slc17a-5

Overview
Nameslc17a-5 (AKN21528.1)
Smed IDSMED30022974
Length (bp)1674
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc17a-5 (SMED30022974) t-SNE clustered cells

Violin plots show distribution of expression levels for slc17a-5 (SMED30022974) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc17a-5 (SMED30022974) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc17a-5 (SMED30022974) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022974

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30022974h1SMcG0004929 dd_Smed_v4_4910_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022974h1SMcG0004929 dd_Smed_v4_4910_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022974h1SMcG0004929 dd_Smed_v4_4910_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022974h1SMcG0004929 dd_Smed_v4_4910_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022974h1SMcG0004929 Contig44487newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022974h1SMcG0004929 Contig44487uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
flame cellSMED30022974h1SMcG0004929 Smed-slc17a-5smed_ncbi_20240424PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
proximal tubuleSMED30022974h1SMcG0004929 Smed-slc17a-5smed_ncbi_20240424PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc17a-5 vs. Ensembl Human
Match: SLC17A5 (solute carrier family 17 member 5 [Source:HGNC Symbol;Acc:HGNC:10933])

HSP 1 Score: 315.849 bits (808), Expect = 4.514e-101
Identity = 173/485 (35.67%), Postives = 278/485 (57.32%), Query Frame = 1
Query:  103 EKYPLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVT--KTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMML-SSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNN 1548
            E  P+C S R  +A++ F G   +Y++R+NLSV +        VD++D+++ +  N ++    + S  +            W  +T+  ILG FF+GY++TQIP G +  +   K +L GF +L +++  +FTP+AA   VG +I LR + GL  GV FP+++ +WS WAPP +RS L+ ++ +G  +G  ++LP++G++C Y     W  +FY  G  GI W +LW +L+ DTP  H  IS  EK YI  SL  +++ S K+V     PW  I  S P WAI V +  ++W  YT +T  PTYMKE+L+FN+ +NGF+S+ PY+G  +  I      D L+ +   S   +R++ + +GM+ P + +V   ++ C+   LAV  LTI  +       G  +NH+DIAP YAG+L G+TNT     G        ++T +N V  W+ VF++ + I V GAIF+ +F  G++Q+WA+ + +   +
Sbjct:   30 EAAPVCCSARYNLAILAFFGFFIVYALRVNLSVAL--------VDMVDSNTTLEDNRTSKACPEHSAPIKVHHNQTGKKYQWDAETQGWILGSFFYGYIITQIPGGYVASKIGGK-MLLGFGILGTAVLTLFTPIAADLGVGPLIVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLSISYAGAQLGTVISLPLSGIICYY---MNWTYVFYFFGTIGIFWFLLWIWLVSDTPQKHKRISHYEKEYILSSLRNQLS-SQKSV-----PWVPILKSLPLWAIVVAHFSYNWTFYTLLTLLPTYMKEILRFNVQENGFLSSLPYLGSWLCMILSGQAADNLRAKWNFSTLCVRRIFSLIGMIGPAVFLVAAGFIGCDYS-LAVAFLTISTTLGGFCSSGFSINHLDIAPSYAGILLGITNTFATIPGMVGPVIAKSLTPDNTVGEWQTVFYIAAAINVFGAIFFTLFAKGEVQNWALNDHHGHRH 495          
BLAST of slc17a-5 vs. Ensembl Human
Match: SLC17A6 (solute carrier family 17 member 6 [Source:HGNC Symbol;Acc:HGNC:16703])

HSP 1 Score: 309.686 bits (792), Expect = 1.416e-97
Identity = 171/503 (34.00%), Postives = 267/503 (53.08%), Query Frame = 1
Query:   91 EELTEKYPLCN------SKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDKEKE 1581
            E    K PLC+       +R I+A++  +G    + IR NL V I+ M N++ +               V K        EKAK     W  +T  +I G FFWGY++TQIP G +  R +   +    ++L+S   M  P AAR   G +I +R++ GL  GV +P+ + +WS+WAPP +RS L   +  G + G  + +P+AG+L +Y    GW S+FY  G FG++W + W  + Y++P+ HPTI+D E+ YIE+S+ GE  +    +     PWR   TS P +AI V N    W  Y  + S P Y +EV  F +S+ G +SA P++ M I       + D L+ ++ILS T +RK+MNC G      +++++ Y       ++ ++L +G S  +    G  VNH+DIAP+YA +L G++N +G  +G      VGA+TKN     W+ VF + ++++  G IFY IF SG+ Q WA            +++D+  E
Sbjct:   51 EVPERKAPLCDCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIH----------RGGKVIK--------EKAK---FNWDPETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQY---TGWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERRYIEESI-GESANLLGAMEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHTRGVAISFLVLAVGFSGFA--ISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKNKSREEWQYVFLIAALVHYGGVIFYAIFASGEKQPWADPEETSEEKCGFIHEDELDE 526          
BLAST of slc17a-5 vs. Ensembl Human
Match: SLC17A7 (solute carrier family 17 member 7 [Source:HGNC Symbol;Acc:HGNC:16704])

HSP 1 Score: 300.827 bits (769), Expect = 1.704e-94
Identity = 165/483 (34.16%), Postives = 257/483 (53.21%), Query Frame = 1
Query:  127 KRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSV-MFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDK 1572
            +R I+A++  +G    + IR NL V I+ M N++       H  V K                        W  +T  +I G FFWGY+VTQIP G + Q+F+   + FGF ++++ ++ M  P AAR   G +I +R++ GL  GV +P+ + +WS+WAPP +RS L      G + G  + +P+AG+L +Y    GW S+FY  G FGI W + W  + Y++P+ HP+IS+ E+ YIE ++ GE       +     PWR   TS P +AI V N    W  Y  + S P Y +EV  F +S+ G VSA P++ M I       + D L+ R+I+S T +RKLMNC G      +++++ Y   +   ++ ++L +G S  +    G  VNH+DIAP+YA +L G++N +G  +G      VGA+TK+     W+ VF + S+++  G IFY +F SG+ Q WA            +  D+
Sbjct:   61 RRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTH-RGGHVVVQK--------------------AQFSWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRV-FGFAIVATSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQY---SGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAI-GESAKLMNPLTKFSTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRRIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFA--ISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQ 515          
BLAST of slc17a-5 vs. Ensembl Human
Match: SLC17A8 (solute carrier family 17 member 8 [Source:HGNC Symbol;Acc:HGNC:20151])

HSP 1 Score: 298.901 bits (764), Expect = 1.881e-93
Identity = 164/501 (32.73%), Postives = 266/501 (53.09%), Query Frame = 1
Query:  112 PLCN------SKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDL-----PWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDKEKE 1581
            PLC+       KR I+A++  +G    + IR NL V I+ M N++ V                      + G+ + +     W  +T  +I G FFWGY++TQIP G +  +F+   +    + L+S   MF P AAR   G ++ +R++ GL  GV +P+ + +WS+WAPP +RS L   +  G + G  + +P+AG+L +Y    GW S+FY  G+FGI+W + W    Y+ P+ HPTIS+ EK YIE S+        +  N+  L     PW+   TS P +AI V N    W  Y  + S P Y +EV  F +S+ G +SA P++ M I       L D L+ R+IL+ T +RK+MNC G      +++++ +   +   ++ ++L +G S  +    G  VNH+DIAP+YA +L G++N +G  +G      VGA+T++     W+ VF + ++++ +G IFY +F SG+ Q WA           ++++D+  E
Sbjct:   63 PLCDCHCCGLPKRYIIAIMSGLGFCISFGIRCNLGVAIVEMVNNSTV---------------------YVDGKPEIQTAQFNWDPETVGLIHGSFFWGYIMTQIPGGFISNKFAANRVFGAAIFLTSTLNMFIPSAARVHYGCVMCVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVLVQY---IGWSSVFYIYGMFGIIWYMFWLLQAYECPAAHPTISNEEKTYIETSI-------GEGANVVSLSKFSTPWKRFFTSLPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFAISKVGLLSAVPHMVMTIVVPIGGQLADYLRSRQILTTTAVRKIMNCGGFGMEATLLLVVGFSHTKGVAISFLVLAVGFSGFA--ISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTRHKTREEWQNVFLIAALVHYSGVIFYGVFASGEKQEWADPENLSEEKCGIIDQDELAE 530          
BLAST of slc17a-5 vs. Ensembl Human
Match: SLC17A7 (solute carrier family 17 member 7 [Source:HGNC Symbol;Acc:HGNC:16704])

HSP 1 Score: 295.049 bits (754), Expect = 3.924e-93
Identity = 161/467 (34.48%), Postives = 248/467 (53.10%), Query Frame = 1
Query:  175 YSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSV-MFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDK 1572
            + IR NL V I+ M N++       H  V K                        W  +T  +I G FFWGY+VTQIP G + Q+F+   + FGF ++++ ++ M  P AAR   G +I +R++ GL  GV +P+ + +WS+WAPP +RS L      G + G  + +P+AG+L +Y    GW S+FY  G FGI W + W  + Y++P+ HP+IS+ E+ YIE ++ GE       +     PWR   TS P +AI V N    W  Y  + S P Y +EV  F +S+ G VSA P++ M I       + D L+ R+I+S T +RKLMNC G      +++++ Y   +   ++ ++L +G S  +    G  VNH+DIAP+YA +L G++N +G  +G      VGA+TK+     W+ VF + S+++  G IFY +F SG+ Q WA            +  D+
Sbjct:   10 FGIRCNLGVAIVSMVNNSTTH-RGGHVVVQK--------------------AQFSWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRV-FGFAIVATSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQY---SGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAI-GESAKLMNPLTKFSTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRRIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFA--ISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQ 448          
BLAST of slc17a-5 vs. Ensembl Celegans
Match: slc-17.2 (Uncharacterized transporter slc-17.2 [Source:UniProtKB/Swiss-Prot;Acc:Q03567])

HSP 1 Score: 310.071 bits (793), Expect = 3.162e-99
Identity = 164/498 (32.93%), Postives = 262/498 (52.61%), Query Frame = 1
Query:   91 EELTEKYPLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDL-MDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDKEKE 1581
            E  T K  L  S R  ++L+ F G L  Y +R N+S  ++CM N    D  ++  S   K  + V   S  +        G+  W KQT  ++L  FF+GY+ +QI  G L  R+  K ++F  ++ S+L  +  P+AARTS   +  LR   G   G  FP+++ +WS W PP + S+L G+T +G  +GN + LP++G LCEYGF GGWPSIFY  G+FG+LW  +W ++  D P+ HP I+  EK YI  ++  E +       +   PW  I TS   WA    +   DW  YT + S P+++K+VL  N+S  G V++ PYI   +      +L D L+ + ILS    R+    + ++  G+ +V   Y  C    L ++ +T G++ +   + G  VN+++IAP ++G + G  NT+ A  G  S      +T N     W++V ++ + I   GA+ + IF SG++Q WA     + +  + L + ++ E
Sbjct:    2 EGATTKPRLVPSTRFALSLVMFFGCLVTYMMRTNMSFAVVCMVNENKTDTGVEKVSRCGKEMTPVESNSSVI--------GEFDWDKQTTGMVLSSFFYGYIGSQIIGGHLASRYGGKRVVFVTILGSALLTLLNPVAARTSEYALAILRAAIGFLQGATFPAMHTMWSVWGPPLELSVLTGVTYAGAQIGNVIVLPLSGFLCEYGFDGGWPSIFYIIGVFGVLWTAVWWYVSSDKPATHPRITPEEKQYIVTAV--EASMGKDTGKVPSTPWIKILTSPAVWACWAGHFAGDWGAYTMLVSLPSFLKDVLGLNLSSLGAVASIPYIAYFLAINAGGVLADTLRSKGILSTLNTRRAAMLVALIGQGIFLVASGYCGCGQDVLVIIFITCGMAISGLQYAGFVVNYLEIAPPFSGTVMGTGNTISALAGIISPAVSSYLTPNGTQEEWQMVLWLTAGILTIGALLFSIFASGEVQPWAKLTAEEGHEMAPLREGEKIE 489          
BLAST of slc17a-5 vs. Ensembl Celegans
Match: slc-17.1 (SLC (SoLute Carrier) homolog [Source:UniProtKB/TrEMBL;Acc:Q23514])

HSP 1 Score: 253.832 bits (647), Expect = 6.572e-78
Identity = 141/471 (29.94%), Postives = 236/471 (50.11%), Query Frame = 1
Query:  124 SKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTN 1536
             +R +VA++  +G  N+Y++R NLS+ I+ MT+ T                 V  T+  +LG+ +       W+  T+ ++L  FF+GY+V+Q+P G L      K I F     +++  + TP  AR   G ++  R + GL  GV +P+++ +WSRWAPP +++ L     SG + G  + +P++  L E+    GWP IF+  G  G++WC++W   ++D P D P IS  E   +++    +        N   +PW  I  SKP WA+ V +   +   Y  +T+ P  +K++  +N+ + G  S+ PY  MG   I    LCD L++ K      +RK+   LG +  G  V +   +   +  L V+  +I +      + G  VNH+D+APQYAG L   +NT     G F    VGA+ +N  +  W ++ ++    Y+ GA  +  F    LQ WA ++T+
Sbjct:   31 KRRHVVAILALLGFANIYAMRANLSIAIVEMTSGTE--------------RKVNGTTLHVLGDFEN------WTPMTQGVVLSSFFYGYIVSQLPGGYLAYTHGAKTIFFAGTFGTAVFTLLTPPFARMGYGMLVFARFMEGLLEGVTYPAMHVIWSRWAPPMEQTKLATFAFSGSYFGTVVAMPLSAYLGEH---FGWPMIFWFFGALGVIWCMVWYKTVHDRPEDDPKISTSELALLQRDAVSQ--------NHYIVPWAQILRSKPVWAVIVAHSAQNLGFYIMLTNLPKMLKDIAGYNVEKAGIASSLPYFLMGFQIITGGQLCDYLRRDKHYDTLFVRKMACALGFI--GQSVFLFLVMTTSNSLLLVLFFSISIGLGGICWCGFSVNHLDLAPQYAGHLMATSNTFATIPGIFGPLLVGAIVQNGTIGEWNVIMYIIISAYLLGAAIFWKFADATLQPWAAEHTS 468          
BLAST of slc17a-5 vs. Ensembl Celegans
Match: slc-17.1 (SLC (SoLute Carrier) homolog [Source:UniProtKB/TrEMBL;Acc:Q23514])

