Homeobox protein DTH-2

Overview
NameHomeobox protein DTH-2
Smed IDSMED30022975
Length (bp)1740
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Homeobox protein DTH-2 (SMED30022975) t-SNE clustered cells

Violin plots show distribution of expression levels for Homeobox protein DTH-2 (SMED30022975) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Homeobox protein DTH-2 (SMED30022975) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Homeobox protein DTH-2 (SMED30022975) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022975

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30022975SMESG000037282.1 SMED30022975smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022975SMESG000037282.1 SMED30022975smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30022975SMESG000037282.1 SMED30022975smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30022975SMESG000037282.1 SMED30022975smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nu neoblastSMED30022975SMESG000037282.1 SMED30022975smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022975SMESG000037282.1 dd_Smed_v4_6729_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022975SMESG000037282.1 dd_Smed_v4_6729_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30022975SMESG000037282.1 dd_Smed_v4_6729_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022975SMESG000037282.1 dd_Smed_v4_6729_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30022975SMESG000037282.1 dd_Smed_v4_6729_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022975SMESG000037282.1 Contig49320newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022975SMESG000037282.1 Contig49320uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
secretory systemSMED30022975SMESG000037282.1 dd_Smed_v6_6729_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Homeobox protein DTH-2 vs. Ensembl Human
Match: NKX2-4 (NK2 homeobox 4 [Source:HGNC Symbol;Acc:HGNC:7837])

HSP 1 Score: 127.102 bits (318), Expect = 1.446e-31
Identity = 71/137 (51.82%), Postives = 81/137 (59.12%), Query Frame = 3
Query:  699 TNSWYGTSSLSNSNSDPRMA-MSRLMGTAAAAASGNMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
               WYG      +N DPR + +SR MG +A      M    GI          A    SLG                + RRKRR+LFSQAQ+YELERRFKQQKYLSAPEREHLA++I+LTPTQVKIWFQNHRYK KR
Sbjct:  133 ATGWYG------ANPDPRYSSISRFMGPSAGVNVAGMGSLTGI----------ADAAKSLGPL-------HAAAAAAAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKR 246          
BLAST of Homeobox protein DTH-2 vs. Ensembl Human
Match: NKX2-1 (NK2 homeobox 1 [Source:HGNC Symbol;Acc:HGNC:11825])

HSP 1 Score: 122.479 bits (306), Expect = 8.258e-30
Identity = 73/161 (45.34%), Postives = 91/161 (56.52%), Query Frame = 3
Query:  651 YCSS----VNDFNPYGDPRGTNS----WYGTSSLSNSNSDPRM-AMSRLMGTAAAAASGNMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            YC+     +++  PY D    ++    WYG      +N DPR  A+SR MG A+                   GM+ +               A +     + RRKRR+LFSQAQ+YELERRFKQQKYLSAPEREHLA++I+LTPTQVKIWFQNHRYK KR
Sbjct:   86 YCNGNLGNMSELPPYQDTMRNSASGPGWYG------ANPDPRFPAISRFMGPAS-------------------GMNMSGMGGLGSLGDVSKNMAPLPS---APRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKR 218          
BLAST of Homeobox protein DTH-2 vs. Ensembl Human
Match: NKX2-1 (NK2 homeobox 1 [Source:HGNC Symbol;Acc:HGNC:11825])

HSP 1 Score: 122.479 bits (306), Expect = 8.258e-30
Identity = 73/161 (45.34%), Postives = 91/161 (56.52%), Query Frame = 3
Query:  651 YCSS----VNDFNPYGDPRGTNS----WYGTSSLSNSNSDPRM-AMSRLMGTAAAAASGNMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            YC+     +++  PY D    ++    WYG      +N DPR  A+SR MG A+                   GM+ +               A +     + RRKRR+LFSQAQ+YELERRFKQQKYLSAPEREHLA++I+LTPTQVKIWFQNHRYK KR
Sbjct:   86 YCNGNLGNMSELPPYQDTMRNSASGPGWYG------ANPDPRFPAISRFMGPAS-------------------GMNMSGMGGLGSLGDVSKNMAPLPS---APRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKR 218          
BLAST of Homeobox protein DTH-2 vs. Ensembl Human
Match: NKX2-1 (NK2 homeobox 1 [Source:HGNC Symbol;Acc:HGNC:11825])

HSP 1 Score: 122.479 bits (306), Expect = 8.258e-30
Identity = 73/161 (45.34%), Postives = 91/161 (56.52%), Query Frame = 3
Query:  651 YCSS----VNDFNPYGDPRGTNS----WYGTSSLSNSNSDPRM-AMSRLMGTAAAAASGNMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            YC+     +++  PY D    ++    WYG      +N DPR  A+SR MG A+                   GM+ +               A +     + RRKRR+LFSQAQ+YELERRFKQQKYLSAPEREHLA++I+LTPTQVKIWFQNHRYK KR
Sbjct:   86 YCNGNLGNMSELPPYQDTMRNSASGPGWYG------ANPDPRFPAISRFMGPAS-------------------GMNMSGMGGLGSLGDVSKNMAPLPS---APRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKR 218          
BLAST of Homeobox protein DTH-2 vs. Ensembl Human
Match: NKX2-1 (NK2 homeobox 1 [Source:HGNC Symbol;Acc:HGNC:11825])

HSP 1 Score: 122.094 bits (305), Expect = 2.000e-29
Identity = 52/58 (89.66%), Postives = 57/58 (98.28%), Query Frame = 3
Query:  933 RRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            RRKRR+LFSQAQ+YELERRFKQQKYLSAPEREHLA++I+LTPTQVKIWFQNHRYK KR
Sbjct:  191 RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKR 248          
BLAST of Homeobox protein DTH-2 vs. Ensembl Celegans
Match: ceh-24 (Homeobox protein ceh-24 [Source:UniProtKB/Swiss-Prot;Acc:Q9NLC2])

HSP 1 Score: 120.939 bits (302), Expect = 2.898e-30
Identity = 53/64 (82.81%), Postives = 59/64 (92.19%), Query Frame = 3
Query:  915 FNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
             +++SQRRKRR+LFSQAQ+YELERRFKQ KYL+APERE LAN I LTPTQVKIWFQNHRYKCKR
Sbjct:  144 MSSMSQRRKRRVLFSQAQVYELERRFKQAKYLTAPEREQLANSIRLTPTQVKIWFQNHRYKCKR 207          
BLAST of Homeobox protein DTH-2 vs. Ensembl Celegans
Match: ceh-22 (Homeobox protein ceh-22 [Source:UniProtKB/Swiss-Prot;Acc:P41936])

HSP 1 Score: 95.5153 bits (236), Expect = 3.505e-22
Identity = 41/53 (77.36%), Postives = 46/53 (86.79%), Query Frame = 3
Query:  948 ILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            +LF++AQ YELERRF+ QKYLSAPERE LA  I LTPTQVKIWFQNHRYK K+
Sbjct:   63 VLFTKAQTYELERRFRSQKYLSAPEREALAMQIRLTPTQVKIWFQNHRYKTKK 115          
BLAST of Homeobox protein DTH-2 vs. Ensembl Celegans
Match: ceh-22 (Homeobox protein ceh-22 [Source:UniProtKB/Swiss-Prot;Acc:P41936])

HSP 1 Score: 95.9005 bits (237), Expect = 6.268e-22
Identity = 41/53 (77.36%), Postives = 46/53 (86.79%), Query Frame = 3
Query:  948 ILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            +LF++AQ YELERRF+ QKYLSAPERE LA  I LTPTQVKIWFQNHRYK K+
Sbjct:  108 VLFTKAQTYELERRFRSQKYLSAPEREALAMQIRLTPTQVKIWFQNHRYKTKK 160          
BLAST of Homeobox protein DTH-2 vs. Ensembl Celegans
Match: ceh-22 (Homeobox protein ceh-22 [Source:UniProtKB/Swiss-Prot;Acc:P41936])

HSP 1 Score: 95.1301 bits (235), Expect = 1.493e-21
Identity = 41/53 (77.36%), Postives = 46/53 (86.79%), Query Frame = 3
Query:  948 ILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            +LF++AQ YELERRF+ QKYLSAPERE LA  I LTPTQVKIWFQNHRYK K+
Sbjct:  131 VLFTKAQTYELERRFRSQKYLSAPEREALAMQIRLTPTQVKIWFQNHRYKTKK 183          
BLAST of Homeobox protein DTH-2 vs. Ensembl Celegans
Match: ceh-22 (Homeobox protein ceh-22 [Source:UniProtKB/Swiss-Prot;Acc:P41936])

HSP 1 Score: 95.9005 bits (237), Expect = 2.541e-21
Identity = 41/53 (77.36%), Postives = 46/53 (86.79%), Query Frame = 3
Query:  948 ILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            +LF++AQ YELERRF+ QKYLSAPERE LA  I LTPTQVKIWFQNHRYK K+
Sbjct:  194 VLFTKAQTYELERRFRSQKYLSAPEREALAMQIRLTPTQVKIWFQNHRYKTKK 246          
BLAST of Homeobox protein DTH-2 vs. Ensembl Fly
Match: scro (gene:FBgn0028993 transcript:FBtr0339923)

