Fasciola gigantica OX=46835 GN=FGIG_11290 PE=4 SV=1)

HSP 1 Score: 342.428 bits (877), Expect = 3.452e-106
Identity = 177/350 (50.57%), Postives = 231/350 (66.00%), Query Frame = 1
Query:  142 IVNTWPFTKATDAAWCEL---------QMSGNVMKSVERGCTEAEYDLSIPTVGYGGSPNEKNVVALDAMIMNGDTMEVGAVASMPHVKNAIKVAHYVLKHTRHTLLVGNDAAEFAREMGFTWENLSTENSTELWNQWKLKNCQPNFRRNVS--PNPKQNCGPYKPISKKLLDDNY-------------------------RVPGTVNEHHHDTIGMIAMNKSGSMAVGTSTNGAIFKVPGRVGDTAIPGSGGYVDSTIGGAVGTGDGDILMRFLLSYQAVEFMRQGLHPSKACVESLRRVKQAGAWSGALVALNRAGEYGAACVGFSDYYISIXXXXXXXXXXXXKINC 1083
            +++TWPFTKATDAAW  L         Q++   + +V  GC++AE D +I +VGYG SP+E+    LDAM+++GDTM VGAVA+MP+++ A +VA  VL  T+H+L+VG  A EFA   G+  ++L T  S ELWN+WK  NCQPN+R   +  P+P+  CGPY P    +   NY                         R  GTV+E HHDTIGMIA++  GSMAVG ST+GAI K+PGRVGDT IPGSGGYVDS +GGAVGTGDGD+LMRF LS+QAV +MR G+ P  AC  SL+ VKQ   WSGALVALN  G YGAACVGF  +  ++R+  T N+++ + ++C
Sbjct:   29 VISTWPFTKATDAAWEVLSQSIYINGEQITSTAVNAVVAGCSQAEEDRTITSVGYGCSPDEEGHTTLDAMVIDGDTMNVGAVAAMPYIRQAAQVAREVLCTTKHSLIVGIKATEFAMSRGYQKQSLDTPESIELWNKWKAANCQPNYREPSTWIPDPQTQCGPYGPKWTDV-QQNYELIYPPPSHFNSGYYYHVAQYQTGDRPEGTVDEDHHDTIGMIAIDAYGSMAVGLSTSGAIHKIPGRVGDTPIPGSGGYVDSEVGGAVGTGDGDVLMRFSLSFQAVSYMRNGISPEDACAMSLKSVKQTEKWSGALVALNATGHYGAACVGFGKFQFALRSENTGNSSIVLTVDC 377          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. TrEMBL
Match: A0A564YTB3 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS9477 PE=4 SV=1)

HSP 1 Score: 336.65 bits (862), Expect = 3.565e-104
Identity = 163/321 (50.78%), Postives = 217/321 (67.60%), Query Frame = 1
Query:  139 IIVNTWPFTKATDAAWCELQMSGNVMKSVERGCTEAEYDLSIPTVGYGGSPNEKNVVALDAMIMNGDTMEVGAVASMPHVKNAIKVAHYVLKHTRHTLLVGNDAAEFAREMGFTWENLSTENSTELWNQWKLKNCQPNFRRNVS--PNPKQNCGPYK-PISKKLLDDNYRVPGTVNEHHHDTIGMIAMNKSGSMAVGTSTNGAIFKVPGRVGDTAIPGSGGYVDSTIGGAVGTGDGDILMRFLLSYQAVEFMRQGLHPSKACVESLRRVKQAGAWSGALVALNRAGEYGAACVGFSDYYISIXXXXXXXXXXXXKINCFNP 1092
            +++NTWP  +   +A+  LQ  G+ +++V  GCT AE D ++ +VGYGGSP+E     L+AM+M+GD+M VGAVA MP++K A +VA  VL  TRHTLLVG  AA+FA  +G+   NLST  S  +W QWK   CQPNFR      PNP Q+CGPY+     +    N R    ++E +HDTIG+IA+N+ G MAVG STNGA F++PGR+GD+ IPG+GGY DS +G A GTGDGD++MRFLLS++AVE MR G HPS AC  SL+ V+Q G W G L+ALN  G+YGAACVGF  +   ++N  +      +K+ C  P
Sbjct:   39 VVINTWPLLEPARSAFQVLQRGGSPLEAVVAGCTVAEADPNVTSVGYGGSPDEIGNTTLNAMVMDGDSMNVGAVAEMPYIKQAAQVALGVLNSTRHTLLVGEAAAKFAESLGYHRTNLSTNESLTIWKQWKNTRCQPNFRIPYVWVPNPNQSCGPYRYKNGSRNTPQNSRTELGIDEENHDTIGVIALNQRGRMAVGLSTNGARFRIPGRIGDSPIPGAGGYADSKVGAAAGTGDGDVMMRFLLSFKAVELMRAGKHPSDACTISLKTVRQKGLWYGGLIALNADGQYGAACVGFKKFAFVVQNSGSAKNGKVIKVKCLTP 359          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Cavefish
Match: aga (aspartylglucosaminidase [Source:NCBI gene;Acc:103034994])