HSP 1 Score: 253.832 bits (647), Expect = 7.191e-78
Identity = 141/471 (29.94%), Postives = 236/471 (50.11%), Query Frame = 1
Query:  124 SKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTN 1536
             +R +VA++  +G  N+Y++R NLS+ I+ MT+ T                 V  T+  +LG+ +       W+  T+ ++L  FF+GY+V+Q+P G L      K I F     +++  + TP  AR   G ++  R + GL  GV +P+++ +WSRWAPP +++ L     SG + G  + +P++  L E+    GWP IF+  G  G++WC++W   ++D P D P IS  E   +++    +        N   +PW  I  SKP WA+ V +   +   Y  +T+ P  +K++  +N+ + G  S+ PY  MG   I    LCD L++ K      +RK+   LG +  G  V +   +   +  L V+  +I +      + G  VNH+D+APQYAG L   +NT     G F    VGA+ +N  +  W ++ ++    Y+ GA  +  F    LQ WA ++T+
Sbjct:   36 KRRHVVAILALLGFANIYAMRANLSIAIVEMTSGTE--------------RKVNGTTLHVLGDFEN------WTPMTQGVVLSSFFYGYIVSQLPGGYLAYTHGAKTIFFAGTFGTAVFTLLTPPFARMGYGMLVFARFMEGLLEGVTYPAMHVIWSRWAPPMEQTKLATFAFSGSYFGTVVAMPLSAYLGEH---FGWPMIFWFFGALGVIWCMVWYKTVHDRPEDDPKISTSELALLQRDAVSQ--------NHYIVPWAQILRSKPVWAVIVAHSAQNLGFYIMLTNLPKMLKDIAGYNVEKAGIASSLPYFLMGFQIITGGQLCDYLRRDKHYDTLFVRKMACALGFI--GQSVFLFLVMTTSNSLLLVLFFSISIGLGGICWCGFSVNHLDLAPQYAGHLMATSNTFATIPGIFGPLLVGAIVQNGTIGEWNVIMYIIISAYLLGAAIFWKFADATLQPWAAEHTS 473          
BLAST of slc17a-5 vs. Ensembl Celegans
Match: eat-4 (Probable vesicular glutamate transporter eat-4 [Source:UniProtKB/Swiss-Prot;Acc:P34644])

HSP 1 Score: 247.284 bits (630), Expect = 1.783e-74
Identity = 139/401 (34.66%), Postives = 221/401 (55.11%), Query Frame = 1
Query:  316 KAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMM-LSSLSVMFTPLAARTSVGFMIA-LRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQ 1512
            K    +  W+    S++   +F+GYLVTQIPAG L  +F P   LFGF + + +   +  P   +    +++A +++  GL  GV +P+++ +W  WAPP +RS L     +G + G  L LP++  L  Y     W + FY  G+ G++W ILW  + ++ P+ HPTIS  EK +IE ++ G +  SN +  I  +PW+AI TSKP WAI V N    W  Y  + +  TYMKE L   ++ +G ++A P++ MG   +    L D L+  KILS T +RK+ NC G       ++I+AY   ++  +  ++  +G+S  +    G  VNH+DIAP+YA +L G +N +G   G    +   A T ++  + W  VF + S+I+  G  FY ++ SG+LQ
Sbjct:   86 KVHMHEFNWTIDELSVMESSYFYGYLVTQIPAGFLAAKFPPN-KLFGFGIGVGAFLNILLPYGFKVKSDYLVAFIQITQGLVQGVCYPAMHGVWRYWAPPMERSKLATTAFTGSYAGAVLGLPLSAFLVSYV---SWAAPFYLYGVCGVIWAILWFCVTFEKPAFHPTISQEEKIFIEDAI-GHV--SNTHPTIRSIPWKAIVTSKPVWAIIVANFARSWTFYLLLQNQLTYMKEALGMKIADSGLLAAIPHLVMGCVVLMGGQLADYLRSNKILSTTAVRKIFNCGGFGGEAAFMLIVAYTTSDTTAIMALIAAVGMSGFA--ISGFNVNHLDIAPRYAAILMGFSNGIGTLAGLTCPFVTEAFTAHSK-HGWTSVFLLASLIHFTGVTFYAVYASGELQ 476          
BLAST of slc17a-5 vs. Ensembl Celegans
Match: eat-4 (Probable vesicular glutamate transporter eat-4 [Source:UniProtKB/Swiss-Prot;Acc:P34644])

HSP 1 Score: 246.899 bits (629), Expect = 3.181e-74
Identity = 139/401 (34.66%), Postives = 221/401 (55.11%), Query Frame = 1
Query:  316 KAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMM-LSSLSVMFTPLAARTSVGFMIA-LRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQ 1512
            K    +  W+    S++   +F+GYLVTQIPAG L  +F P   LFGF + + +   +  P   +    +++A +++  GL  GV +P+++ +W  WAPP +RS L     +G + G  L LP++  L  Y     W + FY  G+ G++W ILW  + ++ P+ HPTIS  EK +IE ++ G +  SN +  I  +PW+AI TSKP WAI V N    W  Y  + +  TYMKE L   ++ +G ++A P++ MG   +    L D L+  KILS T +RK+ NC G       ++I+AY   ++  +  ++  +G+S  +    G  VNH+DIAP+YA +L G +N +G   G    +   A T ++  + W  VF + S+I+  G  FY ++ SG+LQ
Sbjct:  107 KVHMHEFNWTIDELSVMESSYFYGYLVTQIPAGFLAAKFPPN-KLFGFGIGVGAFLNILLPYGFKVKSDYLVAFIQITQGLVQGVCYPAMHGVWRYWAPPMERSKLATTAFTGSYAGAVLGLPLSAFLVSYV---SWAAPFYLYGVCGVIWAILWFCVTFEKPAFHPTISQEEKIFIEDAI-GHV--SNTHPTIRSIPWKAIVTSKPVWAIIVANFARSWTFYLLLQNQLTYMKEALGMKIADSGLLAAIPHLVMGCVVLMGGQLADYLRSNKILSTTAVRKIFNCGGFGGEAAFMLIVAYTTSDTTAIMALIAAVGMSGFA--ISGFNVNHLDIAPRYAAILMGFSNGIGTLAGLTCPFVTEAFTAHSK-HGWTSVFLLASLIHFTGVTFYAVYASGELQ 497          
BLAST of slc17a-5 vs. Ensembl Fly
Match: Picot (gene:FBgn0024315 transcript:FBtr0087115)

HSP 1 Score: 303.138 bits (775), Expect = 5.317e-96
Identity = 164/495 (33.13%), Postives = 265/495 (53.54%), Query Frame = 1
Query:   82 TMKEELTEKYPLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCAL--LGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTS-VGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNND---VNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNN 1548
             + E L ++   C + R  V  + F+G  N Y +R N+SV I+ M NHTA+   +   +            C    +  + ++DG+  WS   +  IL  FF+GY++TQIP G+L +++     L   M+++S+     P+AAR   V  + A+R I GL  G   P  + + ++W PP +RS +     +G   G  +++P++GLL EYGF GGWPSIFY  G+ G +W I +   +++ PS HPTI + EK YI  SL G        V    +P++AI  S PF+AI   ++  ++   T +T  PTYMK+VL+F++  NG +S+ PY+ M +  +  +++ D +   K  S T  RKL+N +G   PG+ ++  +Y  C+ R L + +LTIG+     ++ G  +NH+D+ P++AG L  +TN      G  +    G +  +     +  W+IVFF+ + +Y+    FY IFGSG+ Q W   N  D   
Sbjct:   24 NLHESLEQQPQRCFATRYFVTFMLFLGMANAYVMRTNMSVAIVAMVNHTAIKSGEAEEY---------DDECGDRDIPIDDSQDGEFAWSSALQGYILSSFFYGYVITQIPFGILAKKYGSLRFLGYGMLINSVFAFLVPVAARGGGVWGLCAVRFIQGLGEGPIVPCTHAMLAKWIPPNERSRMGAAVYAGAQFGTIISMPLSGLLAEYGFDGGWPSIFYVFGIVGTVWSIAFLIFVHEDPSSHPTIDEREKKYINDSLWG-----TDVVKSPPIPFKAIIKSLPFYAILFAHMGHNYGYETLMTELPTYMKQVLRFSLKSNGLLSSLPYLAMWLFSMFISVVADWMISSKRFSHTATRKLINSIGQYGPGVALIAASYTGCD-RALTLAILTIGVGLNGGIYSGFKINHLDLTPRFAGFLMSITNCSANLAGLLAPIAAGHLISDPSKPMMGQWQIVFFIAAFVYIICGTFYNIFGSGERQYW--DNPEDDEQ 501          
BLAST of slc17a-5 vs. Ensembl Fly
Match: CG6978 (gene:FBgn0029727 transcript:FBtr0070715)

HSP 1 Score: 300.056 bits (767), Expect = 1.609e-95
Identity = 170/484 (35.12%), Postives = 266/484 (54.96%), Query Frame = 1
Query:   88 KEELTEKY------PLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTS--VGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTK-NNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQ 1512
            +E   E+Y      P C   R  V L+ F G  N Y +R N+SV I+ M NHTA+                TK+S     + K +DGD  WS + +  IL  FF+GY++TQIP G++++ +  +  L   MM++SL+  F P++AR+   VG  + +R I GL  G   P  + L ++W PP +RSL      +G   G  +++P++GLL  YGF GGWPSIFY  GLF  +WCI++  L+ ++P+    IS+ E+ +I +++     +    +     P+  IA S PF+AI V +   ++   T +T  PTYM  VL  N+  NG +S+ PY+ M I  I F IL D L +R   S+T +RKLMN LG   P + ++ + ++   S +L  V+  +G+    A++ G  +NH+D++P++AGLL  +TN +    G  +    G V      V +WRIVF++ + +++  A FY +F SGK Q
Sbjct:   21 QEVRMERYASDGQIPRCRKTRFFVVLMLFSGMANAYVMRTNMSVAIVAMVNHTAISH--------------TKSST----QSKERDGDFEWSYKLQGYILSSFFYGYVITQIPFGLMIKYYGARHFLGWGMMINSLAAFFIPISARSGGVVGLCV-VRFIQGLGEGPIVPCSHSLLAQWVPPNERSLAGAAVYAGAQFGTIVSMPLSGLLAHYGFDGGWPSIFYIFGLFSTIWCIIFICLVQESPAVSTRISEAERRHIMEAIWQAQPEERSRI-----PFLGIAKSPPFYAILVAHAGHNYGYETLMTMLPTYMYRVLNVNIRTNGIISSLPYLAMWILAIVFGILADCLIRRN-FSITVVRKLMNSLGQYGPAVALISVGFVH-HSLWLTSVIFILGMGLNGAIYCGFKINHLDLSPRFAGLLISVTNCVANLVGLMAPMVAGHVIDPKPSVENWRIVFYIAAGVFIFTASFYNVFASGKQQ 478          
BLAST of slc17a-5 vs. Ensembl Fly
Match: MFS10 (gene:FBgn0030452 transcript:FBtr0339677)

HSP 1 Score: 301.597 bits (771), Expect = 3.731e-95
Identity = 161/508 (31.69%), Postives = 276/508 (54.33%), Query Frame = 1
Query:   70 KTMITMKEELTEKYPLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEK-------AKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSL----------------CGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNND-VNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWA 1521
            + +I       E +      R I   +GF+G   +Y++R+NLSV I+ M N TA+     HS    N S +   +C L             K+G+ VW + T+ ++LG FF+GY++TQ+P G + + +  K I    ++++++  + TPLAA   +  ++ +R++ G+  GV +P+++ + + W PP +R+    +  +G ++G  +++P+AG LC   F GGWPS FY  GL GILW I W +L+YD PSDHP IS+ E+ YIE+SL                 G+   S +      +PW ++ TS P WAI +      W  YT +T  PTYM  +L F++  N  ++A PY+      I  + L D +  R+ +S+    KL N +  + P L ++ + Y+ C+  ++  +L  +G S   A++ G  +NH+ ++P+YAG ++G+TN+     GF + Y +G +  + + +  W +VF++ + + +AG   YLIF S + QSW+
Sbjct:   48 RPLIRSSGAAEENHGCGPKTRHIFGFMGFLGFAVVYAMRVNLSVAIVAMVNQTAIP----HS----NSSVIDTDTCPLPAPHHNGSDPNPQKEGEFVWDEATQGLVLGSFFYGYVLTQVPGGRMAELYGGKKIYGYGVLITAVFTLITPLAAHWDLPLLVLVRILEGMGEGVTYPAMHAMLAHWIPPLERNKFAAIVYAGSNIGTVISMPLAGWLCSLDFLGGWPSAFYIFGLLGILWFIAWMYLVYDKPSDHPRISESEREYIERSLQVQRLINQDLAEAEEEEGQDEVSLRAPPEEPIPWSSLLTSVPLWAILLTQCGQGWAFYTQLTELPTYMSNILHFDIQSNALLNAVPYLTSWFVGIACSALADWMLARRYISLLNSYKLWNTVASVVPSLGLIGIIYVGCDWVWVTFMLAGVG-SFGGAVYAGNQMNHIALSPRYAGTMYGITNSAANICGFLAPYVIGLIINHRETLTQWHLVFWLAAGLNIAGNFIYLIFASAEEQSWS 546          
BLAST of slc17a-5 vs. Ensembl Fly
Match: MFS10 (gene:FBgn0030452 transcript:FBtr0073724)