HSP 1 Score: 150.214 bits (378), Expect = 1.107e-40
Identity = 83/161 (51.55%), Postives = 107/161 (66.46%), Query Frame = 3
Query:  633 SPFGSQYCSSVNDFNP---YGDPRGTNSWYGTSSLSNSNSDPRMAMSRLMGTAAAAASGNMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            SP    YC   ++ +    Y D R + SWYG+++     +DPR A+SRLM   +++ASG MS         H G  S +   S+  +        +QF  ++QRRKRR+LF+QAQ+YELERRFKQQ+YLSAPEREHLA+LI+LTPTQVKIWFQNHRYKCKR
Sbjct:   13 SPGVQTYCGPTDNLSLAGHYTDMRNSASWYGSTA-----NDPRFAISRLM---SSSASGTMS---------HMGNMSGLAACSVSDSK------PLQFP-LAQRRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKCKR 149          
BLAST of Homeobox protein DTH-2 vs. Ensembl Fly
Match: scro (gene:FBgn0028993 transcript:FBtr0113751)

HSP 1 Score: 152.14 bits (383), Expect = 6.959e-40
Identity = 83/161 (51.55%), Postives = 107/161 (66.46%), Query Frame = 3
Query:  633 SPFGSQYCSSVNDFN---PYGDPRGTNSWYGTSSLSNSNSDPRMAMSRLMGTAAAAASGNMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            SP    YC   ++ +    Y D R + SWYG+++     +DPR A+SRLM   +++ASG MS         H G  S +   S+  +        +QF  ++QRRKRR+LF+QAQ+YELERRFKQQ+YLSAPEREHLA+LI+LTPTQVKIWFQNHRYKCKR
Sbjct:  174 SPGVQTYCGPTDNLSLAGHYTDMRNSASWYGSTA-----NDPRFAISRLM---SSSASGTMS---------HMGNMSGLAACSVSDS------KPLQFP-LAQRRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKCKR 310          
BLAST of Homeobox protein DTH-2 vs. Ensembl Fly
Match: scro (gene:FBgn0028993 transcript:FBtr0113752)

HSP 1 Score: 116.701 bits (291), Expect = 9.894e-28
Identity = 69/147 (46.94%), Postives = 92/147 (62.59%), Query Frame = 3
Query:  633 SPFGSQYCSSVNDFNP---YGDPRGTNSWYGTSSLSNSNSDPRMAMSRLMGTAAAAASGNMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQ 1064
            SP    YC   ++ +    Y D R + SWYG+++     +DPR A+SRLM   +++ASG MS         H G  S +   S+           +QF  ++QRRKRR+LF+QAQ+YELERRFKQQ+YLSAPEREHLA+LI+LTPTQ
Sbjct:  174 SPGVQTYCGPTDNLSLAGHYTDMRNSASWYGSTA-----NDPRFAISRLM---SSSASGTMS---------HMGNMSGLAACSVS------DSKPLQFP-LAQRRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQ 296          
BLAST of Homeobox protein DTH-2 vs. Ensembl Fly
Match: vnd (gene:FBgn0261930 transcript:FBtr0070110)

HSP 1 Score: 115.546 bits (288), Expect = 1.147e-26
Identity = 48/59 (81.36%), Postives = 56/59 (94.92%), Query Frame = 3
Query:  930 QRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            ++RKRR+LF++AQ YELERRF+QQ+YLSAPEREHLA+LI LTPTQVKIWFQNHRYK KR
Sbjct:  544 KKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKR 602          
BLAST of Homeobox protein DTH-2 vs. Ensembl Fly
Match: vnd (gene:FBgn0261930 transcript:FBtr0110929)

HSP 1 Score: 114.775 bits (286), Expect = 1.503e-26
Identity = 48/59 (81.36%), Postives = 56/59 (94.92%), Query Frame = 3
Query:  930 QRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            ++RKRR+LF++AQ YELERRF+QQ+YLSAPEREHLA+LI LTPTQVKIWFQNHRYK KR
Sbjct:  398 KKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKR 456          
BLAST of Homeobox protein DTH-2 vs. Ensembl Zebrafish
Match: nkx2.1 (NK2 homeobox 1 [Source:ZFIN;Acc:ZDB-GENE-010404-1])

HSP 1 Score: 132.88 bits (333), Expect = 7.835e-34
Identity = 83/173 (47.98%), Postives = 105/173 (60.69%), Query Frame = 3
Query:  615 GVSSGSSPFGSQYCS----SVNDFNPYGDP-RGTN---SWYGTSSLSNSNSDPRMA-MSRLMGTAAAAASGNMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            GVS  S      YC+    +++D   Y D  RG+    SWYGT      N DPR + +SR MG+++    G+MS  + + ++  +GM         G  T             + RRKRR+LFSQAQ+YELERRFKQQKYLSAPEREHLA++I+LTPTQVKIWFQNHRYK KR
Sbjct:   72 GVSQLSHTAMGGYCNGNLGNMSDLPAYQDGMRGSTTATSWYGT------NPDPRFSTISRFMGSSSGMNMGSMSTLSSL-ADVGKGM---------GPLTS------------TPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKR 216          
BLAST of Homeobox protein DTH-2 vs. Ensembl Zebrafish
Match: nkx2.4b (NK2 homeobox 4b [Source:ZFIN;Acc:ZDB-GENE-000830-1])

HSP 1 Score: 125.946 bits (315), Expect = 1.038e-31
Identity = 69/136 (50.74%), Postives = 83/136 (61.03%), Query Frame = 3
Query:  702 NSWYGTSSLSNSNSDPRM-AMSRLMGTAAAAASGNMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
             +WYG      SN +PR   +SR MG +A    G +            GM ++  + +L  A                RRKRR+LFSQAQ+YELERRFKQQKYLSAPEREHLA++I+LTPTQVKIWFQNHRYK KR
Sbjct:  101 TAWYG------SNPEPRYPTISRFMGPSAGMNMGTLP-----------GMDASKSMVTLHAAP---------------RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKR 204          
BLAST of Homeobox protein DTH-2 vs. Ensembl Zebrafish
Match: nkx2.4a (NK2 homeobox 4a [Source:ZFIN;Acc:ZDB-GENE-030131-6336])

HSP 1 Score: 125.946 bits (315), Expect = 2.157e-31
Identity = 71/135 (52.59%), Postives = 85/135 (62.96%), Query Frame = 3
Query:  708 WYGTSSLSNSNSDPRMA-MSRLMGTAAAAASGNMSVYAGIPSNFHQGMHSAMGISSLGTAT-YEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            WYG      +N DPR + +SR MG                PS       + M ++ +GT T       SI   + + RRKRR+LFSQAQ+YELERRFKQQKYLSAPEREHLA++I+LTPTQVKIWFQNHRYK KR
Sbjct:  112 WYG------ANPDPRYSTISRFMG----------------PS-------TGMNMTGMGTLTGMADTTKSIPPLHAAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKR 217          
BLAST of Homeobox protein DTH-2 vs. Ensembl Zebrafish
Match: nkx2.4a (NK2 homeobox 4a [Source:ZFIN;Acc:ZDB-GENE-030131-6336])

HSP 1 Score: 122.865 bits (307), Expect = 2.148e-30
Identity = 58/86 (67.44%), Postives = 70/86 (81.40%), Query Frame = 3
Query:  852 SAMGISSLGTAT-YEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            ++M ++ +GT T       SI   + + RRKRR+LFSQAQ+YELERRFKQQKYLSAPEREHLA++I+LTPTQVKIWFQNHRYK KR
Sbjct:  123 TSMNMTGMGTLTGMADTTKSIPPLHAAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKR 208          
BLAST of Homeobox protein DTH-2 vs. Ensembl Zebrafish
Match: nkx2.2a (NK2 homeobox 2a [Source:NCBI gene;Acc:30697])

HSP 1 Score: 114.775 bits (286), Expect = 4.012e-28
Identity = 49/59 (83.05%), Postives = 56/59 (94.92%), Query Frame = 3
Query:  930 QRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            ++RKRR+LFS+AQ YELERRF+QQ+YLSAPEREHLA+LI LTPTQVKIWFQNHRYK KR
Sbjct:  124 KKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKR 182          
BLAST of Homeobox protein DTH-2 vs. Ensembl Xenopus
Match: trpc3 (transient receptor potential cation channel, subfamily C, member 3 [Source:Xenbase;Acc:XB-GENE-1014039])

HSP 1 Score: 127.487 bits (319), Expect = 7.330e-32
Identity = 69/134 (51.49%), Postives = 82/134 (61.19%), Query Frame = 3
Query:  708 WYGTSSLSNSNSDPRMA-MSRLMGTAAAAASGNMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            WYG      +N+DPR + +SR MG +       M    GI         +A  ++ L  A                RRKRR+LFSQAQ+YELERRFKQQKYLSAPEREHLA++I+LTPTQVKIWFQNHRYK KR
Sbjct:  112 WYG------ANTDPRYSTISRFMGPSTGMNMAGMGTLQGIAE-------AAKSMAPLHAAP---------------RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKR 217          
BLAST of Homeobox protein DTH-2 vs. Ensembl Xenopus
Match: fam221a (family with sequence similarity 221 member A [Source:Xenbase;Acc:XB-GENE-1000335])