HSP 1 Score: 289.656 bits (740), Expect = 4.144e-90
Identity = 153/320 (47.81%), Postives = 209/320 (65.31%), Query Frame = 1
Query:   76 IVDIGVLLFFGIIGMSSSFQDIIVNTWPFTKATDAAWCELQMSGNVMKSVERGCTEAEYDLSIPTVGYGGSPNEKNVVALDAMIMNGDTMEVGAVASMPHVKNAIKVAHYVLKHTRHTLLVGNDAAEFAREMGFTWENLSTENSTELWNQWKLKNCQPNFRRNVSPNPKQNCGPYKPISKKLLDDNYRVPGTVNEHHHDTIGMIAMNKSGSMAVGTSTNGAIFKVPGRVGDTAIPGSGGYVDSTIGGAVGTGDGDILMRFLLSYQAVEFMRQGLHPSKACVESLRRVKQA-GAWSGALVALNRAGEYGAAC---VGFSDY 1023
            ++  G+ L F  + +S +   +++NTW F  AT AAW  LQ   + + + + GCT  E +    +VG+GGSP+E+    LDAMIMNGDTMEVGAVA++  VKNA+ VA  V+ +T HT LVG  A+ FA +MGF  E+L+T  S ++++QW  + CQPN+R+NV P+P  +CGPY P   KL     R PG ++   HDTIGMI + ++G +A  TSTNGA  KVPGRVGD+ + G+G Y DS+ GGA  TG GDI+MRFL SY AVE MR G  PS AC  ++ R+K+    + GAL+  N  G YGAAC    GF+++
Sbjct:    2 MIQTGIFLLFVFLPVSPASLPLVINTWHFENATAAAWSALQAGSSPLDAAQAGCTRCEQEQCDGSVGFGGSPDERGETTLDAMIMNGDTMEVGAVANLRRVKNAVGVARAVMDYTDHTFLVGESASVFAEDMGFKSEDLTTNRSRDIFSQWLSQKCQPNYRKNVFPDPSMSCGPYTP-KAKLHSGPRRKPGLIDLRSHDTIGMIVIGQNGQVAAATSTNGATNKVPGRVGDSPVAGAGAYADSSAGGAAATGSGDIMMRFLPSYLAVEMMRAGASPSAACKTAITRIKERYPDFFGALICANTTGGYGAACNKRPGFTEF 320          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Cavefish
Match: hist2h2l (histone 2, H2, like [Source:NCBI gene;Acc:386920])

HSP 1 Score: 166.392 bits (420), Expect = 2.868e-47
Identity = 78/87 (89.66%), Postives = 82/87 (94.25%), Query Frame = -1
Query: 1195 IYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 1455
            IY+YKVL+QVHPDTGIS KAM IMNSFVND+FERIA EASRLAHYNK+STITSREIQT VRLLLPGELAKHAVSEGTKAVTKYT SK
Sbjct:   40 IYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 126          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Cavefish
Match: ENSAMXT00000025763.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000081.1:1681215:1683989:-1 gene:ENSAMXG00000033961.1 transcript:ENSAMXT00000025763.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 164.466 bits (415), Expect = 3.360e-47
Identity = 77/87 (88.51%), Postives = 82/87 (94.25%), Query Frame = -1
Query: 1195 IYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 1455
            IY+YKVL+QVHPDTGIS KAM IMNSFVND+FERIA E+SRLAHYNK+STITSREIQT VRLLLPGELAKHAVSEGTKAVTKYT SK
Sbjct:   31 IYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGESSRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 117          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Cavefish
Match: ENSAMXT00000018389.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002305.1:122420:122920:1 gene:ENSAMXG00000040093.1 transcript:ENSAMXT00000018389.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 164.081 bits (414), Expect = 5.535e-47
Identity = 77/87 (88.51%), Postives = 82/87 (94.25%), Query Frame = -1
Query: 1195 IYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 1455
            IY+YKVL+QVHPDTGIS KAM IMNSFVND+FERIA E+SRLAHYNK+STITSREIQT VRLLLPGELAKHAVSEGTKAVTKYT SK
Sbjct:   30 IYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGESSRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 116          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Cavefish
Match: ENSAMXT00000026773.2 (pep primary_assembly:Astyanax_mexicanus-2.0:21:10103882:10104382:1 gene:ENSAMXG00000043772.1 transcript:ENSAMXT00000026773.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 164.081 bits (414), Expect = 5.535e-47
Identity = 77/87 (88.51%), Postives = 82/87 (94.25%), Query Frame = -1
Query: 1195 IYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 1455
            IY+YKVL+QVHPDTGIS KAM IMNSFVND+FERIA E+SRLAHYNK+STITSREIQT VRLLLPGELAKHAVSEGTKAVTKYT SK
Sbjct:   30 IYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGESSRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 116          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Sea Lamprey
Match: aga (aspartylglucosaminidase [Source:ZFIN;Acc:ZDB-GENE-040426-2311])

HSP 1 Score: 175.252 bits (443), Expect = 1.305e-50
Identity = 78/166 (46.99%), Postives = 119/166 (71.69%), Query Frame = 1
Query:  511 ELWNQWKLKNCQPNFRRNVSPNPKQNCGPYKPISKKLLDDNYRVPGTVNEHHHDTIGMIAMNKSGSMAVGTSTNGAIFKVPGRVGDTAIPGSGGYVDSTIGGAVGTGDGDILMRFLLSYQAVEFMRQGLHPSKACVESLRRVKQ-AGAWSGALVALNRAGEYGAAC 1005
            EL+ +W+  +C PN+R+NV+P+P ++CGPYKPI+       +  P  +   +HDTIG++ ++  G ++ GTSTNGA  K+PGRVGD+ +PG+G Y   ++GGA  TGDGD++MRFL SYQAVE MR+G+ P+ AC +++RR+K+   ++ GA++  N  G +GAAC
Sbjct:    2 ELYEKWRRNSCHPNYRKNVTPDPDKSCGPYKPIASST--QTWSSP--IGIDNHDTIGVVVIDSQGRVSAGTSTNGATHKIPGRVGDSPVPGAGAYAAGSVGGASATGDGDVMMRFLPSYQAVESMRRGMDPTLACEDAIRRIKKFFPSFFGAIICANITGGFGAAC 163          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011164.1 (pep scaffold:Pmarinus_7.0:GL476820:1014653:1015054:1 gene:ENSPMAG00000010137.1 transcript:ENSPMAT00000011164.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 169.859 bits (429), Expect = 1.565e-49
Identity = 80/87 (91.95%), Postives = 84/87 (96.55%), Query Frame = -1
Query: 1195 IYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 1455
            IYIYKV++QVHPDTGIS KAMSIMNSFVND+FERIASEASRLAHYNK+STITSREIQT VRLLLPGELAKHAVSEGTKAVTKYT SK
Sbjct:   47 IYIYKVMKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 133          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011062.1 (pep scaffold:Pmarinus_7.0:GL476925:226546:226947:1 gene:ENSPMAG00000010034.1 transcript:ENSPMAT00000011062.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 169.859 bits (429), Expect = 1.565e-49
Identity = 80/87 (91.95%), Postives = 84/87 (96.55%), Query Frame = -1
Query: 1195 IYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 1455
            IYIYKV++QVHPDTGIS KAMSIMNSFVND+FERIASEASRLAHYNK+STITSREIQT VRLLLPGELAKHAVSEGTKAVTKYT SK
Sbjct:   47 IYIYKVMKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 133          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011057.1 (pep scaffold:Pmarinus_7.0:GL476925:216848:217249:1 gene:ENSPMAG00000010030.1 transcript:ENSPMAT00000011057.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 169.859 bits (429), Expect = 1.565e-49
Identity = 80/87 (91.95%), Postives = 84/87 (96.55%), Query Frame = -1
Query: 1195 IYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 1455
            IYIYKV++QVHPDTGIS KAMSIMNSFVND+FERIASEASRLAHYNK+STITSREIQT VRLLLPGELAKHAVSEGTKAVTKYT SK
Sbjct:   47 IYIYKVMKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 133          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011052.1 (pep scaffold:Pmarinus_7.0:GL476925:200969:201370:1 gene:ENSPMAG00000010022.1 transcript:ENSPMAT00000011052.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 169.859 bits (429), Expect = 1.565e-49
Identity = 80/87 (91.95%), Postives = 84/87 (96.55%), Query Frame = -1
Query: 1195 IYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 1455
            IYIYKV++QVHPDTGIS KAMSIMNSFVND+FERIASEASRLAHYNK+STITSREIQT VRLLLPGELAKHAVSEGTKAVTKYT SK
Sbjct:   47 IYIYKVMKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 133          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Yeast
Match: HTB1 (Histone H2B; core histone protein required for chromatin assembly and chromosome function; nearly identical to HTB2; Rad6p-Bre1p-Lge1p mediated ubiquitination regulates reassembly after DNA replication, transcriptional activation, meiotic DSB formation and H3 methylation [Source:SGD;Acc:S000002632])