HSP 1 Score: 301.597 bits (771), Expect = 3.731e-95
Identity = 161/508 (31.69%), Postives = 276/508 (54.33%), Query Frame = 1
Query:   70 KTMITMKEELTEKYPLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEK-------AKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSL----------------CGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNND-VNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWA 1521
            + +I       E +      R I   +GF+G   +Y++R+NLSV I+ M N TA+     HS    N S +   +C L             K+G+ VW + T+ ++LG FF+GY++TQ+P G + + +  K I    ++++++  + TPLAA   +  ++ +R++ G+  GV +P+++ + + W PP +R+    +  +G ++G  +++P+AG LC   F GGWPS FY  GL GILW I W +L+YD PSDHP IS+ E+ YIE+SL                 G+   S +      +PW ++ TS P WAI +      W  YT +T  PTYM  +L F++  N  ++A PY+      I  + L D +  R+ +S+    KL N +  + P L ++ + Y+ C+  ++  +L  +G S   A++ G  +NH+ ++P+YAG ++G+TN+     GF + Y +G +  + + +  W +VF++ + + +AG   YLIF S + QSW+
Sbjct:   48 RPLIRSSGAAEENHGCGPKTRHIFGFMGFLGFAVVYAMRVNLSVAIVAMVNQTAIP----HS----NSSVIDTDTCPLPAPHHNGSDPNPQKEGEFVWDEATQGLVLGSFFYGYVLTQVPGGRMAELYGGKKIYGYGVLITAVFTLITPLAAHWDLPLLVLVRILEGMGEGVTYPAMHAMLAHWIPPLERNKFAAIVYAGSNIGTVISMPLAGWLCSLDFLGGWPSAFYIFGLLGILWFIAWMYLVYDKPSDHPRISESEREYIERSLQVQRLINQDLAEAEEEEGQDEVSLRAPPEEPIPWSSLLTSVPLWAILLTQCGQGWAFYTQLTELPTYMSNILHFDIQSNALLNAVPYLTSWFVGIACSALADWMLARRYISLLNSYKLWNTVASVVPSLGLIGIIYVGCDWVWVTFMLAGVG-SFGGAVYAGNQMNHIALSPRYAGTMYGITNSAANICGFLAPYVIGLIINHRETLTQWHLVFWLAAGLNIAGNFIYLIFASAEEQSWS 546          
BLAST of slc17a-5 vs. Ensembl Fly
Match: MFS10 (gene:FBgn0030452 transcript:FBtr0339678)

HSP 1 Score: 301.597 bits (771), Expect = 3.731e-95
Identity = 161/508 (31.69%), Postives = 276/508 (54.33%), Query Frame = 1
Query:   70 KTMITMKEELTEKYPLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEK-------AKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSL----------------CGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNND-VNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWA 1521
            + +I       E +      R I   +GF+G   +Y++R+NLSV I+ M N TA+     HS    N S +   +C L             K+G+ VW + T+ ++LG FF+GY++TQ+P G + + +  K I    ++++++  + TPLAA   +  ++ +R++ G+  GV +P+++ + + W PP +R+    +  +G ++G  +++P+AG LC   F GGWPS FY  GL GILW I W +L+YD PSDHP IS+ E+ YIE+SL                 G+   S +      +PW ++ TS P WAI +      W  YT +T  PTYM  +L F++  N  ++A PY+      I  + L D +  R+ +S+    KL N +  + P L ++ + Y+ C+  ++  +L  +G S   A++ G  +NH+ ++P+YAG ++G+TN+     GF + Y +G +  + + +  W +VF++ + + +AG   YLIF S + QSW+
Sbjct:   48 RPLIRSSGAAEENHGCGPKTRHIFGFMGFLGFAVVYAMRVNLSVAIVAMVNQTAIP----HS----NSSVIDTDTCPLPAPHHNGSDPNPQKEGEFVWDEATQGLVLGSFFYGYVLTQVPGGRMAELYGGKKIYGYGVLITAVFTLITPLAAHWDLPLLVLVRILEGMGEGVTYPAMHAMLAHWIPPLERNKFAAIVYAGSNIGTVISMPLAGWLCSLDFLGGWPSAFYIFGLLGILWFIAWMYLVYDKPSDHPRISESEREYIERSLQVQRLINQDLAEAEEEEGQDEVSLRAPPEEPIPWSSLLTSVPLWAILLTQCGQGWAFYTQLTELPTYMSNILHFDIQSNALLNAVPYLTSWFVGIACSALADWMLARRYISLLNSYKLWNTVASVVPSLGLIGIIYVGCDWVWVTFMLAGVG-SFGGAVYAGNQMNHIALSPRYAGTMYGITNSAANICGFLAPYVIGLIINHRETLTQWHLVFWLAAGLNIAGNFIYLIFASAEEQSWS 546          
BLAST of slc17a-5 vs. Ensembl Zebrafish
Match: slc17a5 (solute carrier family 17 member 5 [Source:ZFIN;Acc:ZDB-GENE-060929-1158])

HSP 1 Score: 311.227 bits (796), Expect = 1.643e-99
Identity = 166/481 (34.51%), Postives = 268/481 (55.72%), Query Frame = 1
Query:   94 ELTEKYPLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTN 1536
            E  +K P C S R  +A +   G    Y++R+NLSV ++ M  +++     +    P N         A++ +         W+ +T+  ILG FF+GY++TQIP G L +++  KW+L   ++ + +  + TPLAA    G++IA+RV+ G+  GV +P+++ +W+ WAPP +RS L+ ++ +G  +G  + LP++G +C   F   W  +FY  G  G+LW  LW   + ++PS H  I++ EK YI  SL  E++ +   +     PW +I  S P WAI V +  ++W  YT +T  PTYM +VL F++ QNG +SA PY+G  +  +    L D+L++R +     +RK    +GM  P + +V   Y  C +  LAV  LTI  S       G  +NH+DIAP YAG+L G+TN+     G        ++TK+N +  W+IVF++ + I + GA+F+ IFG G +Q WA+Q  +
Sbjct:   25 EDIQKAPACGSSRYGLAFLSCYGFFVAYALRVNLSVAMVDMLKNSSKANTSSSICPPHNIPVPKHNHTAMVYD---------WNSETQGWILGSFFYGYIITQIPGGYLARKYGAKWLLGLGILCTVIFTLLTPLAADLGAGYLIAVRVLEGIGEGVTYPAMHAMWASWAPPLERSRLLTISYTGAQLGTVVALPLSGQIC---FYLDWTYVFYIFGAVGLLWFFLWICFVSNSPSSHKRITEAEKTYIMSSLKNELSPTQDYI-----PWTSIFKSMPLWAIVVAHFSYNWTFYTLLTLLPTYMNDVLGFSIQQNGMLSALPYLGCWLLALLGGQLADLLRERFLFRTVIVRKAFTVVGMAGPAVFLVAAGYTGC-NYILAVAFLTISSSLGGISASGFNINHLDIAPSYAGILLGITNSFATIPGMVGPVIARSLTKSNTIPEWQIVFYISAAINIFGAVFFTIFGKGTVQPWAVQTIH 487          
BLAST of slc17a-5 vs. Ensembl Zebrafish
Match: slc17a8 (solute carrier family 17 member 8 [Source:NCBI gene;Acc:563467])

HSP 1 Score: 313.153 bits (801), Expect = 4.909e-99
Identity = 170/482 (35.27%), Postives = 261/482 (54.15%), Query Frame = 1
Query:  127 KRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDK 1572
            KR I+A++  +G    + IR NL V I+ M N+  V +       P  F+                     W  +T  +I G FFWGY+VTQIP G +  + +   +    + L+S+  MF P AAR   G ++ +R++ GL  GV +P+ + +WS+WAPP +RS L   +  G + G  + +P+AG+L +Y    GWPS+FY  G+FGI+W I W  L Y++P+ HPTIS+ E+NYIE S+ GE  +   +      PWR   TS P +AI V N    W  Y  + S P Y +EV  F +S+ G +SA P++ M I       L D L+ RKILS T +RK+MNC G      +++++ +    +  ++ ++L +G S  +    G  VNH+DIAP+YA +L G++N +G  +G      VGA+TK+     W+ VF + S+++  G IFY IF SG+ Q WA           ++ +D+
Sbjct:   74 KRYIIAMLSGLGFCISFGIRCNLGVAIVEMVNNNTVYINGTAVMQPAQFN---------------------WDPETVGLIHGSFFWGYIVTQIPGGFISNKLAANRVFGAAIFLTSVLNMFIPSAARVHYGCVMFVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQY---VGWPSVFYIYGVFGIIWYIFWILLAYNSPAVHPTISEEERNYIETSI-GEGANLMSSTEKFKTPWREFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFPISKVGILSAVPHMVMTIIVPIGGQLADFLRSRKILSTTTVRKIMNCGGFGMEATLLLVVGFSHTRAVAISFLILAVGFSGFA--ISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGALTKHKTRLEWQHVFVIASMVHYTGVIFYAIFASGEKQDWADPENTSDEKCGIIGEDE 528          
BLAST of slc17a-5 vs. Ensembl Zebrafish
Match: slc17a8 (solute carrier family 17 member 8 [Source:NCBI gene;Acc:563467])

HSP 1 Score: 312.768 bits (800), Expect = 6.616e-99
Identity = 170/482 (35.27%), Postives = 261/482 (54.15%), Query Frame = 1
Query:  127 KRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDK 1572
            KR I+A++  +G    + IR NL V I+ M N+  V +       P  F+                     W  +T  +I G FFWGY+VTQIP G +  + +   +    + L+S+  MF P AAR   G ++ +R++ GL  GV +P+ + +WS+WAPP +RS L   +  G + G  + +P+AG+L +Y    GWPS+FY  G+FGI+W I W  L Y++P+ HPTIS+ E+NYIE S+ GE  +   +      PWR   TS P +AI V N    W  Y  + S P Y +EV  F +S+ G +SA P++ M I       L D L+ RKILS T +RK+MNC G      +++++ +    +  ++ ++L +G S  +    G  VNH+DIAP+YA +L G++N +G  +G      VGA+TK+     W+ VF + S+++  G IFY IF SG+ Q WA           ++ +D+
Sbjct:   74 KRYIIAMLSGLGFCISFGIRCNLGVAIVEMVNNNTVYINGTAVMQPAQFN---------------------WDPETVGLIHGSFFWGYIVTQIPGGFISNKLAANRVFGAAIFLTSVLNMFIPSAARVHYGCVMFVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQY---VGWPSVFYIYGVFGIIWYIFWILLAYNSPAVHPTISEEERNYIETSI-GEGANLMSSTEKFKTPWREFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFPISKVGILSAVPHMVMTIIVPIGGQLADFLRSRKILSTTTVRKIMNCGGFGMEATLLLVVGFSHTRAVAISFLILAVGFSGFA--ISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGALTKHKTRLEWQHVFVIASMVHYTGVIFYAIFASGEKQDWADPENTSDEKCGIIGEDE 528          
BLAST of slc17a-5 vs. Ensembl Zebrafish
Match: slc17a6b (solute carrier family 17 member 6b [Source:NCBI gene;Acc:100149756])

HSP 1 Score: 310.071 bits (793), Expect = 5.944e-98
Identity = 177/502 (35.26%), Postives = 269/502 (53.59%), Query Frame = 1
Query:  103 EKYPLCN------SKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICD---LPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDKEKE 1581
             K PLC+       +R I+A++  +G    + IR NL V I+ M N++ + L  N   + K               EKAK     W  +T  +I G FFWGY+VTQIP G +  R +   +    ++L+S   MF P AAR   G +I +R++ GL  GV +P+ + +WS+WAPP +RS L   +  G + G  + +P+AG+L +Y    GW S+FY  G FGI W + W  + Y++P++HPTI+  E+ YIE+S    I +S K +   D    PWR   TS P +AI V N    W  Y  + S P Y +EV  F +S+ G +SA P++ M I       L D L+ + ILS T +RK+MNC G      +++I+ Y   +   ++ ++L +G S  +    G  VNH+DIAP+YA +L G++N +G  +G      VGA+TK+     W+ VF + S+++  G IFY IF SG+ Q WA            +++D+  E
Sbjct:   54 RKAPLCDCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTIHL--NGKIIIK---------------EKAK---FNWDPETVGLIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAILLTSTLNMFIPSAARGHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQY---TGWSSVFYVYGCFGIFWYMFWILVSYESPAEHPTITAEERCYIEES----IGESAKLLGPADKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSALPHLVMTIIVPIGGQLADHLRSKNILSTTTVRKIMNCGGFGMEATLLLIVGYSHSKGVAISFLVLAVGFSGFA--ISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGIFASGEKQPWADPELTSDEKCGFIDEDELAE 526          
BLAST of slc17a-5 vs. Ensembl Zebrafish
Match: slc17a6a (solute carrier family 17 member 6a [Source:NCBI gene;Acc:494492])