HSP 1 Score: 125.561 bits (314), Expect = 3.958e-31
Identity = 72/152 (47.37%), Postives = 90/152 (59.21%), Query Frame = 3
Query:  663 VNDFNPYGDPRGTNS---WYGTSSLSNSNSDPRMA-MSRLMGTAAAAASGNMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            +++  PY D    +S   WYG      +N DPR + +SR MG ++    G +                   + SLG         S+     + RRKRR+LFSQAQ+YELERRFKQQKYLSAPEREHLA++I+LTPTQVKIWFQNHRYK KR
Sbjct:   96 MSELPPYQDTMRNSSATGWYG------ANPDPRFSTISRFMGPSSGMNMGGLG-----------------NMGSLGDV-----GKSMTPLQATPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKR 219          
BLAST of Homeobox protein DTH-2 vs. Ensembl Xenopus
Match: NKX2-2 (NK2 homeobox 2 [Source:NCBI gene;Acc:100038077])

HSP 1 Score: 114.775 bits (286), Expect = 5.420e-28
Identity = 49/59 (83.05%), Postives = 56/59 (94.92%), Query Frame = 3
Query:  930 QRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            ++RKRR+LFS+AQ YELERRF+QQ+YLSAPEREHLA+LI LTPTQVKIWFQNHRYK KR
Sbjct:  126 KKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKR 184          
BLAST of Homeobox protein DTH-2 vs. Ensembl Xenopus
Match: NKX2-3 (NK2 homeobox 3 [Source:NCBI gene;Acc:100486189])

HSP 1 Score: 108.997 bits (271), Expect = 1.388e-25
Identity = 48/58 (82.76%), Postives = 53/58 (91.38%), Query Frame = 3
Query:  933 RRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            RRK R+LFSQAQ++ELERRFKQQ+YLSAPEREHLAN + LT TQVKIWFQN RYKCKR
Sbjct:  146 RRKPRVLFSQAQVFELERRFKQQRYLSAPEREHLANSLKLTSTQVKIWFQNRRYKCKR 203          
BLAST of Homeobox protein DTH-2 vs. Ensembl Xenopus
Match: ENSXETT00000008392.1 (homeobox protein Nkx-2.1-like [Source:NCBI gene;Acc:100485697])

HSP 1 Score: 105.916 bits (263), Expect = 5.176e-25
Identity = 53/87 (60.92%), Postives = 64/87 (73.56%), Query Frame = 3
Query:  852 SAMGISSLGTATY--EHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            S   +S+ G   Y  E  K S+   + S +RKRR+LFSQAQ+YELE+RF+ QKYL+APERE LA  I+LTP QVKIWFQNHRYK KR
Sbjct:   93 SGFNVSTAGCLGYLTEGPKHSLYLQHTS-KRKRRVLFSQAQVYELEKRFEHQKYLTAPEREQLAKHIHLTPNQVKIWFQNHRYKMKR 178          
BLAST of Homeobox protein DTH-2 vs. Ensembl Mouse
Match: Nkx2-4 (NK2 homeobox 4 [Source:MGI Symbol;Acc:MGI:97349])

HSP 1 Score: 127.872 bits (320), Expect = 4.553e-32
Identity = 68/124 (54.84%), Postives = 84/124 (67.74%), Query Frame = 3
Query:  738 NSDPRMA-MSRLMGTAAAAASGNMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            N+DPR + +SR MG +A     N++           GM S  GI+       +  K+    +  + RRKRR+LFSQAQ+YELERRFKQQKYLSAPEREHLA++I+LTPTQVKIWFQNHRYK KR
Sbjct:  143 NTDPRYSSISRFMGPSAGV---NVA-----------GMGSLTGIA-------DAAKSLAPLHAAAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKR 245          
BLAST of Homeobox protein DTH-2 vs. Ensembl Mouse
Match: Nkx2-1 (NK2 homeobox 1 [Source:MGI Symbol;Acc:MGI:108067])

HSP 1 Score: 122.094 bits (305), Expect = 8.559e-30
Identity = 73/161 (45.34%), Postives = 91/161 (56.52%), Query Frame = 3
Query:  651 YCSS----VNDFNPYGDPRGTNS----WYGTSSLSNSNSDPRM-AMSRLMGTAAAAASGNMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            YC+     +++  PY D    ++    WYG      +N DPR  A+SR MG A+                   GM+ +               A +     + RRKRR+LFSQAQ+YELERRFKQQKYLSAPEREHLA++I+LTPTQVKIWFQNHRYK KR
Sbjct:   86 YCNGNLGNMSELPPYQDTMRNSASGPGWYG------ANPDPRFPAISRFMGPAS-------------------GMNMSGMGGLGSLGDVSKNMAPLPS---APRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKR 218          
BLAST of Homeobox protein DTH-2 vs. Ensembl Mouse
Match: Nkx2-1 (NK2 homeobox 1 [Source:MGI Symbol;Acc:MGI:108067])

HSP 1 Score: 122.094 bits (305), Expect = 8.559e-30
Identity = 73/161 (45.34%), Postives = 91/161 (56.52%), Query Frame = 3
Query:  651 YCSS----VNDFNPYGDPRGTNS----WYGTSSLSNSNSDPRM-AMSRLMGTAAAAASGNMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            YC+     +++  PY D    ++    WYG      +N DPR  A+SR MG A+                   GM+ +               A +     + RRKRR+LFSQAQ+YELERRFKQQKYLSAPEREHLA++I+LTPTQVKIWFQNHRYK KR
Sbjct:   86 YCNGNLGNMSELPPYQDTMRNSASGPGWYG------ANPDPRFPAISRFMGPAS-------------------GMNMSGMGGLGSLGDVSKNMAPLPS---APRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKR 218          
BLAST of Homeobox protein DTH-2 vs. Ensembl Mouse
Match: Nkx2-2 (NK2 homeobox 2 [Source:MGI Symbol;Acc:MGI:97347])

HSP 1 Score: 115.161 bits (287), Expect = 3.331e-28
Identity = 49/62 (79.03%), Postives = 57/62 (91.94%), Query Frame = 3
Query:  921 NISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            +  ++RKRR+LFS+AQ YELERRF+QQ+YLSAPEREHLA+LI LTPTQVKIWFQNHRYK KR
Sbjct:  124 DAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKR 185          
BLAST of Homeobox protein DTH-2 vs. Ensembl Mouse
Match: Nkx2-2 (NK2 homeobox 2 [Source:MGI Symbol;Acc:MGI:97347])

HSP 1 Score: 113.62 bits (283), Expect = 6.275e-28
Identity = 49/62 (79.03%), Postives = 57/62 (91.94%), Query Frame = 3
Query:  921 NISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            +  ++RKRR+LFS+AQ YELERRF+QQ+YLSAPEREHLA+LI LTPTQVKIWFQNHRYK KR
Sbjct:  124 DAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKR 185          
BLAST of Homeobox protein DTH-2 vs. UniProt/SwissProt
Match: sp|Q00401|HMH2_GIRTI (Homeobox protein DTH-2 OS=Girardia tigrina OX=6162 GN=DTH-2 PE=2 SV=1)

HSP 1 Score: 530.406 bits (1365), Expect = 0.000e+0
Identity = 282/344 (81.98%), Postives = 312/344 (90.70%), Query Frame = 3
Query:  603 TQHTGVSSGSSPFGSQYCSSVNDFNPYGDPRGTNSWYGTSSLSNSNSDPRMAMSRLMGTAAAAASGNMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKRXXXXXXXXXXXXXXXCHLKKNI-EGKERSPGKLACNASSSPDRSTPEE-TSKVKETGLNFSNHKIDGLNLKTEADNEPKSSFYSIIPPYLTHSYSHQSLTDTQASPIINSVLSSNLFPDRKSPPAMGPLSSYSFGQSMDSISSFYSPDFSLYNCAHPYMSAAGSSYFMNAASRPWN 1628
            TQHTGVSSGSSPFGSQYCSSVNDFNPY DPRG+N+WYG ++ +N+++DPRM MSRLMG+AAAAAS +MS Y+GIP+NFHQGMHSAMG++SLG ATY+HQKA++QFNN+SQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKRSQKDKEKEQ KEKS  HLKKNI + KERSP K  CNASSS DRSTPEE  +K KE+GL+FSNHKID LNLK EAD EPKSS YSIIPPYLT+SY+ Q+ ++ Q SPIIN+VL SNLFP+RKS P MGPL+SYSFGQSMDSISSFYSPDFSLYNCAHPYM AA SSYFMNAASRPWN
Sbjct:   23 TQHTGVSSGSSPFGSQYCSSVNDFNPYSDPRGSNTWYGMAASANASNDPRMTMSRLMGSAAAAASSSMSAYSGIPTNFHQGMHSAMGMASLGAATYDHQKAAMQFNNMSQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKRSQKDKEKEQQKEKSY-HLKKNIVDDKERSPNKQICNASSS-DRSTPEEPVAKAKESGLDFSNHKIDNLNLKMEADLEPKSSLYSIIPPYLTNSYAQQTQSEAQTSPIINNVLGSNLFPERKSTPTMGPLTSYSFGQSMDSISSFYSPDFSLYNCAHPYM-AASSSYFMNAASRPWN 363          
BLAST of Homeobox protein DTH-2 vs. UniProt/SwissProt
Match: sp|Q9EQM3|NKX24_MOUSE (Homeobox protein Nkx-2.4 OS=Mus musculus OX=10090 GN=Nkx2-4 PE=2 SV=2)