HSP 1 Score: 153.295 bits (386), Expect = 5.826e-44
Identity = 69/85 (81.18%), Postives = 80/85 (94.12%), Query Frame = -1
Query: 1198 YIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGS 1452
            YIYKVL+Q HPDTGIS K+MSI+NSFVND+FERIA+EAS+LA YNKKSTI++REIQT VRL+LPGELAKHAVSEGT+AVTKY+ S
Sbjct:   44 YIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSS 128          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Yeast
Match: HTB2 (Histone H2B; core histone protein required for chromatin assembly and chromosome function; nearly identical to HTB1; Rad6p-Bre1p-Lge1p mediated ubiquitination regulates reassembly after DNA replication, transcriptional activation, meiotic DSB formation and H3 methylation [Source:SGD;Acc:S000000098])

HSP 1 Score: 153.295 bits (386), Expect = 6.614e-44
Identity = 69/85 (81.18%), Postives = 80/85 (94.12%), Query Frame = -1
Query: 1198 YIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGS 1452
            YIYKVL+Q HPDTGIS K+MSI+NSFVND+FERIA+EAS+LA YNKKSTI++REIQT VRL+LPGELAKHAVSEGT+AVTKY+ S
Sbjct:   44 YIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSS 128          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Nematostella
Match: EDO49709 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFF9])

HSP 1 Score: 300.827 bits (769), Expect = 5.060e-95
Identity = 159/311 (51.13%), Postives = 206/311 (66.24%), Query Frame = 1
Query:   94 LLFFGIIGMS-SSFQ------DIIVNTW--PFTKATDAAWCELQMSGNVMKSVERGCTEAEYDLSIPTVGYGGSPNEKNVVALDAMIMNGDTMEVGAVASMPHVKNAIKVAHYVLKHTRHTLLVGNDAAEFAREMGFTWENLSTENSTELWNQWKLKNCQPNFRRNVSPNPKQNCGPYKPISKKLLDDNYRVPGTVNEHHHDTIGMIAMNKSGSMAVGTSTNGAIFKVPGRVGDTAIPGSGGYVDSTIGGAVGTGDGDILMRFLLSYQAVEFMRQGLHPSKACVESLRR-VKQAGAWSGALVALNRAGEYG 996
            LLF   I ++   FQ       I++NTW  PFT AT  AW  +    + + +VE GC+  E +    TVGYGGSPNE     LDAMIM+G T +VGAV  +  VKNAI VA  V++H++ T LVG DA  FA +MGF  ENL+T+ S ++W +WK   CQPN+R+NV PNP  +CGPYKP S K      +V   V+ ++HDTIGM+ ++ +G+MA GTSTNGA  KVPGRVGD+ I GSG YVD+ +GGA  TGDGD++MRFL S  AVE+MRQG  P++A   +L R VK    +SG LVA+N+ GEYG
Sbjct:    3 LLFVAFIALAIHLFQCKEASLPIVINTWGPPFTNATAQAWKVISSGSSALDAVEVGCSVCEVEQCDGTVGYGGSPNEDGETTLDAMIMDGITHDVGAVGCLKRVKNAIGVARSVMEHSKETFLVGEDATRFAIQMGFKEENLTTKASMDMWKKWKSNKCQPNYRQNVVPNPSTSCGPYKPKSDKRYTS--KVNKEVDRNNHDTIGMVVVDANGNMAGGTSTNGASHKVPGRVGDSPIAGSGAYVDNEVGGAAATGDGDVMMRFLPSLVAVEYMRQGKPPTQAAQMALGRIVKYYPDFSGGLVAVNKQGEYG 311          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Nematostella
Match: EDO49710 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFG0])