HSP 1 Score: 308.916 bits (790), Expect = 1.809e-97
Identity = 171/499 (34.27%), Postives = 268/499 (53.71%), Query Frame = 1
Query:  103 EKYPLCN------SKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDKEKE 1581
            +K PL +       +R I+A++  +G    + IR NL V I+ M N++ +                      ++ +EKAK     W  +T  +I G FFWGY+VTQIP G +  R +   +    ++L+S   MF P AAR   G ++ +R++ GL  GV +P+ + +WS+WAPP +RS L   +  G + G  + +P+AG+L +Y    GW S+FY  G FGI+W + W  + Y++P+DHPTI+D E+ YIE+S+ GE       +     PWR   TS P +AI V N    W  Y  + S P Y +EV  F +S+ G VSA P++ M I       L D L+ + IL+ T +RK+MNC G      +++++ +   +   ++ ++L +G S  +    G  VNH+DIAP+YA +L G++N +G  +G      VGA+TKN     W+ VF + S+++  G IFY IF SG+ Q WA            +++D+  E
Sbjct:   55 KKAPLVDCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTI-----------------HKGGKIIIKEKAK---FNWDPETVGMIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAILLTSTLNMFIPSAARVHYGCVMFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGILVQY---SGWSSVFYIYGSFGIVWYMFWILVSYESPADHPTITDEERTYIEESI-GESAKLLGAMEKYKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMVSALPHLVMTIIVPIGGQLADYLRSKNILTTTTVRKIMNCGGFGMEATLLLVVGFSHSKGVAISFLVLAVGFSGFA--ISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKNKTREEWQNVFLIASLVHYGGVIFYGIFASGEKQPWADPEETSDEKCGFIDEDELAE 527          
BLAST of slc17a-5 vs. Ensembl Xenopus
Match: nbeal2 (neurobeachin like 2 [Source:Xenbase;Acc:XB-GENE-6038810])

HSP 1 Score: 318.931 bits (816), Expect = 3.181e-102
Identity = 183/482 (37.97%), Postives = 282/482 (58.51%), Query Frame = 1
Query:  106 KYPLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMML-SSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNN 1548
            K P+C S R  +AL+  +G   LY++R+NLSV ++ M N T+    +  +    N      ++ A+L     +  D  W   T+  ILG FF+GY++TQIP G +  +   K +L GF +L +++  + TPLAA    G +IA+R + GL  GV FP+++ +W+RWAPP +RS L+ L+ +G  +G  ++LP++GL+C Y     W  +FY  G  G+LW I+W FL+ DTP  H +I+D EK YI  +L  +++   K+V  C     A+  S P WAI V +  ++W  YT +T  PTYMKE+L+FN  +NGF+SA PY+G  +  I   ++ D L+++  +S   +RK+ N LGML P + ++   Y  C    LAVV LT+  +       G  +NH+DIAP +AGLL G+TNT     G        A+T +N V  W+IVF++ + I   GAIF++IF SG +Q WA+ +  + ++
Sbjct:   32 KVPVCCSARYNLALMALLGFFMLYALRVNLSVALVDMVNSTSTPRENTTA----NICPDHTSAPAVLHNSTGQKYD--WDANTQGWILGSFFYGYILTQIPGGYVAGKIGGKQLL-GFGILGTAVFTLLTPLAADFGAGCLIAVRALEGLGEGVTFPAMHAMWARWAPPLERSRLLSLSYAGAQLGTVVSLPVSGLICYY---MDWIYVFYIFGTLGVLWFIMWCFLVSDTPQSHRSITDSEKEYILYTLQNQLS-YRKSVPCC-----AMMKSLPLWAIIVAHFSYNWTFYTLLTLLPTYMKEILRFNAQENGFLSALPYLGCWVFMIMAGVIADCLREKLNISTKVVRKIFNTLGMLGPAIFLLAAGYTGCNYS-LAVVFLTLSTTLGGFSVAGYGINHLDIAPSFAGLLLGITNTFATIPGMVGPVIAKALTHDNTVEQWQIVFYIAAAINFFGAIFFIIFASGNVQDWAVDHNTEEDS 496          
BLAST of slc17a-5 vs. Ensembl Xenopus
Match: lrpap1 (LDL receptor related protein associated protein 1 [Source:Xenbase;Acc:XB-GENE-946427])

HSP 1 Score: 311.612 bits (797), Expect = 6.250e-99
Identity = 172/503 (34.19%), Postives = 271/503 (53.88%), Query Frame = 1
Query:   91 EELTEKYPLCN------SKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDKEKE 1581
            E   +K PLC+       +R I+A++  +G    + IR NL V I+ M N++ +    +H                 + +EKAK     W  +   +I G FFWGY+VTQIP G +  R +   +    ++L+S   M  P AAR   G +I +R++ GL  GV +P+ + +WS+WAPP +RS L   +  G + G  + +P+AG+L +Y    GW S+FY  G FG++W + W  + Y++P+ HPTI+D E+NYIE+S+ GE  +    V     PWR   TS P +AI V N    W  Y  + S P Y +EV  F +S+ G +SA P++ M I       + D L+ ++ILS T +RK+MNC G      +++++ Y   +   ++ ++L +G S  +    G  VNH+DIAP+YA +L G++N +G  +G      VGA+TK+     W+ VF + ++++  G IFY IF SG+ Q WA            +N+D+  E
Sbjct:   38 EVAEKKPPLCDCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTI----HHG--------------GKIIKEKAK---FNWDPEIVGMIHGSFFWGYIVTQIPGGYIASRLAANRVFGAAIVLTSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQY---TGWSSVFYVYGCFGLVWYLFWILVSYESPAKHPTITDEERNYIEESI-GESANILGPVEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFA--ISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKSREEWQYVFLIAALVHYGGVIFYGIFASGEKQPWADPEQTSDEKCGFINEDELAE 513          
BLAST of slc17a-5 vs. Ensembl Xenopus
Match: lrpap1 (LDL receptor related protein associated protein 1 [Source:Xenbase;Acc:XB-GENE-946427])

HSP 1 Score: 312.383 bits (799), Expect = 9.422e-99
Identity = 179/529 (33.84%), Postives = 279/529 (52.74%), Query Frame = 1
Query:   43 KFHHNY*L*KTMITMKEELTE----------KYPLCN------SKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDKEKE 1581
            K+H N+   K       ELTE          K PLC+       +R I+A++  +G    + IR NL V I+ M N++ +    +H                 + +EKAK     W  +   +I G FFWGY+VTQIP G +  R +   +    ++L+S   M  P AAR   G +I +R++ GL  GV +P+ + +WS+WAPP +RS L   +  G + G  + +P+AG+L +Y    GW S+FY  G FG++W + W  + Y++P+ HPTI+D E+NYIE+S+ GE  +    V     PWR   TS P +AI V N    W  Y  + S P Y +EV  F +S+ G +SA P++ M I       + D L+ ++ILS T +RK+MNC G      +++++ Y   +   ++ ++L +G S  +    G  VNH+DIAP+YA +L G++N +G  +G      VGA+TK+     W+ VF + ++++  G IFY IF SG+ Q WA            +N+D+  E
Sbjct:   22 KYHWNFLEKKNKTGENIELTEDGKPVEVAEKKPPLCDCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTI----HHG--------------GKIIKEKAK---FNWDPEIVGMIHGSFFWGYIVTQIPGGYIASRLAANRVFGAAIVLTSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQY---TGWSSVFYVYGCFGLVWYLFWILVSYESPAKHPTITDEERNYIEESI-GESANILGPVEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFA--ISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKSREEWQYVFLIAALVHYGGVIFYGIFASGEKQPWADPEQTSDEKCGFINEDELAE 523          
BLAST of slc17a-5 vs. Ensembl Xenopus
Match: lrpap1 (LDL receptor related protein associated protein 1 [Source:Xenbase;Acc:XB-GENE-946427])

HSP 1 Score: 310.842 bits (795), Expect = 1.798e-98
Identity = 172/503 (34.19%), Postives = 271/503 (53.88%), Query Frame = 1
Query:   91 EELTEKYPLCN------SKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDKEKE 1581
            E   +K PLC+       +R I+A++  +G    + IR NL V I+ M N++ +    +H                 + +EKAK     W  +   +I G FFWGY+VTQIP G +  R +   +    ++L+S   M  P AAR   G +I +R++ GL  GV +P+ + +WS+WAPP +RS L   +  G + G  + +P+AG+L +Y    GW S+FY  G FG++W + W  + Y++P+ HPTI+D E+NYIE+S+ GE  +    V     PWR   TS P +AI V N    W  Y  + S P Y +EV  F +S+ G +SA P++ M I       + D L+ ++ILS T +RK+MNC G      +++++ Y   +   ++ ++L +G S  +    G  VNH+DIAP+YA +L G++N +G  +G      VGA+TK+     W+ VF + ++++  G IFY IF SG+ Q WA            +N+D+  E
Sbjct:   25 EVAEKKPPLCDCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTI----HHG--------------GKIIKEKAK---FNWDPEIVGMIHGSFFWGYIVTQIPGGYIASRLAANRVFGAAIVLTSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQY---TGWSSVFYVYGCFGLVWYLFWILVSYESPAKHPTITDEERNYIEESI-GESANILGPVEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFA--ISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKSREEWQYVFLIAALVHYGGVIFYGIFASGEKQPWADPEQTSDEKCGFINEDELAE 500          
BLAST of slc17a-5 vs. Ensembl Xenopus
Match: lrpap1 (LDL receptor related protein associated protein 1 [Source:Xenbase;Acc:XB-GENE-946427])

HSP 1 Score: 311.227 bits (796), Expect = 2.058e-98
Identity = 172/503 (34.19%), Postives = 271/503 (53.88%), Query Frame = 1
Query:   91 EELTEKYPLCN------SKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDKEKE 1581
            E   +K PLC+       +R I+A++  +G    + IR NL V I+ M N++ +    +H                 + +EKAK     W  +   +I G FFWGY+VTQIP G +  R +   +    ++L+S   M  P AAR   G +I +R++ GL  GV +P+ + +WS+WAPP +RS L   +  G + G  + +P+AG+L +Y    GW S+FY  G FG++W + W  + Y++P+ HPTI+D E+NYIE+S+ GE  +    V     PWR   TS P +AI V N    W  Y  + S P Y +EV  F +S+ G +SA P++ M I       + D L+ ++ILS T +RK+MNC G      +++++ Y   +   ++ ++L +G S  +    G  VNH+DIAP+YA +L G++N +G  +G      VGA+TK+     W+ VF + ++++  G IFY IF SG+ Q WA            +N+D+  E
Sbjct:   39 EVAEKKPPLCDCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTI----HHG--------------GKIIKEKAK---FNWDPEIVGMIHGSFFWGYIVTQIPGGYIASRLAANRVFGAAIVLTSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQY---TGWSSVFYVYGCFGLVWYLFWILVSYESPAKHPTITDEERNYIEESI-GESANILGPVEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFA--ISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKSREEWQYVFLIAALVHYGGVIFYGIFASGEKQPWADPEQTSDEKCGFINEDELAE 514          
BLAST of slc17a-5 vs. Ensembl Mouse
Match: Slc17a5 (solute carrier family 17 (anion/sugar transporter), member 5 [Source:MGI Symbol;Acc:MGI:1924105])

HSP 1 Score: 319.701 bits (818), Expect = 8.448e-103
Identity = 177/485 (36.49%), Postives = 278/485 (57.32%), Query Frame = 1
Query:  100 TEKYPLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSN--VTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNN 1548
            TE  P+C S R  +A++ F G   LY++R+NLSV +        VD++D+++ +  N ++    + S  +            W  +T+  ILG FF+GY+VTQIP G +  R   K +L   ++ +S+  +FTPLAA   V  ++ LR + GL  GV FP+++ +WS WAPP +RS L+ ++ +G  +G  ++LP++G++C Y     W  +FY  G+ GI+W ILW +++ DTP  H TIS  EK YI  SL  +++ S K V     PW +I  S P WAI V +  ++W+ YT +T  PTYMKE+L+FN+ +NGF+SA PY G  +  I      D L+ +   S   +R++ + +GM+ P + +V   ++ C+   LAV  LTI  +       G  +NH+DIAP YAG+L G+TNT     G        ++T +N +  W+ VF + + I V GAIF+ +F  G++QSWA+ + +   N
Sbjct:   29 TEAAPVCCSARYNLAILAFCGFFVLYALRVNLSVAL--------VDMVDSNTTLTDNRTSKECAEHSAPIKVHHNHTGKKYKWDAETQGWILGSFFYGYIVTQIPGGYIASRVGGKLLLGLGILGTSVFTLFTPLAADLGVVTLVVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLTISYAGAQLGTVISLPLSGIICYY---MNWTYVFYLFGIVGIVWFILWMWIVSDTPETHKTISHYEKEYIVSSLKNQLS-SQKVV-----PWGSILKSLPLWAIVVAHFSYNWSFYTLLTLLPTYMKEILRFNVQENGFLSALPYFGCWLCMILCGQAADYLRVKWNFSTISVRRIFSLVGMVGPAVFLVAAGFIGCDYS-LAVAFLTISTTLGGFASSGFSINHLDIAPSYAGILLGITNTFATIPGMTGPIIAKSLTPDNTIREWQTVFCIAAAINVFGAIFFTLFAKGEVQSWALSDHHGHRN 495          
BLAST of slc17a-5 vs. Ensembl Mouse
Match: Slc17a7 (solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 7 [Source:MGI Symbol;Acc:MGI:1920211])