HSP 1 Score: 127.872 bits (320), Expect = 3.185e-31
Identity = 68/124 (54.84%), Postives = 84/124 (67.74%), Query Frame = 3
Query:  738 NSDPRMA-MSRLMGTAAAAASGNMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            N+DPR + +SR MG +A     N++           GM S  GI+       +  K+    +  + RRKRR+LFSQAQ+YELERRFKQQKYLSAPEREHLA++I+LTPTQVKIWFQNHRYK KR
Sbjct:  143 NTDPRYSSISRFMGPSAGV---NVA-----------GMGSLTGIA-------DAAKSLAPLHAAAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKR 245          
BLAST of Homeobox protein DTH-2 vs. UniProt/SwissProt
Match: sp|Q9H2Z4|NKX24_HUMAN (Homeobox protein Nkx-2.4 OS=Homo sapiens OX=9606 GN=NKX2-4 PE=1 SV=3)

HSP 1 Score: 127.102 bits (318), Expect = 6.946e-31
Identity = 71/137 (51.82%), Postives = 81/137 (59.12%), Query Frame = 3
Query:  699 TNSWYGTSSLSNSNSDPRMA-MSRLMGTAAAAASGNMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
               WYG      +N DPR + +SR MG +A      M    GI          A    SLG                + RRKRR+LFSQAQ+YELERRFKQQKYLSAPEREHLA++I+LTPTQVKIWFQNHRYK KR
Sbjct:  133 ATGWYG------ANPDPRYSSISRFMGPSAGVNVAGMGSLTGI----------ADAAKSLGPL-------HAAAAAAAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKR 246          
BLAST of Homeobox protein DTH-2 vs. UniProt/SwissProt
Match: sp|Q9NLC2|HM24_CAEEL (Homeobox protein ceh-24 OS=Caenorhabditis elegans OX=6239 GN=ceh-24 PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 3.686e-29
Identity = 53/64 (82.81%), Postives = 59/64 (92.19%), Query Frame = 3
Query:  915 FNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
             +++SQRRKRR+LFSQAQ+YELERRFKQ KYL+APERE LAN I LTPTQVKIWFQNHRYKCKR
Sbjct:  144 MSSMSQRRKRRVLFSQAQVYELERRFKQAKYLTAPEREQLANSIRLTPTQVKIWFQNHRYKCKR 207          
BLAST of Homeobox protein DTH-2 vs. UniProt/SwissProt
Match: sp|P43698|TITF1_CANLF (Thyroid transcription factor 1 OS=Canis lupus familiaris OX=9615 GN=TITF1 PE=2 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 3.928e-29
Identity = 73/161 (45.34%), Postives = 91/161 (56.52%), Query Frame = 3
Query:  651 YCSS----VNDFNPYGDPRGTNS----WYGTSSLSNSNSDPRM-AMSRLMGTAAAAASGNMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            YC+     +++  PY D    ++    WYG      +N DPR  A+SR MG A+                   GM+ +               A +     + RRKRR+LFSQAQ+YELERRFKQQKYLSAPEREHLA++I+LTPTQVKIWFQNHRYK KR
Sbjct:   86 YCNGNLGNMSELPPYQDTMRNSASGPGWYG------ANPDPRFPAISRFMGPAS-------------------GMNMSGMGGLGSLGDVSKNMAPLPS---APRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKR 218          
BLAST of Homeobox protein DTH-2 vs. TrEMBL
Match: A0A267H0L1 (Homeobox domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006911g3 PE=4 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 1.334e-48
Identity = 98/168 (58.33%), Postives = 121/168 (72.02%), Query Frame = 3
Query:  615 GVSSGSSPFGSQYCSSVNDFNPYGDPRGTN---SWYGTSSLSNSNSDPRMA-MSRLMGTAAAAASGNMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            G   G++ F SQYC+   D +PY DPR T    SWYG +S     +DPR A MSRLMG+A +A+ G  S Y+ +PS+   GM ++MG+       Y+ + A +QF  +SQRRKRR+LF+QAQ+YELERRFKQQKYLSAPERE LA +INLTPTQVKIWFQNHRYKCKR
Sbjct:   55 GPHPGAASFTSQYCAGP-DLSPYADPRHTAAAASWYGATS---PTADPRFATMSRLMGSAGSASMG--SCYSSMPSSL--GMAASMGL-----GAYDQKAAGMQFP-MSQRRKRRVLFTQAQVYELERRFKQQKYLSAPEREQLAQMINLTPTQVKIWFQNHRYKCKR 208          
BLAST of Homeobox protein DTH-2 vs. TrEMBL
Match: A0A267E4E2 (Homeobox domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006911g1 PE=4 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 4.126e-48
Identity = 98/168 (58.33%), Postives = 122/168 (72.62%), Query Frame = 3
Query:  615 GVSSGSSPFGSQYCSSVNDFNPYGDPRGTN---SWYGTSSLSNSNSDPRMA-MSRLMGTAAAAASGNMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            G   G++ F SQYC+   D +PY DPR T    SWYG +S     +DPR A MSRLMG+A +A+ G  S Y+ +PS+   GM ++MG+ +     Y+ + A +QF  +SQRRKRR+LF+QAQ+YELERRFKQQKYLSAPERE LA +INLTPTQVKIWFQNHRYKCKR
Sbjct:   55 GPHPGAASFTSQYCAGP-DLSPYADPRHTAAAASWYGATS---PTADPRFATMSRLMGSAGSASMG--SCYSSMPSSL--GMAASMGLGA-----YDQKAAGMQFP-MSQRRKRRVLFTQAQVYELERRFKQQKYLSAPEREQLAQMINLTPTQVKIWFQNHRYKCKR 208          
BLAST of Homeobox protein DTH-2 vs. TrEMBL
Match: K1R0H9 (Homeobox protein Nkx-2.1 OS=Crassostrea gigas OX=29159 GN=CGI_10021129 PE=4 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 1.008e-40
Identity = 89/158 (56.33%), Postives = 111/158 (70.25%), Query Frame = 3
Query:  639 FGSQYCSSVNDFNPYGDP--RGTNSWYGTSSLSNSNSDPRMAMSRLMGTAAAAASGNMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            + +Q+C+   +F  YGDP   G+++WYGT      N DPR+A+SRLMG  ++ A  +MS                M +S+LG    +H+   IQF  I+QRRKRR+LFSQAQ+YELERRFKQQKYLSAPEREHLA++INLTPTQVKIWFQNHRYKCKR
Sbjct:   76 YTTQFCNGT-EFGHYGDPTRHGSSNWYGT------NPDPRLAISRLMGGPSSCAMSSMSSGM-----------HNMNMSALG-GLDQHKAGGIQFP-ITQRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMINLTPTQVKIWFQNHRYKCKR 213          
BLAST of Homeobox protein DTH-2 vs. TrEMBL
Match: A0A0K1NZ93 (NK2.1 homeobox (Fragment) OS=Priapulus caudatus OX=37621 GN=NK2.1 PE=2 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 1.152e-40
Identity = 86/169 (50.89%), Postives = 104/169 (61.54%), Query Frame = 3
Query:  609 HTGVSSGSSPFGSQYCSSVNDFNPYGDPRGTNSWYGTSSLSNSNSDPRMAMSRLMGTAAAA---ASGNMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            H    S  S F SQYC+   + + YGDP G    + ++    +N DPR A+SRLM  ++      S  +S   GI    H+GM                     QF  ++QRRKRR+LF+QAQ+YELERRFKQQKYLSAPEREHLA+LINLTPTQVKIWFQNHRYKCKR
Sbjct:   70 HVPQLSHHSSFPSQYCNGA-ELSHYGDPTGLAVRHSSTGWYTANPDPRFAISRLMSHSSGMNMNMSSTVSALNGIDGGMHKGM---------------------QFP-LTQRRKRRVLFTQAQVYELERRFKQQKYLSAPEREHLASLINLTPTQVKIWFQNHRYKCKR 215          
BLAST of Homeobox protein DTH-2 vs. TrEMBL
Match: Q2WBW8 (Nk2.1 protein OS=Platynereis dumerilii OX=6359 GN=nk2.1 PE=2 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 2.496e-40
Identity = 85/161 (52.80%), Postives = 115/161 (71.43%), Query Frame = 3
Query:  630 SSPFGSQYCSSVNDFNPYGDPRGTNSWYGTSSLSNSNSDPRMAMSRLMGTAAAAASG--NMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            +S F SQYC+  +D + YGDP   ++ + ++S  ++N DPR+ +SRLMG ++ + SG   MS   G+    +    +  G++  G    + QK  +QF  ++QRRKRR+LF+QAQ+YELERRFKQQKYLSAPEREHLA++INLTPTQVKIWFQNHRYK KR
Sbjct:   68 TSAFPSQYCNG-SDLSHYGDPMSMSTRHSSASWYSANPDPRLTISRLMGPSSCSMSGVSGMSGMTGMSGTMNHMNMNMTGMNMSGLGGLD-QKTGMQFP-MTQRRKRRVLFTQAQVYELERRFKQQKYLSAPEREHLASMINLTPTQVKIWFQNHRYKNKR 225          
BLAST of Homeobox protein DTH-2 vs. Ensembl Cavefish
Match: nkx2.1 (homeobox protein Nkx-2.1 [Source:NCBI gene;Acc:103043023])