HSP 1 Score: 256.914 bits (655), Expect = 1.520e-78
Identity = 131/314 (41.72%), Postives = 191/314 (60.83%), Query Frame = 1
Query:   76 IVDIGVLLFFGIIGMSSSFQDIIVNTWPFTKATDAAWCELQMSGNVMKSVERGCTEAEYDLSI-----PTVGYGGSPNEKNVVALDAMIMNGDTMEVGAVASMPHVKNAIKVAHYVLKHTRHTLLVGNDAAEFAREMGFTWENLSTENSTELWNQWKLKNCQPNFRRNVSPNPKQNCGPYKPISKKLLDDNYRVPGTVNEHHHDTIGMIAMNKSGSMAVGTSTNGAIFKVPGRVGDTAIPGSGGYVDSTIGGAVGTGDGDILMRFLLSYQAVEFMRQGLHPSKACVESLRRVKQ--AGAWSGALVALNRAGEYG 996
            ++ + VL  +    + +S   +++NTW FT A+D  +  L   G+ +  +  G T  E          P VG+GG PNE     LDA+IMNG   + GAV  +  VKNAI VA  V+ +T+H+LL+G+DA  FA+E GF  E+L+T NS ++W  WK   CQPNF +N+  +P+  C PY        D   R    V E +HDTIGM+A++ +G++A G STNG  FK+PGRVGD+ I G+G Y D+ +G A  TG+GDI+ ++L +YQ VEFMRQG  P KA   +L R+ +     ++G+++A+N+ GEYG
Sbjct:    9 VLFLAVLNIYLHQSLGASKLPVVLNTWSFTLASDTGFETLMKGGSAVDGIVSGITACELKPCANNPLNPNVGFGGKPNEVGETTLDALIMNGVGHQSGAVGCLRRVKNAIGVARAVMNYTKHSLLIGDDATNFAKEFGFPEESLTTNNSRKVWEDWKSNKCQPNFWKNLPGDPQSGCRPY-----SFPDTQSRKRREVAEDNHDTIGMVAVDANGNVAAGCSTNGLGFKIPGRVGDSPIAGAGAYADNDVGAAAATGNGDIMAKYLPTYQTVEFMRQGFSPEKAAEMALMRIHKIYKDGFTGSVIAVNKKGEYG 317          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Nematostella
Match: EDO48412 (Histone H2B [Source:UniProtKB/TrEMBL;Acc:A7RJP4])

HSP 1 Score: 166.777 bits (421), Expect = 2.201e-48
Identity = 80/87 (91.95%), Postives = 82/87 (94.25%), Query Frame = -1
Query: 1195 IYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 1455
            IYIYKVL+QVHPDTGIS KAM IMNSFVND+FERIA EASRLAHYNKKSTITSREIQT VRLLLPGELAKHAVSEGTKAVTKYT SK
Sbjct:   37 IYIYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKKSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Nematostella
Match: EDO48413 (Histone H2B [Source:UniProtKB/TrEMBL;Acc:A7RJP4])

HSP 1 Score: 166.777 bits (421), Expect = 2.201e-48
Identity = 80/87 (91.95%), Postives = 82/87 (94.25%), Query Frame = -1
Query: 1195 IYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 1455
            IYIYKVL+QVHPDTGIS KAM IMNSFVND+FERIA EASRLAHYNKKSTITSREIQT VRLLLPGELAKHAVSEGTKAVTKYT SK
Sbjct:   37 IYIYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKKSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Nematostella
Match: EDO48398 (Histone H2B [Source:UniProtKB/TrEMBL;Acc:A7RJL3])

HSP 1 Score: 166.392 bits (420), Expect = 2.899e-48
Identity = 80/87 (91.95%), Postives = 82/87 (94.25%), Query Frame = -1
Query: 1195 IYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 1455
            IYIYKVL+QVHPDTGIS KAM IMNSFVND+FERIA EASRLAHYNKKSTITSREIQT VRLLLPGELAKHAVSEGTKAVTKYT SK
Sbjct:   37 IYIYKVLKQVHPDTGISSKAMVIMNSFVNDIFERIAGEASRLAHYNKKSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Medaka
Match: aga (aspartylglucosaminidase [Source:NCBI gene;Acc:101169182])

HSP 1 Score: 285.804 bits (730), Expect = 1.506e-88
Identity = 152/290 (52.41%), Postives = 199/290 (68.62%), Query Frame = 1
Query:  139 IIVNTWPFTKATDAAWCELQMSGNVMKSVERGCTEAEYDLSIPTVGYGGSPNEKNVVALDAMIMNGDTMEVGAVASMPHVKNAIKVAHYVLKHTRHTLLVGNDAAEFAREMGFTWENLSTENSTELWNQWKLKNCQPNFRRNVSPNPKQNCGPYKPISKKLLDDNYRVPGTVNEHHHDTIGMIAMNKSGSMAVGTSTNGAIFKVPGRVGDTAIPGSGGYVDSTIGGAVGTGDGDILMRFLLSYQAVEFMRQGLHPSKACVESLRRVKQA-GAWSGALVALNRAGEYGAAC 1005
            ++VNTWPF  A  AAW  LQ  G+V+ +VE+GC   E +    +VG+GGSP+E     LDAMIMNG+TMEVGAVA +  +KNAI VA  V++HT HTLLVG  A+ FA  MGF  E+LST  S  +++QW   NCQPN+R+NVSP+P ++CGPY+P   + L    R+   VN   HDTIG++A+++ G +A GTSTNG   KVPGRVGD+ I G+G Y DS+ G A  TGDGD++MRFL SY AVE MR G  PS+AC  ++ R+K+    + GA++  N  G YGAAC
Sbjct:   31 LVVNTWPFKSAAAAAWSCLQSGGSVLDAVEQGCARCEAEQCDGSVGFGGSPDENGETTLDAMIMNGNTMEVGAVADLKRIKNAIGVARAVMEHTEHTLLVGESASVFAENMGFVAEDLSTNTSVSIFSQWLRGNCQPNYRKNVSPDPLKSCGPYRPEGARTLGKRARL---VNALSHDTIGIVALDQDGHVAAGTSTNGLTHKVPGRVGDSPIVGAGAYADSSAGAAAATGDGDLMMRFLPSYLAVELMRTGTDPSEACKTAISRIKRHYPDFFGAVICANTTGHYGAAC 317          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Medaka
Match: aga (aspartylglucosaminidase [Source:NCBI gene;Acc:101169182])