HSP 1 Score: 310.071 bits (793), Expect = 6.449e-98
Identity = 173/498 (34.74%), Postives = 269/498 (54.02%), Query Frame = 1
Query:  127 KRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCAL--LGEEKAKDGDLV---WSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSV-MFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDK-----EKEAE 1587
            +R I+A++  +G    + IR NL V I+ M N++       H  V   + +V K       LG+ +  D +     W  +T  +I G FFWGY+VTQIP G + Q+F+   + FGF ++++ ++ M  P AAR   G +I +R++ GL  GV +P+ + +WS+WAPP +RS L      G + G  + +P+AG+L +Y    GW S+FY  G FGI W + W  + Y++P+ HP+IS+ E+ YIE ++ GE       V   + PWR   TS P +AI V N    W  Y  + S P Y +EV  F +S+ G VSA P++ M I       + D L+ R I+S T +RKLMNC G      +++++ Y   +   ++ ++L +G S  +    G  VNH+DIAP+YA +L G++N +G  +G      VGA+TK+     W+ VF + S+++  G IFY +F SG+ Q WA            +  D+     E E E
Sbjct:   61 RRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTH-RGGHVVVQTPYRSVHKQEAVTPTLGDIQGGDTEKAQFNWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRV-FGFAIVATSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQY---SGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAI-GESAKLMNPVTKFNTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRHIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFA--ISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQLAGSDESEME 550          
BLAST of slc17a-5 vs. Ensembl Mouse
Match: Slc17a6 (solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6 [Source:MGI Symbol;Acc:MGI:2156052])

HSP 1 Score: 308.531 bits (789), Expect = 2.618e-97
Identity = 170/503 (33.80%), Postives = 268/503 (53.28%), Query Frame = 1
Query:   91 EELTEKYPLCN------SKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDKEKE 1581
            E   +K PLC+       +R I+A++  +G    + IR NL V I+ M N++ +               V K        EKAK     W  +T  +I G FFWGY++TQIP G +  R +   +    ++L+S   M  P AAR   G +I +R++ GL  GV +P+ + +WS+WAPP +RS L   +  G + G  + +P+AG+L +Y    GW S+FY  G FG++W + W  + Y++P+ HPTI+D E+ YIE+S+ GE  +    +     PWR   TS P +AI V N    W  Y  + S P Y +EV  F +S+ G +SA P++ M I       + D L+ ++ILS T +RK+MNC G      +++++ Y    +R +A+  L + +  +     G  VNH+DIAP+YA +L G++N +G  +G      VGA+TKN     W+ VF + ++++  G IFY +F SG+ Q WA            +++D+  E
Sbjct:   51 EVPEKKAPLCDCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTI----------HRGGKVIK--------EKAK---FNWDPETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQY---TGWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERRYIEESI-GESANLLGAMEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGY--SHTRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKNKSREEWQYVFLIAALVHYGGVIFYALFASGEKQPWADPEETSEEKCGFIHEDELDE 526          
BLAST of slc17a-5 vs. Ensembl Mouse
Match: Slc17a7 (solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 7 [Source:MGI Symbol;Acc:MGI:1920211])

HSP 1 Score: 301.597 bits (771), Expect = 6.725e-95
Identity = 170/493 (34.48%), Postives = 261/493 (52.94%), Query Frame = 1
Query:  127 KRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSV-MFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDK-----EKEAE 1587
            +R I+A++  +G    + IR NL V I+ M N++       H  V K   N                    W  +T  +I G FFWGY+VTQIP G + Q+F+   + FGF ++++ ++ M  P AAR   G +I +R++ GL  GV +P+ + +WS+WAPP +RS L      G + G  + +P+AG+L +Y    GW S+FY  G FGI W + W  + Y++P+ HP+IS+ E+ YIE ++ GE       V   + PWR   TS P +AI V N    W  Y  + S P Y +EV  F +S+ G VSA P++ M I       + D L+ R I+S T +RKLMNC G      +++++ Y   +   ++ ++L +G S  +    G  VNH+DIAP+YA +L G++N +G  +G      VGA+TK+     W+ VF + S+++  G IFY +F SG+ Q WA            +  D+     E E E
Sbjct:   61 RRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTH-RGGHVVVQKAQFN--------------------WDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRV-FGFAIVATSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQY---SGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAI-GESAKLMNPVTKFNTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRHIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFA--ISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQLAGSDESEME 525          
BLAST of slc17a-5 vs. Ensembl Mouse
Match: Slc17a8 (solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 8 [Source:MGI Symbol;Acc:MGI:3039629])

HSP 1 Score: 302.368 bits (773), Expect = 8.794e-95
Identity = 163/485 (33.61%), Postives = 265/485 (54.64%), Query Frame = 1
Query:  127 KRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDKEKE 1581
            KR I+A++  +G    + IR NL V I+ M N++ V                      + G+ + +     W  +T  +I G FFWGY+VTQIP G +  +F+   +    + L+S   MF P AAR   G ++ +R++ GL  GV +P+ + +WS+WAPP +RS L   +  G + G  + +P+AG+L +Y    GW S+FY  G+FGI+W + W    Y+ P+ HPTIS+ E+ YIE S+    N +  +++  + PWR   TS P +AI V N    W  Y  + S P Y +EV  F +S+ G +SA P++ M I       L D L+ RKIL+ T +RK+MNC G      +++++ +   +   ++ ++L +G S  +    G  VNH+DIAP+YA +L G++N +G  +G      VGA+TK+     W+ VF + ++++ +G IFY +F SG+ Q WA       +   ++++D+  E
Sbjct:   87 KRYIIAVMSGLGFCISFGIRCNLGVAIVEMVNNSTV---------------------YVDGKPEIQTAQFNWDPETVGLIHGSFFWGYIVTQIPGGFISNKFAASRVFGAAIFLTSTLNMFIPSAARVHYGCVMGVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVLVQY---IGWASVFYIYGMFGIIWYMFWLLQAYECPAAHPTISNAERTYIETSIGEGANLA--SLSKFNTPWRRFFTSLPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFAISKVGLLSAVPHMVMTIVVPIGGQLADYLRSRKILTTTAVRKIMNCGGFGMEATLLLVVGFSHTKGVAISFLVLAVGFSGFA--ISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQNVFLIAALVHYSGVIFYGVFASGEKQDWADPENLSEDKCGIIDQDELAE 543          
BLAST of slc17a-5 vs. UniProt/SwissProt
Match: sp|Q9MZD1|S17A5_SHEEP (Sialin OS=Ovis aries OX=9940 GN=SLC17A5 PE=2 SV=1)

HSP 1 Score: 322.398 bits (825), Expect = 7.296e-103
Identity = 181/494 (36.64%), Postives = 277/494 (56.07%), Query Frame = 1
Query:   70 KTMITMKEELTEKYPLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGF-MMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNN 1548
            +T +  +    E  P+C S R  +A + F G   LYS+R+NLSV ++ M +       +  S+     S   K    +L  +  K     W  +T+  ILG FF+GY++TQIP G +  R   K +L GF +  +++  +FTPLAA   VG ++ALR + GL  GV +P+++ +WS WAPP +RS L+ ++ +G  +G  ++LP++G++C Y     W  +FY  G+ GI+W ILW  L+ DTP  H TI+  EK YI  SL  +++ S K+V     PW  +  S P WAI V +  ++W  YT +T  PTYMKEVL+FN+ +NGF+SA PY+G  +  I      D L+ R   S   +R++ + +GM+ P + +V   ++ C+   LAV  LTI  +       G  +NH+DIAP YAG+L G+TNT     G        ++T  N +  W+ VF + + I V GAIF+ +F  G++Q+WAI +     N
Sbjct:   19 RTPLLQRAPRAEPAPVCCSARYNLAFLSFFGFFVLYSLRVNLSVALVDMVDSNTTAKDNRTSYECAEHSAPIK----VLHNQTGKK--YRWDAETQGWILGSFFYGYIITQIPGGYVASRSGGK-LLLGFGIFATAIFTLFTPLAADFGVGALVALRALEGLGEGVTYPAMHAMWSSWAPPLERSKLLSISYAGAQLGTVVSLPLSGVICYY---MNWTYVFYFFGIVGIIWFILWICLVSDTPETHKTITPYEKEYILSSLKNQLS-SQKSV-----PWIPMLKSLPLWAIVVAHFSYNWTFYTLLTLLPTYMKEVLRFNIQENGFLSAVPYLGCWLCMILSGQAADNLRARWNFSTLWVRRVFSLIGMIGPAIFLVAAGFIGCDYS-LAVAFLTISTTLGGFCSSGFSINHLDIAPSYAGILLGITNTFATIPGMIGPIIARSLTPENTIGEWQTVFCIAAAINVFGAIFFTLFAKGEVQNWAISDHQGHRN 495          
BLAST of slc17a-5 vs. UniProt/SwissProt
Match: sp|Q8BN82|S17A5_MOUSE (Sialin OS=Mus musculus OX=10090 GN=Slc17a5 PE=1 SV=2)

HSP 1 Score: 319.701 bits (818), Expect = 5.909e-102
Identity = 177/485 (36.49%), Postives = 278/485 (57.32%), Query Frame = 1
Query:  100 TEKYPLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSN--VTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNN 1548
            TE  P+C S R  +A++ F G   LY++R+NLSV +        VD++D+++ +  N ++    + S  +            W  +T+  ILG FF+GY+VTQIP G +  R   K +L   ++ +S+  +FTPLAA   V  ++ LR + GL  GV FP+++ +WS WAPP +RS L+ ++ +G  +G  ++LP++G++C Y     W  +FY  G+ GI+W ILW +++ DTP  H TIS  EK YI  SL  +++ S K V     PW +I  S P WAI V +  ++W+ YT +T  PTYMKE+L+FN+ +NGF+SA PY G  +  I      D L+ +   S   +R++ + +GM+ P + +V   ++ C+   LAV  LTI  +       G  +NH+DIAP YAG+L G+TNT     G        ++T +N +  W+ VF + + I V GAIF+ +F  G++QSWA+ + +   N
Sbjct:   29 TEAAPVCCSARYNLAILAFCGFFVLYALRVNLSVAL--------VDMVDSNTTLTDNRTSKECAEHSAPIKVHHNHTGKKYKWDAETQGWILGSFFYGYIVTQIPGGYIASRVGGKLLLGLGILGTSVFTLFTPLAADLGVVTLVVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLTISYAGAQLGTVISLPLSGIICYY---MNWTYVFYLFGIVGIVWFILWMWIVSDTPETHKTISHYEKEYIVSSLKNQLS-SQKVV-----PWGSILKSLPLWAIVVAHFSYNWSFYTLLTLLPTYMKEILRFNVQENGFLSALPYFGCWLCMILCGQAADYLRVKWNFSTISVRRIFSLVGMVGPAVFLVAAGFIGCDYS-LAVAFLTISTTLGGFASSGFSINHLDIAPSYAGILLGITNTFATIPGMTGPIIAKSLTPDNTIREWQTVFCIAAAINVFGAIFFTLFAKGEVQSWALSDHHGHRN 495          
BLAST of slc17a-5 vs. UniProt/SwissProt
Match: sp|Q9NRA2|S17A5_HUMAN (Sialin OS=Homo sapiens OX=9606 GN=SLC17A5 PE=1 SV=2)

HSP 1 Score: 315.849 bits (808), Expect = 2.168e-100
Identity = 173/485 (35.67%), Postives = 278/485 (57.32%), Query Frame = 1
Query:  103 EKYPLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVT--KTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMML-SSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNN 1548
            E  P+C S R  +A++ F G   +Y++R+NLSV +        VD++D+++ +  N ++    + S  +            W  +T+  ILG FF+GY++TQIP G +  +   K +L GF +L +++  +FTP+AA   VG +I LR + GL  GV FP+++ +WS WAPP +RS L+ ++ +G  +G  ++LP++G++C Y     W  +FY  G  GI W +LW +L+ DTP  H  IS  EK YI  SL  +++ S K+V     PW  I  S P WAI V +  ++W  YT +T  PTYMKE+L+FN+ +NGF+S+ PY+G  +  I      D L+ +   S   +R++ + +GM+ P + +V   ++ C+   LAV  LTI  +       G  +NH+DIAP YAG+L G+TNT     G        ++T +N V  W+ VF++ + I V GAIF+ +F  G++Q+WA+ + +   +
Sbjct:   30 EAAPVCCSARYNLAILAFFGFFIVYALRVNLSVAL--------VDMVDSNTTLEDNRTSKACPEHSAPIKVHHNQTGKKYQWDAETQGWILGSFFYGYIITQIPGGYVASKIGGK-MLLGFGILGTAVLTLFTPIAADLGVGPLIVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLSISYAGAQLGTVISLPLSGIICYY---MNWTYVFYFFGTIGIFWFLLWIWLVSDTPQKHKRISHYEKEYILSSLRNQLS-SQKSV-----PWVPILKSLPLWAIVVAHFSYNWTFYTLLTLLPTYMKEILRFNVQENGFLSSLPYLGSWLCMILSGQAADNLRAKWNFSTLCVRRIFSLIGMIGPAVFLVAAGFIGCDYS-LAVAFLTISTTLGGFCSSGFSINHLDIAPSYAGILLGITNTFATIPGMVGPVIAKSLTPDNTVGEWQTVFYIAAAINVFGAIFFTLFAKGEVQNWALNDHHGHRH 495          
BLAST of slc17a-5 vs. UniProt/SwissProt
Match: sp|Q1L8X9|VGLU3_DANRE (Vesicular glutamate transporter 3 OS=Danio rerio OX=7955 GN=slc17a8 PE=3 SV=2)