HSP 1 Score: 132.88 bits (333), Expect = 5.350e-34
Identity = 72/135 (53.33%), Postives = 86/135 (63.70%), Query Frame = 3
Query:  705 SWYGTSSLSNSNSDPRMA-MSRLMGTAAAAASGNMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            SWYGT      N DPR + +SR MG+++    G+MS    +            G+ SL +A                RRKRR+LFSQAQ+YELERRFKQQKYLSAPEREHLA++I+LTPTQVKIWFQNHRYK KR
Sbjct:  111 SWYGT------NPDPRFSTISRFMGSSSGMNMGSMSSLGSLAD-------VGKGMGSLSSAP---------------RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKR 217          
BLAST of Homeobox protein DTH-2 vs. Ensembl Cavefish
Match: nkx2.4b (NK2 homeobox 4 [Source:NCBI gene;Acc:103036401])

HSP 1 Score: 125.561 bits (314), Expect = 1.497e-31
Identity = 68/136 (50.00%), Postives = 84/136 (61.76%), Query Frame = 3
Query:  702 NSWYGTSSLSNSNSDPRM-AMSRLMGTAAAAASGNMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
             +WYG      +N +PR   +SR MG++A  A G ++           GM +   +S  GT                 RRKRR+LFSQAQ+YELERRFKQQ+YLSAPEREHLA++I+LTP QVKIWFQNHRYK KR
Sbjct:   98 TAWYG------ANPEPRYPTISRFMGSSAGMAVGALA-----------GMDTKTVVSLHGTP----------------RRKRRVLFSQAQVYELERRFKQQRYLSAPEREHLASMIHLTPNQVKIWFQNHRYKMKR 200          
BLAST of Homeobox protein DTH-2 vs. Ensembl Cavefish
Match: ENSAMXT00000002203.2 (pep primary_assembly:Astyanax_mexicanus-2.0:9:20913167:20916891:1 gene:ENSAMXG00000002158.2 transcript:ENSAMXT00000002203.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.064 bits (253), Expect = 4.344e-25
Identity = 47/71 (66.20%), Postives = 56/71 (78.87%), Query Frame = 3
Query:  894 HQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            H+  S       +++KRR+LFS+ Q YELERRF+QQ+YLSAPEREHLA  + LTPTQVKIWFQNHRYK KR
Sbjct:    4 HKPQSFSTEMEQKKKKRRVLFSKTQTYELERRFRQQRYLSAPEREHLARALRLTPTQVKIWFQNHRYKMKR 74          
BLAST of Homeobox protein DTH-2 vs. Ensembl Cavefish
Match: nkx2.5 (homeobox protein Nkx-2.5 [Source:NCBI gene;Acc:103025318])

HSP 1 Score: 102.449 bits (254), Expect = 1.403e-23
Identity = 45/59 (76.27%), Postives = 50/59 (84.75%), Query Frame = 3
Query:  930 QRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            +RRK R+LFSQAQ+ ELERRF QQ+YLSA EREHLA  + LT TQVKIWFQN RYKCKR
Sbjct:  131 KRRKPRVLFSQAQVCELERRFTQQRYLSAAEREHLAGALRLTSTQVKIWFQNRRYKCKR 189          
BLAST of Homeobox protein DTH-2 vs. Ensembl Cavefish
Match: nkx2.3 (NK2 homeobox 3 [Source:NCBI gene;Acc:103034978])

HSP 1 Score: 101.293 bits (251), Expect = 3.756e-23
Identity = 43/53 (81.13%), Postives = 49/53 (92.45%), Query Frame = 3
Query:  948 ILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            +LFSQAQ++ELERRFKQQ+YLSAPEREHLA+ + LT TQVKIWFQN RYKCKR
Sbjct:  154 VLFSQAQVFELERRFKQQRYLSAPEREHLASALKLTSTQVKIWFQNRRYKCKR 206          
BLAST of Homeobox protein DTH-2 vs. Ensembl Sea Lamprey
Match: nkx2.1 (NK2 homeobox 1 [Source:ZFIN;Acc:ZDB-GENE-010404-1])

HSP 1 Score: 122.479 bits (306), Expect = 4.166e-32
Identity = 61/117 (52.14%), Postives = 76/117 (64.96%), Query Frame = 3
Query:  756 AMSRLMGTAAAAASGNMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            A+SR M T++    G M+ Y G+  +  + +   +                      + RRKRR+LFSQAQ+YELERRFKQQKYLSAPEREHLA++I+LTPTQVKIWFQNHRYK KR
Sbjct:    2 AVSRFMSTSSGMNMGGMNAYGGMGGDAGKVLAPLVS---------------------TPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKR 97          
BLAST of Homeobox protein DTH-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005776.1 (pep scaffold:Pmarinus_7.0:GL477528:542110:542457:1 gene:ENSPMAG00000005236.1 transcript:ENSPMAT00000005776.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.375 bits (259), Expect = 2.418e-27
Identity = 46/59 (77.97%), Postives = 55/59 (93.22%), Query Frame = 3
Query:  930 QRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            ++RKRR+LFS+AQ +ELERRF+ Q+YLSAPEREHLA+L+ LTPTQVKIWFQNHRYK KR
Sbjct:    1 KKRKRRVLFSKAQTFELERRFRHQRYLSAPEREHLASLLKLTPTQVKIWFQNHRYKMKR 59          
BLAST of Homeobox protein DTH-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001141.1 (pep scaffold:Pmarinus_7.0:GL478075:36995:38394:-1 gene:ENSPMAG00000001023.1 transcript:ENSPMAT00000001141.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.6994 bits (156), Expect = 2.666e-13
Identity = 32/57 (56.14%), Postives = 40/57 (70.18%), Query Frame = 3
Query:  936 RKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            R+ R  FS  Q+ ELER F +Q+YLS P+R  +A+ + LT TQVKIWFQN R K KR
Sbjct:    4 RRPRTAFSSQQLLELERHFSRQRYLSRPQRFQVASALMLTETQVKIWFQNRRMKWKR 60          
BLAST of Homeobox protein DTH-2 vs. Ensembl Sea Lamprey
Match: dlx5a (distal-less homeobox 5a [Source:NCBI gene;Acc:30569])

HSP 1 Score: 70.0922 bits (170), Expect = 3.434e-13
Identity = 43/104 (41.35%), Postives = 56/104 (53.85%), Query Frame = 3
Query:  936 RKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKRXXXXXXXXXXXXXXXCHLKKNIE--GKERSPG---KLACNASSSPDR 1232
            RK R ++S  Q+  L+RRF+Q +YL+ PER  LA  + LT TQVKIWFQN R K K+                 L KN E    + SP     +ACN+ +SP R
Sbjct:  203 RKPRTIYSSFQLAALQRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFKK-----------------LGKNGEMAPAQASPSSSDPMACNSPASPGR 289          
BLAST of Homeobox protein DTH-2 vs. Ensembl Sea Lamprey
Match: HMX1 (H6 family homeobox 1 [Source:HGNC Symbol;Acc:HGNC:5017])

HSP 1 Score: 64.6994 bits (156), Expect = 7.199e-13
Identity = 30/58 (51.72%), Postives = 43/58 (74.14%), Query Frame = 3
Query:  933 RRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            ++K R +FS++Q+++LE  F  ++YLS+ ER  LA  ++LT TQVKIWFQN R K KR
Sbjct:    1 KKKTRTVFSRSQVFQLESTFDMKRYLSSAERAGLAASLHLTETQVKIWFQNRRNKWKR 58          
BLAST of Homeobox protein DTH-2 vs. Ensembl Nematostella
Match: EDO33946 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQP5])

HSP 1 Score: 107.071 bits (266), Expect = 1.456e-27
Identity = 47/63 (74.60%), Postives = 56/63 (88.89%), Query Frame = 3
Query:  918 NNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            N   ++RKRR+LF++AQ YELERRF+QQ+YLSAPERE LA +INLTPTQVKIWFQNHRYK K+
Sbjct:    2 NEPPKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREQLARIINLTPTQVKIWFQNHRYKFKK 64          
BLAST of Homeobox protein DTH-2 vs. Ensembl Nematostella
Match: EDO45871 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRR7])

HSP 1 Score: 102.834 bits (255), Expect = 6.822e-27
Identity = 43/58 (74.14%), Postives = 55/58 (94.83%), Query Frame = 3
Query:  933 RRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            ++K+RILF+++QIYELERRF+ Q+YLSAPEREHLA +I+LTP QVKIWFQNHRYKC++
Sbjct:    1 KKKKRILFTRSQIYELERRFRVQQYLSAPEREHLARMISLTPVQVKIWFQNHRYKCRQ 58          
BLAST of Homeobox protein DTH-2 vs. Ensembl Nematostella
Match: NK-4 (NK-4 homeobox protein; Predicted protein [Source:UniProtKB/TrEMBL;Acc:Q7YZD1])