HSP 1 Score: 250.366 bits (638), Expect = 2.194e-75
Identity = 142/290 (48.97%), Postives = 184/290 (63.45%), Query Frame = 1
Query:  139 IIVNTWPFTKATDAAWCELQMSGNVMKSVERGCTEAEYDLSIPTVGYGGSPNEKNVVALDAMIMNGDTMEVGAVASMPHVKNAIKVAHYVLKHTRHTLLVGNDAAEFAREMGFTWENLSTENSTELWNQWKLKNCQPNFRRNVSPNPKQNCGPYKPISKKLLDDNYRVPGTVNEHHHDTIGMIAMNKSGSMAVGTSTNGAIFKVPGRVGDTAIPGSGGYVDSTIGGAVGTGDGDILMRFLLSYQAVEFMRQGLHPSKACVESLRRVKQA-GAWSGALVALNRAGEYGAAC 1005
            ++VNTWPF  A  AAW  LQ  G+V+ +VE+GC   E +    +VG+GGSP+E     LDAMIMNG+TMEVGAVA +  +KNAI VA  V++HT HTLLVG  A+ FA  MGF  E+LST  S  +++QW   NCQPN+R+NVSP+P ++CGPY+P   + L    R+   VN   HDTIG  A+  S S                RVGD+ I G+G Y DS+ G A  TGDGD++MRFL SY AVE MR G  PS+AC  ++ R+K+    + GA++  N  G YGAAC
Sbjct:   31 LVVNTWPFKSAAAAAWSCLQSGGSVLDAVEQGCARCEAEQCDGSVGFGGSPDENGETTLDAMIMNGNTMEVGAVADLKRIKNAIGVARAVMEHTEHTLLVGESASVFAENMGFVAEDLSTNTSVSIFSQWLRGNCQPNYRKNVSPDPLKSCGPYRPEGARTLGKRARL---VNALSHDTIGESAIQGSQSAL-------------KRVGDSPIVGAGAYADSSAGAAAATGDGDLMMRFLPSYLAVELMRTGTDPSEACKTAISRIKRHYPDFFGAVICANTTGHYGAAC 304          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Medaka
Match: ENSORLT00000036814.1 (histone H2B 1/2 [Source:NCBI gene;Acc:101159064])

HSP 1 Score: 170.244 bits (430), Expect = 4.498e-49
Identity = 80/87 (91.95%), Postives = 84/87 (96.55%), Query Frame = -1
Query: 1195 IYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 1455
            IY+YKVL+QVHPDTGIS KAMSIMNSFVND+FERIASEASRLAHYNK+STITSREIQT VRLLLPGELAKHAVSEGTKAVTKYT SK
Sbjct:   38 IYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 124          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Medaka
Match: ENSORLT00000034562.1 (histone H2B 1/2 [Source:NCBI gene;Acc:101167975])

HSP 1 Score: 170.244 bits (430), Expect = 4.498e-49
Identity = 80/87 (91.95%), Postives = 84/87 (96.55%), Query Frame = -1
Query: 1195 IYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 1455
            IY+YKVL+QVHPDTGIS KAMSIMNSFVND+FERIASEASRLAHYNK+STITSREIQT VRLLLPGELAKHAVSEGTKAVTKYT SK
Sbjct:   38 IYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 124          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Medaka
Match: ENSORLT00000044844.1 (histone H2B 1/2 [Source:NCBI gene;Acc:111947380])

HSP 1 Score: 170.244 bits (430), Expect = 4.498e-49
Identity = 80/87 (91.95%), Postives = 84/87 (96.55%), Query Frame = -1
Query: 1195 IYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 1455
            IY+YKVL+QVHPDTGIS KAMSIMNSFVND+FERIASEASRLAHYNK+STITSREIQT VRLLLPGELAKHAVSEGTKAVTKYT SK
Sbjct:   38 IYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 124          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Planmine SMEST
Match: SMESG000003786.1 (SMESG000003786.1)

HSP 1 Score: 712.99 bits (1839), Expect = 0.000e+0
Identity = 353/353 (100.00%), Postives = 353/353 (100.00%), Query Frame = 1
Query:   58 MCKFFRIVDIGVLLFFGIIGMSSSFQDIIVNTWPFTKATDAAWCELQMSGNVMKSVERGCTEAEYDLSIPTVGYGGSPNEKNVVALDAMIMNGDTMEVGAVASMPHVKNAIKVAHYVLKHTRHTLLVGNDAAEFAREMGFTWENLSTENSTELWNQWKLKNCQPNFRRNVSPNPKQNCGPYKPISKKLLDDNYRVPGTVNEHHHDTIGMIAMNKSGSMAVGTSTNGAIFKVPGRVGDTAIPGSGGYVDSTIGGAVGTGDGDILMRFLLSYQAVEFMRQGLHPSKACVESLRRVKQAGAWSGALVALNRAGEYGAACVGFSDYYISIXXXXXXXXXXXXKINCFNPCTSTKEFG 1116
            MCKFFRIVDIGVLLFFGIIGMSSSFQDIIVNTWPFTKATDAAWCELQMSGNVMKSVERGCTEAEYDLSIPTVGYGGSPNEKNVVALDAMIMNGDTMEVGAVASMPHVKNAIKVAHYVLKHTRHTLLVGNDAAEFAREMGFTWENLSTENSTELWNQWKLKNCQPNFRRNVSPNPKQNCGPYKPISKKLLDDNYRVPGTVNEHHHDTIGMIAMNKSGSMAVGTSTNGAIFKVPGRVGDTAIPGSGGYVDSTIGGAVGTGDGDILMRFLLSYQAVEFMRQGLHPSKACVESLRRVKQAGAWSGALVALNRAGEYGAACVGFSDYYISIRNVETRNTTVTVKINCFNPCTSTKEFG
Sbjct:    1 MCKFFRIVDIGVLLFFGIIGMSSSFQDIIVNTWPFTKATDAAWCELQMSGNVMKSVERGCTEAEYDLSIPTVGYGGSPNEKNVVALDAMIMNGDTMEVGAVASMPHVKNAIKVAHYVLKHTRHTLLVGNDAAEFAREMGFTWENLSTENSTELWNQWKLKNCQPNFRRNVSPNPKQNCGPYKPISKKLLDDNYRVPGTVNEHHHDTIGMIAMNKSGSMAVGTSTNGAIFKVPGRVGDTAIPGSGGYVDSTIGGAVGTGDGDILMRFLLSYQAVEFMRQGLHPSKACVESLRRVKQAGAWSGALVALNRAGEYGAACVGFSDYYISIRNVETRNTTVTVKINCFNPCTSTKEFG 353          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Planmine SMEST
Match: SMESG000003788.1 (SMESG000003788.1)