HSP 1 Score: 313.153 bits (801), Expect = 3.706e-98
Identity = 170/482 (35.27%), Postives = 261/482 (54.15%), Query Frame = 1
Query:  127 KRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDK 1572
            KR I+A++  +G    + IR NL V I+ M N+  V +       P  F+                     W  +T  +I G FFWGY+VTQIP G +  + +   +    + L+S+  MF P AAR   G ++ +R++ GL  GV +P+ + +WS+WAPP +RS L   +  G + G  + +P+AG+L +Y    GWPS+FY  G+FGI+W I W  L Y++P+ HPTIS+ E+NYIE S+ GE  +   +      PWR   TS P +AI V N    W  Y  + S P Y +EV  F +S+ G +SA P++ M I       L D L+ RKILS T +RK+MNC G      +++++ +    +  ++ ++L +G S  +    G  VNH+DIAP+YA +L G++N +G  +G      VGA+TK+     W+ VF + S+++  G IFY IF SG+ Q WA           ++ +D+
Sbjct:   74 KRYIIAMLSGLGFCISFGIRCNLGVAIVEMVNNNTVYINGTAVMQPAQFN---------------------WDPETVGLIHGSFFWGYIVTQIPGGFISNKLAANRVFGAAIFLTSVLNMFIPSAARVHYGCVMFVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQY---VGWPSVFYIYGVFGIIWYIFWILLAYNSPAVHPTISEEERNYIETSI-GEGANLMSSTEKFKTPWREFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFPISKVGILSAVPHMVMTIIVPIGGQLADFLRSRKILSTTTVRKIMNCGGFGMEATLLLVVGFSHTRAVAISFLILAVGFSGFA--ISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGALTKHKTRLEWQHVFVIASMVHYTGVIFYAIFASGEKQDWADPENTSDEKCGIIGEDE 528          
BLAST of slc17a-5 vs. UniProt/SwissProt
Match: sp|Q03567|SL172_CAEEL (Uncharacterized transporter slc-17.2 OS=Caenorhabditis elegans OX=6239 GN=C38C10.2 PE=1 SV=2)

HSP 1 Score: 310.071 bits (793), Expect = 4.022e-98
Identity = 164/498 (32.93%), Postives = 262/498 (52.61%), Query Frame = 1
Query:   91 EELTEKYPLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDL-MDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDKEKE 1581
            E  T K  L  S R  ++L+ F G L  Y +R N+S  ++CM N    D  ++  S   K  + V   S  +        G+  W KQT  ++L  FF+GY+ +QI  G L  R+  K ++F  ++ S+L  +  P+AARTS   +  LR   G   G  FP+++ +WS W PP + S+L G+T +G  +GN + LP++G LCEYGF GGWPSIFY  G+FG+LW  +W ++  D P+ HP I+  EK YI  ++  E +       +   PW  I TS   WA    +   DW  YT + S P+++K+VL  N+S  G V++ PYI   +      +L D L+ + ILS    R+    + ++  G+ +V   Y  C    L ++ +T G++ +   + G  VN+++IAP ++G + G  NT+ A  G  S      +T N     W++V ++ + I   GA+ + IF SG++Q WA     + +  + L + ++ E
Sbjct:    2 EGATTKPRLVPSTRFALSLVMFFGCLVTYMMRTNMSFAVVCMVNENKTDTGVEKVSRCGKEMTPVESNSSVI--------GEFDWDKQTTGMVLSSFFYGYIGSQIIGGHLASRYGGKRVVFVTILGSALLTLLNPVAARTSEYALAILRAAIGFLQGATFPAMHTMWSVWGPPLELSVLTGVTYAGAQIGNVIVLPLSGFLCEYGFDGGWPSIFYIIGVFGVLWTAVWWYVSSDKPATHPRITPEEKQYIVTAV--EASMGKDTGKVPSTPWIKILTSPAVWACWAGHFAGDWGAYTMLVSLPSFLKDVLGLNLSSLGAVASIPYIAYFLAINAGGVLADTLRSKGILSTLNTRRAAMLVALIGQGIFLVASGYCGCGQDVLVIIFITCGMAISGLQYAGFVVNYLEIAPPFSGTVMGTGNTISALAGIISPAVSSYLTPNGTQEEWQMVLWLTAGILTIGALLFSIFASGEVQPWAKLTAEEGHEMAPLREGEKIE 489          
BLAST of slc17a-5 vs. TrEMBL
Match: A0A0H3YK80 (Slc17a-5 OS=Schmidtea mediterranea OX=79327 GN=slc17a-5 PE=2 SV=1)

HSP 1 Score: 1032.71 bits (2669), Expect = 0.000e+0
Identity = 505/505 (100.00%), Postives = 505/505 (100.00%), Query Frame = 1
Query:   76 MITMKEELTEKYPLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDKEKEAEC 1590
            MITMKEELTEKYPLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDKEKEAEC
Sbjct:    1 MITMKEELTEKYPLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDKEKEAEC 505          
BLAST of slc17a-5 vs. TrEMBL
Match: A0A1S3H0J2 (sialin isoform X1 OS=Lingula unguis OX=7574 GN=LOC106150431 PE=4 SV=1)

HSP 1 Score: 435.647 bits (1119), Expect = 9.250e-144
Identity = 218/502 (43.43%), Postives = 316/502 (62.95%), Query Frame = 1
Query:  112 PLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMD----------------------NHSFVPKNFSNVTKTS---------CALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAI 1524
            P   S RL +A IG +G   LY++R+N+SV ++CM NHTA ++++                      N SF+ K   N T T           A  GE    +G+ +WSK  +  ILG FF+GYL TQIP G L +RF  KW+    M+++S++ +F P+AAR   GF+I +R++ GL SGV FP ++ +W+ WAPP +RS L GLT +G  +GN LTLP+ G LC+YGF GGW SIFY  GL G++WCILW  L+ ++P+DHP IS  E+++I +SL G+++  +K      +PW+A  TS P WAI V N+  DW  YTF+T+ PTY KEVLKF++  NG +SA PYIG  +      +  D+ +K+  LS T  RKLM  +G L P +++V L+++ C    LAV LLT+G++ + A++ G  +NHVDIAP+YAG+LFG+TNT+ + TGF     +G++T N+    W++VFF+ + +Y+ G IFY IF SG +Q WA+
Sbjct:   23 PFWCSCRLGLAAIGCMGFFILYALRINISVALVCMVNHTATEILNKQSSVNGNLSDTVWYNTSYGENNTSFIVKGMINETTTQPDPTGVVCPGAGDGESDGVNGEFIWSKDIQGHILGSFFYGYLATQIPGGWLAERFGGKWVFGISMLIASIATIFCPIAARVHWGFLIFMRILVGLGSGVAFPVMHTIWANWAPPMERSKLTGLTYAGTQLGNILTLPLGGFLCQYGFDGGWASIFYILGLLGVIWCILWLILVSNSPADHPRISAIERDFILQSLKGQMDHKDKKHT--HIPWKAFLTSMPLWAIVVGNVTSDWGLYTFLTNMPTYFKEVLKFDIKSNGLISAIPYIGFWLVINLAGLGADLFRKKGWLSTTNARKLMETIGQLIPAILLVGLSFVDCTQPALAVTLLTLGVAISGAVYSGYTINHVDIAPKYAGMLFGITNTIASVTGFIVPVLIGSITSNSTREEWQVVFFIAAAVYLFGVIFYGIFASGDVQPWAV 522          
BLAST of slc17a-5 vs. TrEMBL
Match: A0A1S3GXU6 (sialin isoform X2 OS=Lingula unguis OX=7574 GN=LOC106150431 PE=4 SV=1)

HSP 1 Score: 435.647 bits (1119), Expect = 9.279e-144
Identity = 218/505 (43.17%), Postives = 317/505 (62.77%), Query Frame = 1
Query:  103 EKYPLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMD----------------------NHSFVPKNFSNVTKTS---------CALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAI 1524
            +  P   S RL +A IG +G   LY++R+N+SV ++CM NHTA ++++                      N SF+ K   N T T           A  GE    +G+ +WSK  +  ILG FF+GYL TQIP G L +RF  KW+    M+++S++ +F P+AAR   GF+I +R++ GL SGV FP ++ +W+ WAPP +RS L GLT +G  +GN LTLP+ G LC+YGF GGW SIFY  GL G++WCILW  L+ ++P+DHP IS  E+++I +SL G+++  +K      +PW+A  TS P WAI V N+  DW  YTF+T+ PTY KEVLKF++  NG +SA PYIG  +      +  D+ +K+  LS T  RKLM  +G L P +++V L+++ C    LAV LLT+G++ + A++ G  +NHVDIAP+YAG+LFG+TNT+ + TGF     +G++T N+    W++VFF+ + +Y+ G IFY IF SG +Q WA+
Sbjct:   15 KDVPFWCSCRLGLAAIGCMGFFILYALRINISVALVCMVNHTATEILNKQSSVNGNLSDTVWYNTSYGENNTSFIVKGMINETTTQPDPTGVVCPGAGDGESDGVNGEFIWSKDIQGHILGSFFYGYLATQIPGGWLAERFGGKWVFGISMLIASIATIFCPIAARVHWGFLIFMRILVGLGSGVAFPVMHTIWANWAPPMERSKLTGLTYAGTQLGNILTLPLGGFLCQYGFDGGWASIFYILGLLGVIWCILWLILVSNSPADHPRISAIERDFILQSLKGQMDHKDKKHT--HIPWKAFLTSMPLWAIVVGNVTSDWGLYTFLTNMPTYFKEVLKFDIKSNGLISAIPYIGFWLVINLAGLGADLFRKKGWLSTTNARKLMETIGQLIPAILLVGLSFVDCTQPALAVTLLTLGVAISGAVYSGYTINHVDIAPKYAGMLFGITNTIASVTGFIVPVLIGSITSNSTREEWQVVFFIAAAVYLFGVIFYGIFASGDVQPWAV 517          
BLAST of slc17a-5 vs. TrEMBL
Match: R7UX60 (MFS domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_113983 PE=4 SV=1)

HSP 1 Score: 427.172 bits (1097), Expect = 5.388e-141
Identity = 211/496 (42.54%), Postives = 311/496 (62.70%), Query Frame = 1
Query:  112 PLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSG-LHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSL----LNKDKEKEA 1584
            P   S R+ +AL+GF+G +NLY++R+NLSVG++CM N TA+  M + S       ++T  S A    +   DG+  W K T+ +ILG FFWGYL+TQIP G L +RF  K +   FM++++++ + TP+ ARTS  F++ALR+I GL  GV FP+++ LWS+WAPP +RS L+G T +G   +GN LT+PI+GLLC+YGF GGW SIFY  G  G++W ILW F+ Y+ PS HP ISD E++YIE+S+ G    S K       PWR   TSK  W I + ++  +W  YT +T+ PTYMKEVL+F++  NG  SA PY+   +      ++ D ++        R+RK+M CLG L P   ++ + Y+ C + Y+A+VLLT+G+  +   + G  VNHVD+AP +AG LFG++NTL    G  + Y +G +TK+     W+IVF++ + IY  GAIF+++F  G++Q W  +   D  +       LN+  +K A
Sbjct:   11 PWLLSCRVALALVGFLGFVNLYALRVNLSVGLVCMVNQTAIQEMSDSS----PAFDLTNGSNAERNWDHCADGEFAWPKATQGMILGAFFWGYLLTQIPGGWLAERFGGKAVFGWFMLMTAVATLLTPIGARTSPWFLVALRIIQGLGEGVVFPAMHALWSKWAPPLERSKLIGFTYAGSAQIGNVLTMPISGLLCDYGFDGGWGSIFYIFGTLGVVWFILWMFIAYNEPSVHPRISDVERDYIEQSIGG----SRKESKHLSTPWRKFFTSKAIWGIIIGHMCANWGTYTLLTNIPTYMKEVLRFDIKSNGLFSAIPYVAFWLFINVGGVMADYMRSTG-WETARVRKIMYCLGTLLPAAFLIGVGYISCATPYVAIVLLTLGVGFSGFQYPGVMVNHVDVAPPFAGTLFGISNTLATLPGILAPYAIGVITKDQTEEQWQIVFYISAAIYTVGAIFFVLFACGEIQPWVREFMFDDKDLKEMTCNLNESDDKPA 497          
BLAST of slc17a-5 vs. TrEMBL
Match: A0A4Z2CSR0 (Sialin isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_007841 PE=4 SV=1)

HSP 1 Score: 416.001 bits (1068), Expect = 1.335e-136
Identity = 204/490 (41.63%), Postives = 311/490 (63.47%), Query Frame = 1
Query:  118 CNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTS--CALLGEEKAK---DGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQ--NTNDSNNFSLLNK 1566
            C S+R+I++L+  +GT+N+ + R+NLS+ ILCMTNH++++  +N S   K+  N   TS  C++    K +   DG  VW + +R I+LG+ FWGY + QIPAG+L+Q+FS + +L   ++L S S +  PL A   +    A+RV+ GL S  WFP  YQLW+ WAPP +R LL+G   +GLH+G+A+++PI G LC+     GW  +FY  G F  L+CI+W   +YD P  HP IS   K Y+E S C  I +  K      +P+++I TS P WA   +NI  DWN YTF+TS PTYM+EVL F+  +N  +S+ PYIGM IGQI F  L DI   R+IL+++ +RKLMN +GM  P ++++++    C  +Y+ V+LLT GL  +S +F G  ++ ++I P+Y+G LF  +N++GA TGF +     A+T +     WR VF++ + I++   +F+L+F S  +QSWAI+  +T+  N+ S ++K
Sbjct:    3 CLSERMILSLVLCLGTINMLAQRVNLSIAILCMTNHSSIN--ENDSVNDKHTMNDNSTSSICSIQSLNKTETMMDGPFVWDRSSRGILLGIIFWGYFLGQIPAGILIQKFSVRLVLLISLILMSTSTILVPLVATKFLYLFYAVRVLTGLTSASWFPGFYQLWAAWAPPNERGLLIGFAYAGLHIGSAISMPITGALCQTSL--GWSLVFYFYGAFSFLYCIIWFIFVYDEPKTHPRISLKGKIYLESS-CPIIKNDKKG----KIPFKSILTSLPVWAFVFVNIGIDWNLYTFLTSVPTYMREVLHFDFQRNALLSSIPYIGMWIGQILFGWLSDIFLTRRILTLSAVRKLMNSIGMFGPAVLMILITLFDCRYKYVVVILLTFGLFLSSGVFSGGMLSPIEITPKYSGFLFSASNSVGALTGFLTPVVANALTPDKTFEQWRYVFYLGAAIFLIAGLFFLLFSSFTVQSWAIEVTDTSSDNDHSFIDK 483          
BLAST of slc17a-5 vs. Ensembl Cavefish
Match: si:ch1073-513e17.1 (sialin-like [Source:NCBI gene;Acc:103042153])