HSP 1 Score: 108.997 bits (271), Expect = 1.840e-26
Identity = 47/58 (81.03%), Postives = 53/58 (91.38%), Query Frame = 3
Query:  933 RRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            RRK R+LFSQAQ+YELERRFK QKYLSAPER+HLA+L+ LTP QVKIWFQN RYKCK+
Sbjct:  155 RRKPRVLFSQAQVYELERRFKGQKYLSAPERDHLASLLKLTPNQVKIWFQNKRYKCKK 212          
BLAST of Homeobox protein DTH-2 vs. Ensembl Nematostella
Match: EDO33947 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQP6])

HSP 1 Score: 100.138 bits (248), Expect = 1.237e-25
Identity = 45/59 (76.27%), Postives = 54/59 (91.53%), Query Frame = 3
Query:  930 QRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            ++RKRRILF+++QIYELERRF+ Q+YLSAPERE L  +INLTPTQVKIWFQNHRYK K+
Sbjct:    1 KKRKRRILFTKSQIYELERRFRYQRYLSAPEREQLGRMINLTPTQVKIWFQNHRYKHKK 59          
BLAST of Homeobox protein DTH-2 vs. Ensembl Nematostella
Match: NK-2 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQP7])

HSP 1 Score: 102.449 bits (254), Expect = 1.078e-24
Identity = 44/59 (74.58%), Postives = 55/59 (93.22%), Query Frame = 3
Query:  930 QRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            +++KRRILF+++QI+ELERRF+QQKYLSA ERE LA +I+LTPTQVKIWFQNHRYK K+
Sbjct:   90 RKKKRRILFTKSQIFELERRFRQQKYLSANEREQLARIIDLTPTQVKIWFQNHRYKFKK 148          
BLAST of Homeobox protein DTH-2 vs. Ensembl Medaka
Match: ENSORLT00000021504.2 (NK2 homeobox 4 [Source:NCBI gene;Acc:101162726])

HSP 1 Score: 129.413 bits (324), Expect = 6.920e-33
Identity = 101/260 (38.85%), Postives = 128/260 (49.23%), Query Frame = 3
Query:  699 TNSWYGTSSLSNSNSDPRM-AMSRLMGTAAAAASGNMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKRXXXXXXXXXXXXXXXCHLKKNIEGKERSPGK-LACNASSSPDRSTPEETSKVKETG----LNFSNHKIDGLNLKTEADNEPKSSFYSIIPPYLTHSYSHQSLTDTQASPIINSVLSSNLFPDR 1460
            T +WY       SN +PR   +SR MG   A+A  NMS   G                  G A  +    S+   + + RRKRR+LFSQAQ+YELERRFKQQKYLSAPEREHLA LI+LTP QVKIWFQNHRYK KR  KDK  +Q +  S         G+  S    L+ NA  S   S     +  ++ G    +  +  +++ L+   E ++       S  PP   H     S TD       NSV+ SNL   R
Sbjct:  107 TTAWY-------SNPEPRYPTISRYMG---ASAGMNMSGMVG------------------GLAGMDSSAKSVVTLHAAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLAGLIHLTPNQVKIWFQNHRYKLKRQAKDKAAQQPQHDSGGGAASATTGRSSSVSPVLSKNAKGSRTDSCGSNNTGNRQGGSGDAMTATPQQVNHLSSTEELED------LSPSPPMGLHDQIQMSQTDAALMDYTNSVIGSNLLYGR 332          
BLAST of Homeobox protein DTH-2 vs. Ensembl Medaka
Match: ENSORLT00000042590.1 (NK2 homeobox 4 [Source:NCBI gene;Acc:101162726])

HSP 1 Score: 129.798 bits (325), Expect = 8.969e-33
Identity = 110/295 (37.29%), Postives = 141/295 (47.80%), Query Frame = 3
Query:  606 QHTGVSSGSSPFGSQYCSSVNDFNPYGDP----RGTNSWYGTSSLSNSNSDPRM-AMSRLMGTAAAAASGNMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKRXXXXXXXXXXXXXXXCHLKKNIEGKERSPGK-LACNASSSPDRSTPEETSKVKETG----LNFSNHKIDGLNLKTEADNEPKSSFYSIIPPYLTHSYSHQSLTDTQASPIINSVLSSNLFPDR 1460
            Q +G  SG   F +   S+V D   Y +       T +WY       SN +PR   +SR MG   A+A  NMS   G                  G A  +    S+   + + RRKRR+LFSQAQ+YELERRFKQQKYLSAPEREHLA LI+LTP QVKIWFQNHRYK KR  KDK  +Q +  S         G+  S    L+ NA  S   S     +  ++ G    +  +  +++ L+   E ++       S  PP   H     S TD       NSV+ SNL   R
Sbjct:   94 QFSGAVSG---FCNGGISNVGDLPTYQETVRSGGATTAWY-------SNPEPRYPTISRYMG---ASAGMNMSGMVG------------------GLAGMDSSAKSVVTLHAAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLAGLIHLTPNQVKIWFQNHRYKLKRQAKDKAAQQPQHDSGGGAASATTGRSSSVSPVLSKNAKGSRTDSCGSNNTGNRQGGSGDAMTATPQQVNHLSSTEELED------LSPSPPMGLHDQIQMSQTDAALMDYTNSVIGSNLLYGR 351          
BLAST of Homeobox protein DTH-2 vs. Ensembl Medaka
Match: nkx2.1 (NK2 homeobox 1 [Source:NCBI gene;Acc:100049404])

HSP 1 Score: 128.642 bits (322), Expect = 1.888e-32
Identity = 69/134 (51.49%), Postives = 85/134 (63.43%), Query Frame = 3
Query:  708 WYGTSSLSNSNSDPRMA-MSRLMGTAAAAASGNMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            WYG      +N DPR + +SR MG+++    G+M     +            G+SSL +               + RRKRR+LFSQAQ+YELERRFKQQKYLSAPEREHLA++I+LTPTQVKIWFQNHRYK KR
Sbjct:  111 WYG------ANPDPRFSTISRFMGSSSGMNMGSMGSLGSLAD-------VGKGMSSLSS---------------TPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKR 216          
BLAST of Homeobox protein DTH-2 vs. Ensembl Medaka
Match: nkx2.4a (homeobox protein Nkx-2.4-like [Source:NCBI gene;Acc:101163285])

HSP 1 Score: 122.094 bits (305), Expect = 4.062e-30
Identity = 52/58 (89.66%), Postives = 57/58 (98.28%), Query Frame = 3
Query:  933 RRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            RRKRR+LFSQAQ+YELERRFKQQKYLSAPEREHLA++I+LTPTQVKIWFQNHRYK KR
Sbjct:  151 RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKR 208          
BLAST of Homeobox protein DTH-2 vs. Ensembl Medaka
Match: nkx2.2a (homeobox protein Nkx-2.2a [Source:NCBI gene;Acc:101157822])

HSP 1 Score: 114.39 bits (285), Expect = 4.843e-28
Identity = 49/59 (83.05%), Postives = 56/59 (94.92%), Query Frame = 3
Query:  930 QRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            ++RKRR+LFS+AQ YELERRF+QQ+YLSAPEREHLA+LI LTPTQVKIWFQNHRYK KR
Sbjct:  128 KKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKR 186          
BLAST of Homeobox protein DTH-2 vs. Planmine SMEST
Match: SMESG000037282.1 (SMESG000037282.1)

HSP 1 Score: 675.241 bits (1741), Expect = 0.000e+0
Identity = 341/342 (99.71%), Postives = 342/342 (100.00%), Query Frame = 3
Query:  603 TQHTGVSSGSSPFGSQYCSSVNDFNPYGDPRGTNSWYGTSSLSNSNSDPRMAMSRLMGTAAAAASGNMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKRXXXXXXXXXXXXXXXCHLKKNIEGKERSPGKLACNASSSPDRSTPEETSKVKETGLNFSNHKIDGLNLKTEADNEPKSSFYSIIPPYLTHSYSHQSLTDTQASPIINSVLSSNLFPDRKSPPAMGPLSSYSFGQSMDSISSFYSPDFSLYNCAHPYMSAAGSSYFMNAASRPWN 1628
            TQHTGVSSGSSPFGSQYCSSVNDFNPYGDPRGTNSWYGTSSLSNSNSDPRMAMSRLMGTAAAAASGNMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKRSQKDKEKEQLKEKSSCHLKKNIEGKERSPGKLACNASSSPDRSTPEETSKVKETGLNFSNHKIDGLNLKTEADNEPKSSFYSIIPPYLT+SYSHQSLTDTQASPIINSVLSSNLFPDRKSPPAMGPLSSYSFGQSMDSISSFYSPDFSLYNCAHPYMSAAGSSYFMNAASRPWN
Sbjct:   14 TQHTGVSSGSSPFGSQYCSSVNDFNPYGDPRGTNSWYGTSSLSNSNSDPRMAMSRLMGTAAAAASGNMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKRSQKDKEKEQLKEKSSCHLKKNIEGKERSPGKLACNASSSPDRSTPEETSKVKETGLNFSNHKIDGLNLKTEADNEPKSSFYSIIPPYLTNSYSHQSLTDTQASPIINSVLSSNLFPDRKSPPAMGPLSSYSFGQSMDSISSFYSPDFSLYNCAHPYMSAAGSSYFMNAASRPWN 355          
BLAST of Homeobox protein DTH-2 vs. Planmine SMEST
Match: SMESG000037282.1 (SMESG000037282.1)