HSP 1 Score: 246.899 bits (629), Expect = 1.042e-73
Identity = 119/122 (97.54%), Postives = 119/122 (97.54%), Query Frame = -1
Query: 2005 LPFQIKEIRNRCQCQTKFLIEKTILQEGMYKIGNKNIFVRMFRGNIMLRVGGGWETLNEYLNKVDPCCKSDNKSTNANPRRKSMAATTFVTDLTTDGIISKNLRKLSQCELTTIRKKSNDSP 2370
            L   IKEIRNRCQCQTKFLIEKTILQEGMYKIGNKNIFVRMFRGNIMLRVGGGWETLNEYLNKVDPCCKSDNKSTNANPRRKSMAATTFVTDLTTDGIISKNLRKLSQCELTTIRKKSNDSP
Sbjct:  261 LDILIKEIRNRCQCQTKFLIEKTILQEGMYKIGNKNIFVRMFRGNIMLRVGGGWETLNEYLNKVDPCCKSDNKSTNANPRRKSMAATTFVTDLTTDGIISKNLRKLSQCELTTIRKKSNDSP 382          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Planmine SMEST
Match: SMESG000003788.1 (SMESG000003788.1)

HSP 1 Score: 248.054 bits (632), Expect = 4.394e-73
Identity = 118/120 (98.33%), Postives = 119/120 (99.17%), Query Frame = -1
Query: 2005 FQIKEIRNRCQCQTKFLIEKTILQEGMYKIGNKNIFVRMFRGNIMLRVGGGWETLNEYLNKVDPCCKSDNKSTNANPRRKSMAATTFVTDLTTDGIISKNLRKLSQCELTTIRKKSNDSP 2364
             +IKEIRNRCQCQTKFLIEKTILQEGMYKIGNKNIFVRMFRGNIMLRVGGGWETLNEYLNKVDPCCKSDNKSTNANPRRKSMAATTFVTDLTTDGIISKNLRKLSQCELTTIRKKSNDSP
Sbjct:  350 LKIKEIRNRCQCQTKFLIEKTILQEGMYKIGNKNIFVRMFRGNIMLRVGGGWETLNEYLNKVDPCCKSDNKSTNANPRRKSMAATTFVTDLTTDGIISKNLRKLSQCELTTIRKKSNDSP 469          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Planmine SMEST
Match: SMESG000003787.1 (SMESG000003787.1)

HSP 1 Score: 182.956 bits (463), Expect = 7.583e-54
Identity = 121/121 (100.00%), Postives = 121/121 (100.00%), Query Frame = -1
Query: 1195 MAPKVSGXXXXXXXXXXXXXXXXXXXXXXXXXXAIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 1557
            MAPKVSGKAAKKATKAKVQKPDKKKHKKRKESYAIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK
Sbjct:    1 MAPKVSGKAAKKATKAKVQKPDKKKHKKRKESYAIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 121          
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Planmine SMEST
Match: SMESG000077385.1 (SMESG000077385.1)