HSP 1 Score: 313.923 bits (803), Expect = 2.182e-100
Identity = 175/490 (35.71%), Postives = 275/490 (56.12%), Query Frame = 1
Query:   91 EELTEKYPLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHT----AVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNN 1548
            EEL+   P C S R  +A++ F G   +Y +R+NLSV ++ M N T    +++  + H   P   ++ +++   L G  +       W  Q + ++LG FF+GYL TQIP G L   F  +  L G ++ +++  + TPLAA     ++ ALR + G   GV +P++  +W+ WAPP +R+ L+ L+ +G + G  ++ P+ G +C    + GWP++FY  G  G LW ILW  L+ D P  HP ISD EK YI  ++  E      +V     P   +  S P WAI +  +  +W+ YT +TS PTYM  VL F++ QN F+SA PY+G  +  +   ++ D L +R+++ VT IRK+   +GM+ P   +V +A+  C S  LAV  LT+  +   A   G ++N +DIAP+YAG+L G+TNT G   G  +   VG + K++ +  W  VF+V + + V GAI + +FGSGKLQ+WA+       +
Sbjct:   30 EELSVP-PKCCSARCNLAIMMFFGFAVVYGLRVNLSVAMVAMVNGTNSQPSLNGSETHE-CPGALNSSSQSPDQLDGVPRYN-----WDSQMQGMLLGAFFFGYLFTQIPGGYLSGHFGGRIFLGGGVLCTAILTLLTPLAAELGARWLFALRALEGFGEGVTYPAMMAMWACWAPPLERARLMSLSGAGGNFGAFVSFPLTGFICH---SLGWPAVFYWCGGAGCLWAILWFILVSDDPRKHPRISDQEKEYIVNTIGSEGGSHGWSV-----PLLPMLLSVPLWAIIITQMCSNWSYYTLLTSLPTYMDTVLHFDLRQNSFLSALPYLGGWLFSVLSGVIADNLLERELMGVTAIRKIFTVVGMVVPAGFLVAVAFSGC-SGGLAVTFLTLSSTIGGASSAGVYMNQIDIAPRYAGVLLGITNTFGTIPGVLAPIVVGQLAKDHSLTGWSNVFYVSAGVSVVGAIIFTVFGSGKLQNWAVSEDEREAD 503          
BLAST of slc17a-5 vs. Ensembl Cavefish
Match: slc17a6b (vesicular glutamate transporter 2.1 [Source:NCBI gene;Acc:103031917])

HSP 1 Score: 309.301 bits (791), Expect = 6.043e-98
Identity = 171/503 (34.00%), Postives = 268/503 (53.28%), Query Frame = 1
Query:   91 EELTEKYPLCN------SKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDKEKE 1581
            +    K PLC+       +R I+A++  +G    + IR NL V I+ M N++ +   +N   + K               EKAK     W  +T  +I G FFWGY+VTQIP G +  R +   +    ++L+S   MF P AAR   G +I +R++ GL  GV +P+ + +WS+WAPP +RS L   +  G + G  + +P+AG+L +Y    GW S+FY  G FG++W + W  + Y++P++HPTI+D E+ YIE+S+ GE             PWR   TS P +AI V N    W  Y  + S P Y +EV  F +S+ G +SA P++ M I       + D L+ + ++S T +RK+MNC G      +++I+ Y   +   ++ ++L +G S  +    G  VNH+DIAP+YA +L G++N +G  +G      VG +TKN     W+ VF + S+++  G IFY IF SG+ Q WA            +++D+  E
Sbjct:   29 QRSERKTPLCDCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTIH--ENGKIIIK---------------EKAK---FNWDPETVGMIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAIVLTSTLNMFIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQY---TGWSSVFYVYGCFGLVWYMFWILVSYESPAEHPTITDEERCYIEESI-GESAKLLGPAEKFKTPWRQFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSALPHLVMTIIVPIGGQIADYLRSKNLMSTTNVRKIMNCGGFGMEATLLLIVGYSHSKGMAISFLVLAVGFSGFA--ISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGTMTKNKTREEWQYVFLIASMVHYGGVIFYGIFASGEKQPWADPELTSEEKCGFIDEDELAE 505          
BLAST of slc17a-5 vs. Ensembl Cavefish
Match: slc17a6b (vesicular glutamate transporter 2.1 [Source:NCBI gene;Acc:103031917])

HSP 1 Score: 308.916 bits (790), Expect = 1.533e-97
Identity = 171/499 (34.27%), Postives = 267/499 (53.51%), Query Frame = 1
Query:  103 EKYPLCN------SKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDKEKE 1581
             K PLC+       +R I+A++  +G    + IR NL V I+ M N++ +   +N   + K               EKAK     W  +T  +I G FFWGY+VTQIP G +  R +   +    ++L+S   MF P AAR   G +I +R++ GL  GV +P+ + +WS+WAPP +RS L   +  G + G  + +P+AG+L +Y    GW S+FY  G FG++W + W  + Y++P++HPTI+D E+ YIE+S+ GE             PWR   TS P +AI V N    W  Y  + S P Y +EV  F +S+ G +SA P++ M I       + D L+ + ++S T +RK+MNC G      +++I+ Y   +   ++ ++L +G S  +    G  VNH+DIAP+YA +L G++N +G  +G      VG +TKN     W+ VF + S+++  G IFY IF SG+ Q WA            +++D+  E
Sbjct:   55 RKTPLCDCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTIH--ENGKIIIK---------------EKAK---FNWDPETVGMIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAIVLTSTLNMFIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQY---TGWSSVFYVYGCFGLVWYMFWILVSYESPAEHPTITDEERCYIEESI-GESAKLLGPAEKFKTPWRQFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSALPHLVMTIIVPIGGQIADYLRSKNLMSTTNVRKIMNCGGFGMEATLLLIVGYSHSKGMAISFLVLAVGFSGFA--ISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGTMTKNKTREEWQYVFLIASMVHYGGVIFYGIFASGEKQPWADPELTSEEKCGFIDEDELAE 527          
BLAST of slc17a-5 vs. Ensembl Cavefish
Match: slc17a8 (solute carrier family 17 member 8 [Source:NCBI gene;Acc:563467])

HSP 1 Score: 306.99 bits (785), Expect = 6.708e-97
Identity = 169/482 (35.06%), Postives = 256/482 (53.11%), Query Frame = 1
Query:  127 KRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDK 1572
            KR I+A++  +G    + IR NL V I+ M N+  V +       P  F+                     W  +T  +I G FFWGY+VTQIP G +  + +   +    + L+S+  MF P AAR   G ++ +R++ GL  GV +P+ + +WS+WAPP +RS L   +  G + G  + +P+AG+L +Y    GWPS+FY  G+FGI+W   W  L YD+P+ HPTISD EK YIE ++ GE             PWR   TS P +AI V N    W  Y  + S P Y +EV  F +S+ G +SA P++ M I       L D L+  KILS T +RK+MNC G      +++++ +       ++ ++L +G S  +    G  VNH+DIAP+YA +L G++N +G  +G      VGA+TK+     W+ VF + S+++  G IFY IF SG+ Q WA   +       ++ +D+
Sbjct:   58 KRYIIAILSGLGFCISFGIRCNLGVAIVEMVNNNTVYINGTPVMQPAQFN---------------------WDPETVGLIHGSFFWGYIVTQIPGGFISNKLAANRVFGAAIFLTSMLNMFIPSAARVHYGCVMFVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQY---VGWPSVFYIYGVFGIIWYTFWLLLAYDSPAVHPTISDEEKIYIETTI-GEGASLMSATEKFKTPWRQFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFPISKVGILSAVPHMVMTIVVPIGGQLADFLRSNKILSTTTVRKIMNCGGFGMEATLLLVVGFSHTRGVAISFLVLAVGFSGFA--ISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGALTKHKTRLEWQNVFVIASMVHYCGVIFYAIFASGEKQDWADPESTSDEKCGIIGEDE 512          
BLAST of slc17a-5 vs. Ensembl Cavefish
Match: slc17a8 (solute carrier family 17 member 8 [Source:NCBI gene;Acc:563467])

HSP 1 Score: 305.064 bits (780), Expect = 4.357e-96
Identity = 169/482 (35.06%), Postives = 259/482 (53.73%), Query Frame = 1
Query:  127 KRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDK 1572
            KR I+A++  +G    + IR NL V I+ M N+  V  ++    +  N     +T    +           W  +T  +I G FFWGY+VTQIP G +  + +   +    + L+S+  MF P AAR   G ++ +R++ GL  GV +P+ + +WS+WAPP +RS L   +  G + G  + +P+AG+L +Y    GWPS+FY  G+FGI+W   W  L YD+P+ HPTISD EK YIE ++ GE             PWR   TS P +AI V N    W  Y  + S P Y +EV  F +S+ G +SA P++ M I       L D L+  KILS T +RK+MNC G      +++++ +       ++ ++L +G S  +    G  VNH+DIAP+YA +L G++N +G  +G      VGA+TK+     W+ VF + S+++  G IFY IF SG+ Q WA   +       ++ +D+
Sbjct:   58 KRYIIAILSGLGFCISFGIRCNLGVAIVEMVNNNTV-YINGTPVMQVNKKKHKRTESFFI-----LPAQFNWDPETVGLIHGSFFWGYIVTQIPGGFISNKLAANRVFGAAIFLTSMLNMFIPSAARVHYGCVMFVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQY---VGWPSVFYIYGVFGIIWYTFWLLLAYDSPAVHPTISDEEKIYIETTI-GEGASLMSATEKFKTPWRQFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFPISKVGILSAVPHMVMTIVVPIGGQLADFLRSNKILSTTTVRKIMNCGGFGMEATLLLVVGFSHTRGVAISFLVLAVGFSGFA--ISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGALTKHKTRLEWQNVFVIASMVHYCGVIFYAIFASGEKQDWADPESTSDEKCGIIGEDE 527          
BLAST of slc17a-5 vs. Ensembl Sea Lamprey
Match: slc17a6b (solute carrier family 17 member 6b [Source:NCBI gene;Acc:100149756])

HSP 1 Score: 243.047 bits (619), Expect = 1.857e-73
Identity = 156/511 (30.53%), Postives = 248/511 (48.53%), Query Frame = 1
Query:  106 KYPLCN------SKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVF-FWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCS---GVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDK-------EKEAE 1587
            K PLC        KR ++A++  +G    + IR NL V +        VD+++N S+   +   V K             G L WS      +  ++ F+ + +      ++V+  S +  L      S+L   + P+          A      L S   GV +P+ + +W++WAPP +RS L      G + G  + +P+AG+L +Y    GW S+FY  G FG+ W I W  + Y++P+ HPTISD EK YIE+S+ GE      +      PW+   TS P +AI V N    W  Y  + S P Y +EV  F +S+ G +SA P++ M I       L D  + +KI+S T +RK+MNC G      +++++ +   +   +  ++L +G S  +    G  VNH+DIAP+YA +L G++N +G  +G      VGA+TK      W+ VF + ++++  G IFY +F SG+ Q WA            +N+D+       E EAE
Sbjct:   16 KEPLCECRCFGMPKRYVIAVMSGLGFCISFGIRCNLGVAV--------VDMVNNSSYHSGDKLIVQK-------------GSLGWSMDLAMQLHELYNFFLFFLATWQGHIVVKSMSREERLH---QCSTLPPHWLPVHVEERRAVPCACLTSLSLSSVEQGVTYPACHGIWAKWAPPLERSRLATTAFCGSYAGAVVAMPLAGILVQYA---GWSSVFYVYGSFGLFWYIFWLCIAYESPAKHPTISDEEKTYIEESI-GESYGILGSTQKFKTPWKKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGIISALPHLVMTIVVPIGGQLADFFRSKKIMSTTTVRKMMNCGGFGMEATLLLVVGFSHGKGIAITFLVLAVGFSGFA--ISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKGKTREEWQNVFLIAALVHYGGVIFYGLFASGEKQPWADPEETSDEKCGFINEDELGGDDFAEGEAE 496          
BLAST of slc17a-5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010352.1 (pep scaffold:Pmarinus_7.0:GL492704:416:4460:1 gene:ENSPMAG00000009375.1 transcript:ENSPMAT00000010352.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 199.904 bits (507), Expect = 1.996e-60
Identity = 103/259 (39.77%), Postives = 150/259 (57.92%), Query Frame = 1
Query:  751 GILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQ 1527
            G+LW I+W    +D+P  HP IS  E+ +I KSL  E   +N   +I   PWR + T  P WAI V      W  Y  +TS PTYM  VL + M QNG +SA PY+   +  +   +  D L+ R +LS+T IRK+   LG+  P L +V   ++ C +  LAV  LT+ ++  +    G  +N +DIAPQYAG+L G++NT     GF +    G +T+++ +  W +VFF+ + I + GA+FYL+FGSGK QSWA +
Sbjct:    4 GLLWSIVWFLFAFDSPERHPRISAEEREFILKSLQAE-RQANHGTSI---PWRHVWTCMPLWAINVAMFCSGWGFYVLLTSLPTYMSTVLHYEMQQNGLLSALPYLAGWVFTVAGGMAADALRIRGLLSITAIRKVATTLGLAVPSLCLVASGFVGC-NHLLAVSFLTLSVAFGAFTTAGCGINQLDIAPQYAGVLLGISNTFNNLPGFLAPTLTGYLTEHDTLKEWHMVFFISAAINMFGALFYLVFGSGKQQSWARE 257          
BLAST of slc17a-5 vs. Ensembl Nematostella
Match: EDO48671 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIA9])