HSP 1 Score: 674.47 bits (1739), Expect = 0.000e+0
Identity = 341/342 (99.71%), Postives = 342/342 (100.00%), Query Frame = 3
Query:  603 TQHTGVSSGSSPFGSQYCSSVNDFNPYGDPRGTNSWYGTSSLSNSNSDPRMAMSRLMGTAAAAASGNMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKRXXXXXXXXXXXXXXXCHLKKNIEGKERSPGKLACNASSSPDRSTPEETSKVKETGLNFSNHKIDGLNLKTEADNEPKSSFYSIIPPYLTHSYSHQSLTDTQASPIINSVLSSNLFPDRKSPPAMGPLSSYSFGQSMDSISSFYSPDFSLYNCAHPYMSAAGSSYFMNAASRPWN 1628
            TQHTGVSSGSSPFGSQYCSSVNDFNPYGDPRGTNSWYGTSSLSNSNSDPRMAMSRLMGTAAAAASGNMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKRSQKDKEKEQLKEKSSCHLKKNIEGKERSPGKLACNASSSPDRSTPEETSKVKETGLNFSNHKIDGLNLKTEADNEPKSSFYSIIPPYLT+SYSHQSLTDTQASPIINSVLSSNLFPDRKSPPAMGPLSSYSFGQSMDSISSFYSPDFSLYNCAHPYMSAAGSSYFMNAASRPWN
Sbjct:   23 TQHTGVSSGSSPFGSQYCSSVNDFNPYGDPRGTNSWYGTSSLSNSNSDPRMAMSRLMGTAAAAASGNMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKRSQKDKEKEQLKEKSSCHLKKNIEGKERSPGKLACNASSSPDRSTPEETSKVKETGLNFSNHKIDGLNLKTEADNEPKSSFYSIIPPYLTNSYSHQSLTDTQASPIINSVLSSNLFPDRKSPPAMGPLSSYSFGQSMDSISSFYSPDFSLYNCAHPYMSAAGSSYFMNAASRPWN 364          
BLAST of Homeobox protein DTH-2 vs. Planmine SMEST
Match: SMESG000081885.1 (SMESG000081885.1)

HSP 1 Score: 119.398 bits (298), Expect = 4.854e-29
Identity = 74/131 (56.49%), Postives = 90/131 (68.70%), Query Frame = 3
Query:  738 NSDPRMAMSRLMGTAAAAASGN-------MSVYAGIPSN-FHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            N+D R A+S+L+G A+  +SG        MS +   PS+ + +  +   G S +    Y+           SQRR+RRILFSQAQ+YELERRFKQQKYLSAPEREHLA+LINLTPTQVKIWFQNHRYKCKR
Sbjct:   70 NTDTRSAVSKLIG-ASDTSSGTAYNPCNLMSPF--FPSSRYDRSSNLFSGNSPINGMLYQSH---------SQRRRRRILFSQAQVYELERRFKQQKYLSAPEREHLASLINLTPTQVKIWFQNHRYKCKR 188          
BLAST of Homeobox protein DTH-2 vs. Planmine SMEST
Match: SMESG000062916.1 (SMESG000062916.1)

HSP 1 Score: 110.923 bits (276), Expect = 3.944e-27
Identity = 49/59 (83.05%), Postives = 53/59 (89.83%), Query Frame = 3
Query:  930 QRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            QRRKRRILFSQ+Q+YELER+FK QKYLSA ER+ LA  INLTP QVKIWFQNHRYKCKR
Sbjct:  129 QRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKR 187          
BLAST of Homeobox protein DTH-2 vs. Planmine SMEST
Match: SMESG000079512.1 (SMESG000079512.1)