HSP 1 Score: 181.8 bits (460), Expect = 2.288e-53
Identity = 118/121 (97.52%), Postives = 119/121 (98.35%), Query Frame = -1
Query: 1195 MAPKVSGXXXXXXXXXXXXXXXXXXXXXXXXXXAIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPGELAKHAVSEGTKAVTKYTGSK 1557
            MAPKVSGKAAKKATKAKVQK DKKKH+KRKESYAIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQT VRLLLPGELAKHAVSEGTKAVTKYTGSK
Sbjct:    1 MAPKVSGKAAKKATKAKVQKVDKKKHRKRKESYAIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTSVRLLLPGELAKHAVSEGTKAVTKYTGSK 121          
The following BLAST results are available for this feature:
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AGA4.824e-8650.33aspartylglucosaminidase [Source:HGNC Symbol;Acc:HG... [more]
H2BC136.485e-4889.66H2B clustered histone 13 [Source:HGNC Symbol;Acc:H... [more]
H2BU17.974e-4889.66H2B.U histone 1 [Source:HGNC Symbol;Acc:HGNC:20514... [more]
H2BU17.974e-4889.66H2B.U histone 1 [Source:HGNC Symbol;Acc:HGNC:20514... [more]
H2BC212.377e-4789.66H2B clustered histone 21 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
R04B3.22.124e-7142.48Putative N(4)-(beta-N-acetylglucosaminyl)-L-aspara... [more]
his-417.323e-4888.51Probable histone H2B 3 [Source:UniProtKB/Swiss-Pr... [more]
his-668.322e-4888.51Probable histone H2B 4 [Source:UniProtKB/Swiss-Pr... [more]
his-628.322e-4888.51Probable histone H2B 4 [Source:UniProtKB/Swiss-Pr... [more]
his-588.322e-4888.51Probable histone H2B 4 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG18278.185e-9249.50gene:FBgn0033431 transcript:FBtr0339392[more]
CG104742.372e-7845.30gene:FBgn0034427 transcript:FBtr0086561[more]
CG43722.024e-7037.58gene:FBgn0034665 transcript:FBtr0071738[more]
His2B:CG338886.971e-4991.95gene:FBgn0053888 transcript:FBtr0091892[more]
His2B:CG339046.971e-4991.95gene:FBgn0053904 transcript:FBtr0091908[more]
back to top
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aga2.219e-10051.17aspartylglucosaminidase [Source:ZFIN;Acc:ZDB-GENE-... [more]
aga2.483e-9950.50aspartylglucosaminidase [Source:ZFIN;Acc:ZDB-GENE-... [more]
si:ch211-190p8.26.439e-4889.66si:ch211-190p8.2 [Source:ZFIN;Acc:ZDB-GENE-070424-... [more]
zgc:1949891.520e-4789.66zgc:194989 [Source:ZFIN;Acc:ZDB-GENE-080723-3][more]
hist2h2l1.770e-4789.66histone 2, H2, like [Source:NCBI gene;Acc:386920][more]
back to top
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lurap1l1.813e-10149.83leucine rich adaptor protein 1-like [Source:Xenbas... [more]
lurap1l4.784e-9850.34leucine rich adaptor protein 1-like [Source:Xenbas... [more]
abcb11.24.733e-4890.80ATP binding cassette subfamily B member 11, gene 2... [more]
ENSXETT00000016353.14.733e-4890.80histone H2B 1.1-like [Source:NCBI gene;Acc:1004851... [more]
phc24.733e-4890.80polyhomeotic homolog 2 [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Aga3.765e-8351.86aspartylglucosaminidase [Source:MGI Symbol;Acc:MGI... [more]
Aga1.288e-7449.49aspartylglucosaminidase [Source:MGI Symbol;Acc:MGI... [more]
H2bc12.447e-4891.95H2B clustered histone 1 [Source:MGI Symbol;Acc:MGI... [more]
H2bc114.196e-4889.66H2B clustered histone 11 [Source:MGI Symbol;Acc:MG... [more]
Hist1h2br4.196e-4889.66histone cluster 1 H2br [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B4NWI1|ASPG1_DROYA7.938e-9249.19Putative N(4)-(beta-N-acetylglucosaminyl)-L-aspara... [more]
sp|O02467|ASPG_SPOFR2.931e-9147.81N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase (F... [more]
sp|Q8MR45|ASPG1_DROME8.205e-9149.50Putative N(4)-(beta-N-acetylglucosaminyl)-L-aspara... [more]
sp|B4HT15|ASPG1_DROSE3.163e-9049.17Putative N(4)-(beta-N-acetylglucosaminyl)-L-aspara... [more]
sp|B3N6Y7|ASPG1_DROER9.269e-9049.17Putative N(4)-(beta-N-acetylglucosaminyl)-L-aspara... [more]
back to top
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2M5118.483e-11756.33Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A183A9701.512e-11455.23Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A4E0RSN46.161e-11153.85Beta N acetylglucosaminyl L asparaginase OS=Fascio... [more]
A0A504YS823.452e-10650.57N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase OS... [more]
A0A564YTB33.565e-10450.78Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aga4.144e-9047.81aspartylglucosaminidase [Source:NCBI gene;Acc:1030... [more]
hist2h2l2.868e-4789.66histone 2, H2, like [Source:NCBI gene;Acc:386920][more]
ENSAMXT00000025763.23.360e-4788.51pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000018389.25.535e-4788.51pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000026773.25.535e-4788.51pep primary_assembly:Astyanax_mexicanus-2.0:21:101... [more]
back to top
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aga1.305e-5046.99aspartylglucosaminidase [Source:ZFIN;Acc:ZDB-GENE-... [more]
ENSPMAT00000011164.11.565e-4991.95pep scaffold:Pmarinus_7.0:GL476820:1014653:1015054... [more]
ENSPMAT00000011062.11.565e-4991.95pep scaffold:Pmarinus_7.0:GL476925:226546:226947:1... [more]
ENSPMAT00000011057.11.565e-4991.95pep scaffold:Pmarinus_7.0:GL476925:216848:217249:1... [more]
ENSPMAT00000011052.11.565e-4991.95pep scaffold:Pmarinus_7.0:GL476925:200969:201370:1... [more]
back to top
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
HTB15.826e-4481.18Histone H2B; core histone protein required for chr... [more]
HTB26.614e-4481.18Histone H2B; core histone protein required for chr... [more]
back to top
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO497095.060e-9551.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO497101.520e-7841.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484122.201e-4891.95Histone H2B [Source:UniProtKB/TrEMBL;Acc:A7RJP4][more]
EDO484132.201e-4891.95Histone H2B [Source:UniProtKB/TrEMBL;Acc:A7RJP4][more]
EDO483982.899e-4891.95Histone H2B [Source:UniProtKB/TrEMBL;Acc:A7RJL3][more]
back to top
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aga1.506e-8852.41aspartylglucosaminidase [Source:NCBI gene;Acc:1011... [more]
aga2.194e-7548.97aspartylglucosaminidase [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000036814.14.498e-4991.95histone H2B 1/2 [Source:NCBI gene;Acc:101159064][more]
ENSORLT00000034562.14.498e-4991.95histone H2B 1/2 [Source:NCBI gene;Acc:101167975][more]
ENSORLT00000044844.14.498e-4991.95histone H2B 1/2 [Source:NCBI gene;Acc:111947380][more]
back to top
BLAST of N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003786.10.000e+0100.00SMESG000003786.1[more]
SMESG000003788.11.042e-7397.54SMESG000003788.1[more]
SMESG000003788.14.394e-7398.33SMESG000003788.1[more]
SMESG000003787.17.583e-54100.00SMESG000003787.1[more]
SMESG000077385.12.288e-5397.52SMESG000077385.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022982 ID=SMED30022982|Name=N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase|organism=Schmidtea mediterranea sexual|type=transcript|length=2628bp
CCTACTAATAAATCGATTTTCACCTTTGACCTGGAAAATAATATTTCAAA
TATCAAGATGTGTAAGTTCTTCCGAATTGTTGATATTGGAGTATTATTAT
TTTTCGGAATCATTGGAATGAGTTCAAGCTTTCAAGATATTATTGTTAAT
ACATGGCCATTTACTAAGGCAACCGATGCTGCTTGGTGTGAATTACAAAT
GAGCGGAAATGTAATGAAATCCGTAGAACGTGGATGCACAGAAGCTGAGT
ACGATTTGAGCATTCCAACAGTAGGTTATGGAGGTTCGCCAAATGAAAAA
AACGTTGTAGCATTAGACGCGATGATAATGAACGGCGATACAATGGAGGT
TGGTGCTGTTGCAAGCATGCCTCACGTCAAAAACGCTATTAAAGTTGCAC
ATTATGTGCTTAAACATACTAGACACACTTTATTAGTAGGAAATGATGCA
GCTGAGTTTGCTAGAGAAATGGGGTTTACGTGGGAAAATTTATCCACCGA
AAATTCAACTGAATTATGGAACCAATGGAAATTAAAAAATTGTCAACCTA
ACTTCCGTCGCAATGTATCACCTAACCCTAAGCAAAATTGCGGGCCATAT
AAACCGATATCAAAAAAGCTCTTGGATGATAATTACAGAGTTCCAGGAAC
TGTTAATGAACATCATCATGATACCATTGGAATGATCGCTATGAATAAAT
CAGGAAGCATGGCCGTTGGGACATCGACAAATGGTGCAATTTTTAAAGTT
CCCGGAAGAGTTGGAGACACAGCAATTCCTGGTTCAGGTGGATATGTTGA
CTCTACGATCGGTGGAGCAGTTGGTACAGGTGATGGTGACATTCTTATGA
GATTTCTACTATCATATCAAGCTGTCGAATTTATGAGACAAGGGTTACAC
CCGAGTAAAGCTTGTGTTGAAAGCTTGAGACGAGTAAAACAGGCCGGTGC
CTGGTCTGGAGCACTGGTCGCTTTAAATCGAGCGGGAGAATATGGAGCAG
CATGCGTTGGCTTCTCCGACTACTATATAAGTATTCGCAATGTTGAAACT
CGAAACACTACTGTTACTGTTAAAATTAACTGTTTCAACCCTTGCACGTC
TACAAAAGAATTCGGATAAAGTTTTGTACATTTTACAACCAATAAATTGT
GGCCCTAAAGAGGACCTTTAACATTCTCAGCCCATTACTATTTACTTACT
GCCCGTATACTTAGTTACTGCTTTAGTACCCTCACTAACAGCGTGCTTGG
CTAATTCACCGGGTAAAAGAAGCCTCACGCCGGTTTGTATCTCCCTACTC
GTAATTGTAGATTTCTTGTTGTAATGTGCCAGCCGACTAGCTTCTGATGC
TATTCTTTCGAAAACATCATTCACAAAGCTATTCATAATTGACATGGCTT
TACCAGAAATTCCAGTATCAGGATGGACTTGTCTCAGAACCTTGTATATA
TAGATAGCATAGCTTTCCTTCCTTTTCTTATGCTTCTTCTTATCAGGCTT
TTGAACTTTAGCTTTCGTTGCTTTTTTTGCAGCTTTTCCACTCACTTTCG
GTGCCATTAGAAATAAAATTTTAGAAATGGGCAAAAGAGTATTTATATTG
TAAAATATTCCTGGTAAAATAAGCGATTACGTTGAAGTATTTTATTTTTA
TGTTACGTTGCAGTATTTTAATTTAATATTTTCTAATCAATAATTTCAAT
AACAGTAAAAGTTTATTAGGAATTATTATTAATGAAAGTGATATGTTGAA
AATAATACAATCCATTCTCTATCAAATAAATATGAAAGGTAATTAAAATA
TTATAATGTAACCAGCAATTGCACAGCCAAATCTTATGGAATATACTAGA
TCTGTAAATATTCTTTAGAGCTAAACGTAAATAATAATTCTGGATTATCA
CATTGAAAGCAGGATGTTACTATCACAGTGGAATGCTATGGTTAATGTTG
AAAAATAATTACATAGAATAAAAAGGGCGAGTTGATATTTGAAATCTGTA
GTCATGGCGAGTCGTTGGATTTCTTTCGTATTGTTGTTAGTTCACACTGA
CTCAATTTTCTTAGGTTTTTACTGATAATTCCATCAGTTGTTAAATCAGT
AACAAATGTTGTGGCTGCCATTGACTTCCGCCTTGGATTGGCATTAGTTG
ATTTATTGTCAGATTTGCAACATGGATCTACTTTGTTCAAGTATTCATTG
AGAGTTTCCCATCCTCCTCCAACTCGTAGCATTATGTTTCCACGGAACAT
ACGGACAAATATATTTTTATTACCTATTTTATACATGCCTTCTTGGAGAA
TTGTTTTTTCAATTAGAAATTTTGTCTGGCATTGACAGCGATTTCTGATT
TCCTTGATCTGAAACGGTAATATTTAAATCTATTTCTAATGGCGCCGAAC
AATATTATTAGTTTAGTGCAATCAACTCTTAAAAACTTTTTCTGATCGAA
ATTAACTCCAATGAAAAACAAGAATATGGATAAGTAAATGTCTTAAAGAA
TCAAGCAAACTTTTTTGTTATATTCACATGTTTTTCTATATTTGGACGTT
CCGAAAAATGTTAAAAGTGTCCTTTGTTATACTTTAGTTTTATGTTTCAT
GTTTCGTATCACAGCAGTTTATTTTTTT
back to top

protein sequence of SMED30022982-orf-1

>SMED30022982-orf-1 ID=SMED30022982-orf-1|Name=SMED30022982-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=373bp
PTNKSIFTFDLENNISNIKMCKFFRIVDIGVLLFFGIIGMSSSFQDIIVN
TWPFTKATDAAWCELQMSGNVMKSVERGCTEAEYDLSIPTVGYGGSPNEK
NVVALDAMIMNGDTMEVGAVASMPHVKNAIKVAHYVLKHTRHTLLVGNDA
AEFAREMGFTWENLSTENSTELWNQWKLKNCQPNFRRNVSPNPKQNCGPY
KPISKKLLDDNYRVPGTVNEHHHDTIGMIAMNKSGSMAVGTSTNGAIFKV
PGRVGDTAIPGSGGYVDSTIGGAVGTGDGDILMRFLLSYQAVEFMRQGLH
PSKACVESLRRVKQAGAWSGALVALNRAGEYGAACVGFSDYYISIRNVET
RNTTVTVKINCFNPCTSTKEFG*
back to top

protein sequence of SMED30022982-orf-2

>SMED30022982-orf-2 ID=SMED30022982-orf-2|Name=SMED30022982-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=122bp
MAPKVSGKAAKKATKAKVQKPDKKKHKKRKESYAIYIYKVLRQVHPDTGI
SGKAMSIMNSFVNDVFERIASEASRLAHYNKKSTITSREIQTGVRLLLPG
ELAKHAVSEGTKAVTKYTGSK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR009072Histone-fold
IPR007125Histone_H2A/H2B/H3
IPR003108GAR_dom
IPR000246Peptidase_T2
IPR029055Ntn_hydrolases_N
IPR000558Histone_H2B
Vocabulary: cellular component
TermDefinition
GO:0000786nucleosome
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0046982protein heterodimerization activity
GO:0008017microtubule binding
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.60.20.30coord: 223..360
e-value: 1.4E-41
score: 143.8
NoneNo IPR availablePANTHERPTHR10188:SF6N(4)-(BETA-N-ACETYLGLUCOSAMINYL)-L-ASPARAGINASEcoord: 43..355
NoneNo IPR availableCDDcd04513Glycosylasparaginasecoord: 45..335
e-value: 2.68709E-153
score: 431.6
NoneNo IPR availableTMHMMTMhelixcoord: 21..43
IPR000246Peptidase T2, asparaginase 2PFAMPF01112Asparaginase_2coord: 52..337
e-value: 2.2E-73
score: 247.0
IPR000246Peptidase T2, asparaginase 2PANTHERPTHR10188L-ASPARAGINASEcoord: 43..355
IPR029055Nucleophile aminohydrolases, N-terminalSUPERFAMILYSSF56235N-terminal nucleophile aminohydrolases (Ntn hydrolases)coord: 44..347