HSP 1 Score: 111.309 bits (277), Expect = 9.733e-26
Identity = 47/62 (75.81%), Postives = 56/62 (90.32%), Query Frame = 3
Query:  921 NISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKR 1106
            ++ ++RKRR+LFS+ QI ELER F+Q+KYLSAPEREHLANLI L+PTQVKIWFQNHRYK KR
Sbjct:  362 DVGKKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKR 423          
The following BLAST results are available for this feature:
BLAST of Homeobox protein DTH-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NKX2-41.446e-3151.82NK2 homeobox 4 [Source:HGNC Symbol;Acc:HGNC:7837][more]
NKX2-18.258e-3045.34NK2 homeobox 1 [Source:HGNC Symbol;Acc:HGNC:11825][more]
NKX2-18.258e-3045.34NK2 homeobox 1 [Source:HGNC Symbol;Acc:HGNC:11825][more]
NKX2-18.258e-3045.34NK2 homeobox 1 [Source:HGNC Symbol;Acc:HGNC:11825][more]
NKX2-12.000e-2989.66NK2 homeobox 1 [Source:HGNC Symbol;Acc:HGNC:11825][more]
back to top
BLAST of Homeobox protein DTH-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ceh-242.898e-3082.81Homeobox protein ceh-24 [Source:UniProtKB/Swiss-P... [more]
ceh-223.505e-2277.36Homeobox protein ceh-22 [Source:UniProtKB/Swiss-P... [more]
ceh-226.268e-2277.36Homeobox protein ceh-22 [Source:UniProtKB/Swiss-P... [more]
ceh-221.493e-2177.36Homeobox protein ceh-22 [Source:UniProtKB/Swiss-P... [more]
ceh-222.541e-2177.36Homeobox protein ceh-22 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Homeobox protein DTH-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scro1.107e-4051.55gene:FBgn0028993 transcript:FBtr0339923[more]
scro6.959e-4051.55gene:FBgn0028993 transcript:FBtr0113751[more]
scro9.894e-2846.94gene:FBgn0028993 transcript:FBtr0113752[more]
vnd1.147e-2681.36gene:FBgn0261930 transcript:FBtr0070110[more]
vnd1.503e-2681.36gene:FBgn0261930 transcript:FBtr0110929[more]
back to top
BLAST of Homeobox protein DTH-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nkx2.17.835e-3447.98NK2 homeobox 1 [Source:ZFIN;Acc:ZDB-GENE-010404-1][more]
nkx2.4b1.038e-3150.74NK2 homeobox 4b [Source:ZFIN;Acc:ZDB-GENE-000830-1... [more]
nkx2.4a2.157e-3152.59NK2 homeobox 4a [Source:ZFIN;Acc:ZDB-GENE-030131-6... [more]
nkx2.4a2.148e-3067.44NK2 homeobox 4a [Source:ZFIN;Acc:ZDB-GENE-030131-6... [more]
nkx2.2a4.012e-2883.05NK2 homeobox 2a [Source:NCBI gene;Acc:30697][more]
back to top
BLAST of Homeobox protein DTH-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpc37.330e-3251.49transient receptor potential cation channel, subfa... [more]
fam221a3.958e-3147.37family with sequence similarity 221 member A [Sour... [more]
NKX2-25.420e-2883.05NK2 homeobox 2 [Source:NCBI gene;Acc:100038077][more]
NKX2-31.388e-2582.76NK2 homeobox 3 [Source:NCBI gene;Acc:100486189][more]
ENSXETT00000008392.15.176e-2560.92homeobox protein Nkx-2.1-like [Source:NCBI gene;Ac... [more]
back to top
BLAST of Homeobox protein DTH-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nkx2-44.553e-3254.84NK2 homeobox 4 [Source:MGI Symbol;Acc:MGI:97349][more]
Nkx2-18.559e-3045.34NK2 homeobox 1 [Source:MGI Symbol;Acc:MGI:108067][more]
Nkx2-18.559e-3045.34NK2 homeobox 1 [Source:MGI Symbol;Acc:MGI:108067][more]
Nkx2-23.331e-2879.03NK2 homeobox 2 [Source:MGI Symbol;Acc:MGI:97347][more]
Nkx2-26.275e-2879.03NK2 homeobox 2 [Source:MGI Symbol;Acc:MGI:97347][more]
back to top
BLAST of Homeobox protein DTH-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q00401|HMH2_GIRTI0.000e+081.98Homeobox protein DTH-2 OS=Girardia tigrina OX=6162... [more]
sp|Q9EQM3|NKX24_MOUSE3.185e-3154.84Homeobox protein Nkx-2.4 OS=Mus musculus OX=10090 ... [more]
sp|Q9H2Z4|NKX24_HUMAN6.946e-3151.82Homeobox protein Nkx-2.4 OS=Homo sapiens OX=9606 G... [more]
sp|Q9NLC2|HM24_CAEEL3.686e-2982.81Homeobox protein ceh-24 OS=Caenorhabditis elegans ... [more]
sp|P43698|TITF1_CANLF3.928e-2945.34Thyroid transcription factor 1 OS=Canis lupus fami... [more]
back to top
BLAST of Homeobox protein DTH-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267H0L11.334e-4858.33Homeobox domain-containing protein OS=Macrostomum ... [more]
A0A267E4E24.126e-4858.33Homeobox domain-containing protein OS=Macrostomum ... [more]
K1R0H91.008e-4056.33Homeobox protein Nkx-2.1 OS=Crassostrea gigas OX=2... [more]
A0A0K1NZ931.152e-4050.89NK2.1 homeobox (Fragment) OS=Priapulus caudatus OX... [more]
Q2WBW82.496e-4052.80Nk2.1 protein OS=Platynereis dumerilii OX=6359 GN=... [more]
back to top
BLAST of Homeobox protein DTH-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nkx2.15.350e-3453.33homeobox protein Nkx-2.1 [Source:NCBI gene;Acc:103... [more]
nkx2.4b1.497e-3150.00NK2 homeobox 4 [Source:NCBI gene;Acc:103036401][more]
ENSAMXT00000002203.24.344e-2566.20pep primary_assembly:Astyanax_mexicanus-2.0:9:2091... [more]
nkx2.51.403e-2376.27homeobox protein Nkx-2.5 [Source:NCBI gene;Acc:103... [more]
nkx2.33.756e-2381.13NK2 homeobox 3 [Source:NCBI gene;Acc:103034978][more]
back to top
BLAST of Homeobox protein DTH-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nkx2.14.166e-3252.14NK2 homeobox 1 [Source:ZFIN;Acc:ZDB-GENE-010404-1][more]
ENSPMAT00000005776.12.418e-2777.97pep scaffold:Pmarinus_7.0:GL477528:542110:542457:1... [more]
ENSPMAT00000001141.12.666e-1356.14pep scaffold:Pmarinus_7.0:GL478075:36995:38394:-1 ... [more]
dlx5a3.434e-1341.35distal-less homeobox 5a [Source:NCBI gene;Acc:3056... [more]
HMX17.199e-1351.72H6 family homeobox 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Homeobox protein DTH-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Homeobox protein DTH-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO339461.456e-2774.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458716.822e-2774.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
NK-41.840e-2681.03NK-4 homeobox protein; Predicted protein [Source:... [more]
EDO339471.237e-2576.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
NK-21.078e-2474.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Homeobox protein DTH-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000021504.26.920e-3338.85NK2 homeobox 4 [Source:NCBI gene;Acc:101162726][more]
ENSORLT00000042590.18.969e-3337.29NK2 homeobox 4 [Source:NCBI gene;Acc:101162726][more]
nkx2.11.888e-3251.49NK2 homeobox 1 [Source:NCBI gene;Acc:100049404][more]
nkx2.4a4.062e-3089.66homeobox protein Nkx-2.4-like [Source:NCBI gene;Ac... [more]
nkx2.2a4.843e-2883.05homeobox protein Nkx-2.2a [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Homeobox protein DTH-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037282.10.000e+099.71SMESG000037282.1[more]
SMESG000037282.10.000e+099.71SMESG000037282.1[more]
SMESG000081885.14.854e-2956.49SMESG000081885.1[more]
SMESG000062916.13.944e-2783.05SMESG000062916.1[more]
SMESG000079512.19.733e-2675.81SMESG000079512.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022975 ID=SMED30022975|Name=Homeobox protein DTH-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1740bp
CTAAATTTGATTCATTAGTAATTTATTTTGAAAAATTATTCCATAGGCAG
AGCAGTCGATGTGCATGAAATAAGAAATTACCTGTGACCGAGTATGACTG
TATGTGGACAGAAATTGAGAAGCATGCAAACTGATGAAATGAAAAACGTG
GTTACGAATGTTCACGGTGTACGGTAATTGCTTTATTGTATGTTGGTAAG
GTAGCGATAAGTATGCATTTAAGTAAGTAGAACACACTGGCTTGAGTTTA
GTTGTGAAATATACAAATAATCAGTGAAGCACGATCAAATCAGCACCAAT
AAATGCAACCAGATAACACTTGGTACTTAATATCTAAACTCAGGACTAGA
TAGTTATTAATTCAGCTTTGCCTTTAAACTTACTACTCAAGTATCTGTTA
TAGGTATTTGTAATCATCTATTTGAATAACACTTAACACTTTCTGTGAGA
ACCTTTATTATCTAAACTGGTACTAGGAGAAGTACTACTTCAAGACTACT
CAACTAAGTGAGACACCCATCATTCATAAAGCTGCTATGAGTGGTATACC
TGGACTCTCTGGAATGTCCTCAATGTCACCATATTCTGCATATGCTGCAT
TAACTCAGCATACTGGTGTCAGTTCTGGCTCCTCACCATTTGGATCTCAA
TATTGTTCAAGTGTAAATGATTTCAATCCCTATGGTGATCCAAGAGGAAC
CAATTCTTGGTATGGAACATCATCACTATCTAATTCAAACAGTGATCCGC
GTATGGCGATGTCTCGATTGATGGGAACTGCAGCGGCAGCTGCAAGTGGA
AACATGTCAGTTTATGCGGGAATTCCTTCTAATTTCCATCAAGGTATGCA
TTCTGCAATGGGAATATCTTCATTGGGAACGGCCACTTATGAACATCAAA
AAGCTTCAATTCAATTTAACAATATATCTCAACGTCGAAAACGACGAATT
TTATTTAGTCAAGCTCAGATTTATGAACTTGAGCGTCGATTTAAACAACA
AAAGTATTTGTCTGCTCCAGAAAGAGAACATTTAGCTAATTTAATAAATT
TAACTCCCACTCAGGTAAAGATTTGGTTTCAAAATCATCGTTATAAATGT
AAAAGATCTCAAAAGGATAAAGAAAAAGAGCAACTAAAAGAAAAATCATC
ATGTCATTTAAAAAAAAATATTGAAGGTAAAGAAAGATCACCCGGTAAAC
TTGCATGCAATGCATCTAGTTCCCCAGATAGAAGCACTCCCGAGGAAACA
TCAAAAGTCAAAGAAACTGGACTCAATTTTAGTAATCACAAAATTGATGG
CCTTAATTTAAAAACTGAAGCCGACAATGAACCGAAATCGTCCTTTTACT
CTATAATACCTCCCTATTTAACCCATTCCTATTCACATCAAAGCCTAACG
GATACTCAAGCTTCTCCTATAATTAATAGTGTGCTTAGTTCAAATCTTTT
CCCGGACAGAAAATCTCCCCCGGCAATGGGGCCTCTGAGTAGTTATTCAT
TCGGACAATCTATGGATTCGATTTCCAGTTTTTATTCACCGGACTTTTCC
CTGTATAATTGCGCCCATCCGTACATGTCAGCTGCTGGTTCGTCCTATTT
CATGAATGCGGCTTCTAGGCCGTGGAATTAAAATTTTAAGTCAACTATGA
GAAATATTTAAATTTCATTTATTGTTAATTTTTGTGCAAATAGATTTGAT
TTCTGAATTTTCTTATTAGTTTTTTTAAAATCAAAAAAAG
back to top

protein sequence of SMED30022975-orf-1

>SMED30022975-orf-1 ID=SMED30022975-orf-1|Name=SMED30022975-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=365bp
MSGIPGLSGMSSMSPYSAYAALTQHTGVSSGSSPFGSQYCSSVNDFNPYG
DPRGTNSWYGTSSLSNSNSDPRMAMSRLMGTAAAAASGNMSVYAGIPSNF
HQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELER
RFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKRSQKDKEKEQL
KEKSSCHLKKNIEGKERSPGKLACNASSSPDRSTPEETSKVKETGLNFSN
HKIDGLNLKTEADNEPKSSFYSIIPPYLTHSYSHQSLTDTQASPIINSVL
SSNLFPDRKSPPAMGPLSSYSFGQSMDSISSFYSPDFSLYNCAHPYMSAA
GSSYFMNAASRPWN*
back to top
Aliases
The feature 'Homeobox protein DTH-2' has the following synonyms
Synonym
nkx2.4*
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000039gamma neoblast
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0003117parapharyngeal cell
PLANA:0007552nu neoblast
Vocabulary: INTERPRO
TermDefinition
IPR020479Homeobox_metazoa
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0007275multicellular organism development
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 183..203
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 128..209
e-value: 2.4E-24
score: 86.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 217..244
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 222..244
NoneNo IPR availablePANTHERPTHR24340:SF41SCARECROW, ISOFORM Acoord: 32..285
NoneNo IPR availablePANTHERPTHR24340FAMILY NOT NAMEDcoord: 32..285
IPR020479Homeobox domain, metazoaPRINTSPR00024HOMEOBOXcoord: 170..180
score: 57.42
coord: 155..166
score: 41.38
coord: 180..189
score: 69.65
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 133..195
e-value: 5.0E-25
score: 99.1
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 134..190
e-value: 1.2E-19
score: 69.9
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 131..191
score: 19.791
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 134..192
e-value: 1.53877E-24
score: 92.6916
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 166..189
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 119..193