HSP 1 Score: 318.546 bits (815), Expect = 2.169e-103
Identity = 184/471 (39.07%), Postives = 267/471 (56.69%), Query Frame = 1
Query:  130 RLIVALIGFIGTLNLYSIRMNLSVGILCMTN-HTAVDLMDNHSFVPKNFSNVTKTSCALLG-EEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTN 1536
            R IVA++ F+G    Y++R+NLSV I  M N HT  +    + F  K    V    C  +   +K    +  WS + +  ILG F++GY+  Q+P G L QRF    +    + ++S+  M TPLAARTSV  +I LRVI GL  G  FP  + +WS+WAPP +R+ L  +T +G  VG  L++P++GL+ +YGF GGW S+FY  G  G+LW  +W   I+ TPS+HPTIS+ EK YIE ++  +       V +  +PW++I TS P WAI + N   DW  YT +   P Y  EVLKF++++ GF++A PY+          ++ D L K K LSV   R+ +  +G     + V+   Y      YLAV LLTIG+  T     G  VN +DIAP+YAG++ G+TN  GA  GF S   VG +T N     WR+VF++  I+Y+ G + + +  SG  Q WA+ + +
Sbjct:    1 RYIVAIMVFLGICVQYALRVNLSVAIGAMCNPHTVTE----NGFTIKK---VLVVYCVTVRRHQKVLPAEFDWSSKLQGTILGAFYYGYMTMQLPGGWLGQRFGGTRVFGICLGIASVLTMLTPLAARTSVVALITLRVIEGLTLGALFPCNHAIWSKWAPPSERTRLFTITVAGCPVGTILSMPLSGLMSKYGFDGGWASVFYCFGAVGLLWFFVWQLSIHATPSEHPTISEEEKVYIETAIADQ-----PGVKL-SIPWKSILTSGPVWAIIIANFTADWGMYTILICLPKYFIEVLKFDLAKTGFLAALPYVLKAFVGPTGGVIVDWLIKNK-LSVKNTRRCVFTVGCTVASIFVLATGY--ANQPYLAVGLLTIGVGITGINAAGYAVNILDIAPKYAGVIMGVTNVFGAAPGFISPQIVGIITPNKTAKEWRVVFWITFIVYIVGIVLFGLLVSGDKQKWAMDDPS 455          
BLAST of slc17a-5 vs. Ensembl Nematostella
Match: EDO45514 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSS9])

HSP 1 Score: 318.546 bits (815), Expect = 6.161e-103
Identity = 180/487 (36.96%), Postives = 279/487 (57.29%), Query Frame = 1
Query:   85 MKEELTEKYP-LCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMML-SSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVT-KNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTN 1536
            ++ ++    P  C   R  +AL+  +G   +Y +R+NLSV ++ M N T  D +D ++       N   T+         K+GD  W ++T+ +ILG FF+GY+ TQ+P G L  +F  K  LFGF +L +S+  + TP AA   +  +IALR++ GL  GV FP+++ +WS WAPP +RS L+ L+ +G  +GN + +P+AG+LC    AGGWPS+FY  G  GILW ++W  ++ + P+DHPTIS+ E++YI  S+       ++     + PW AI +S   WAI + +   +W  YTF+T  P+Y KEVL F++  NGF+SA PY    +  +    + D L +R+I SV+ +RK+      + P  ++V  +Y  C +  L+V L +  L  T     G  VNH+DIAP+YAG+L G+TN+ G   G  + Y  G +T K  D   W+IVFF+ + +YV GAI ++    G  + W I   +
Sbjct:    9 LRPDVRRSRPGTCWRVRYTLALLACLGFCVVYGLRVNLSVALVAMVNST-YDGIDGNTNSECPGGNTPDTT--------YKNGDFNWDQKTQGLILGSFFYGYICTQLPGGWLASQFGGK-HLFGFGVLCTSIFTLLTPWAAHQGIPMLIALRILEGLGEGVTFPAMHAIWSSWAPPLERSKLLTLSYAGCQLGNIIFMPLAGVLCASEIAGGWPSVFYIFGSLGILWFVVWTLMVTEKPADHPTISEAERDYIISSIG---TSQDRKTTKQNTPWSAIWSSPAVWAIIIAHFCNNWGFYTFLTLLPSYFKEVLNFSILTNGFLSAVPYSTQWLFIVIAGQIADWLLRRRISSVSDVRKVFCVTAFIIPACLLVATSYTGCTTTTLSVCLFSTALGFTGFNLSGFNVNHLDIAPRYAGILMGITNSFGTVPGIAAPYVAGWITNKKPDRAHWQIVFFISAGLYVIGAISFVTLSKGSERRWNIPEKD 482          
BLAST of slc17a-5 vs. Ensembl Nematostella
Match: EDO31704 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX52])

HSP 1 Score: 309.301 bits (791), Expect = 4.151e-99
Identity = 173/483 (35.82%), Postives = 256/483 (53.00%), Query Frame = 1
Query:  127 KRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDKE 1575
            KR ++  + ++G +N+YS+R+NL+V I+ M N   +     H F+                    K  +  W    + ++LG FF+GY V QIP   L  R     +    + ++SL  + TP+A R SV  ++ +R+  GL  GV FP  + +WS+WAPP +RS L+ ++ +G   GN + +P+ GLL +YGF GGWPS+FY  G  GI+W   W  +++++P+ HPTIS  E+  IE S    I  S+       LPW  I   K  WAI + +    W  YT  T  PTY K+VL F++ Q GF++A PY+   +      IL D L K  IL +  +R +   +G L  G+ +V  +Y    +R++ V+ L +G+  +    +G  VNH+DIAPQYAG+L GLTNT  +  GF S    G VTK+     WRIVF++  I+YV   I Y    SG  Q WA     D    S   +D+E
Sbjct:   38 KRYVLLAMTWLGFINIYSMRVNLNVAIVGMVNDQTISKGRLH-FI--------------------KKAEFNWDSALQGLVLGSFFYGYWVLQIPGAWLAMRIGGTRVFGYGVFVTSLLALLTPVATRYSVWGLVGVRIFQGLFLGVTFPCNHAIWSKWAPPFERSTLITISIAGCPFGNIVAIPLTGLLSKYGFDGGWPSVFYCFGTSGIIWYCCWELVVHESPATHPTISKEERELIENS----IASSDNKAQFEGLPWHHILRCKAVWAIVIGHFGACWGYYTLFTGMPTYFKDVLDFDIEQTGFLAACPYLFKALLAPLGGILADYLIKHNILRIGTVRVIFYAVGCLLAGVFIVATSY--ATTRHMCVIFLVLGVGFSGLNAIGYAVNHLDIAPQYAGVLMGLTNTFASTPGFISPQITGIVTKHKKQEEWRIVFWITMIVYVVAVIGYSALCSGYRQPWA--GGRDQVELSEKERDEE 491          
BLAST of slc17a-5 vs. Ensembl Nematostella
Match: EDO31712 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX51])

HSP 1 Score: 273.092 bits (697), Expect = 3.078e-86
Identity = 157/452 (34.73%), Postives = 255/452 (56.42%), Query Frame = 1
Query:  172 LYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGF-MMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESR-YLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWA 1521
            +Y++R  LSV I+ M +++ V +                      G++  K  +  WS + + ++LG F++GY V QIPAG  V +   K I FGF ++++S+  + TP   + S    I LR+  GL  G+   + + +W+ W+P  +R+ L+ +  SG  VG  +T+P+ GLLC+     GWP  FY  G  G+LW I W + +Y+TP DHPTI+  E  +I   +   I+++ K+V    +PW +I  S P WA      + DW  Y+ +   P +MK+VL F++S+ GFVSA P++ M I      +  D L+ R +LS   IRK+  C G+      VV + Y   ES+ +L++ LLT+G+ +   +  G   N +D++P+YAGLL G +NT+G+ +GF +   VG +T +  +  WR+VF++ +++ +AG + Y+ FGSGK QSWA
Sbjct:    1 MYAVRTCLSVAIVAMVSNSTVLIN---------------------GKKTVKPPEFAWSSEMQGLVLGSFYYGYAVLQIPAGWAVLKIGGKPI-FGFGILVASVLALVTPPIVKQSFIVFICLRIAQGLSLGLIASAHHCIWATWSPIFERASLLTIAGSGTLVGTIVTMPVTGLLCDS--PKGWPLAFYFIGSLGVLWFIAWQYFMYETPQDHPTITQAEIEFI--GVPWNIDEATKSV----VPWASILCSTPVWAANFTMFISDWCFYSMLICIPLFMKQVLHFSLSETGFVSALPFVLMTIVSPVSGMYADRLRARGVLSTGAIRKIFQCAGLAASSCFVVAVGY---ESKPFLSLALLTLGIGSFGLIAAGVGPNLIDLSPKYAGLLMGFSNTMGSLSGFLAPGVVGVLTVHGTLEEWRLVFWLTAVLSLAGILVYVAFGSGKKQSWA 419          
BLAST of slc17a-5 vs. Ensembl Nematostella
Match: EDO46366 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQH0])

HSP 1 Score: 269.626 bits (688), Expect = 4.198e-84
Identity = 169/484 (34.92%), Postives = 253/484 (52.27%), Query Frame = 1
Query:  130 RLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDV-NSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDKEK 1578
            R I+A++G  G    +S+R+NLSV ++ M N T                             + K+    W +QTR IILG FF+GY+V  IP G L +R   K  +   +++SS+  + TPLAAR S   +I LR++ GL  GV +PS+  L S WAPP++RS ++ +T +G   GN + L ++GLLC   F   WPS+FY  G  GI+W + W FL+YD+PS HP IS  EK YI  ++       +K V     PWR I TS+   AI++     +W   TF+TS PTY +EVL FN++ NG +SA PY       +    L D L    I++VT +RK+           I+V L +       +AV LL +     +    G +++ ++ AP+Y GLLF + N++G  TG  + + VG +T      + W+ V+++ + IYV GA+ +   G+ K Q W   NT    N   ++   EK
Sbjct:   11 RYILAVLGCFGLTVTFSLRVNLSVALVAMVNSTQTG--------------------------QPKEDYFSWDQQTRGIILGSFFYGYIVMLIPGGWLAERNGGKHFVGLGVLISSVLSLLTPLAARYSYKMLIVLRILEGLAQGVIYPSVNVLLSCWAPPEERSKMLVITWTGCQAGNIIGLVVSGLLCASRFQ--WPSVFYLFGASGIVWYLFWCFLVYDSPSVHPRISLEEKEYIVTAIGA---SQDKVVKKHPTPWRQILTSRAVLAISISFFCSNWGFCTFLTSLPTYFQEVLHFNITTNGLLSALPYFCQYFTSLPAGFLADWLIHSHIITVTEVRKIFT-----LASCIMVALGF--TNQPVVAVTLLCVLFMFQTIDTCGHWISPMEFAPRYCGLLFAIANSIGTSTGIAAPFVVGYLTNGQPTRDQWQKVYYIGAGIYVFGAVAFAALGTSKEQPW---NTPPEENLVPVDLPHEK 453          
BLAST of slc17a-5 vs. Ensembl Medaka
Match: slc17a5 (solute carrier family 17 member 5 [Source:NCBI gene;Acc:101165833])

HSP 1 Score: 330.487 bits (846), Expect = 4.665e-107
Identity = 177/483 (36.65%), Postives = 279/483 (57.76%), Query Frame = 1
Query:   88 KEELTEKYPLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLV-WSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMML-SSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQN 1530
            K+    + P C S R  +AL+   G   +YS+R+NLSV ++ M N T      NHS      ++V     +    +     ++  W  +T+  ILG FF+GY++TQIP G +  RF  KW L GF +L +++  + TPLAA     ++IA+RV+ G+  GV FP++Y +W+ WAPP +RS L+ ++  G  +G  ++LP++G +C   F  GW  +FY  G+ G++W +LWAF ++D+P+ HP IS+ E+ YI  SL  E++ S   +     PWRAI TS+P  AI V +  ++W  YT +T  PTYM ++L F++ QNG +SA PY+G  +  +    + D L++  +     +RK  + +GM+ P L +V   ++ C+   LAV  LT+  S       G  +NH+DIAP YAG+L G+TNT     G        A+T++N +  W++VF++ + I V GA+FY +FG G +Q WA+  
Sbjct:   23 KDGRVPRAPACCSSRYGLALLSCYGFFVVYSLRVNLSVAMVDMLNTTH---QTNHS------ASVCPAHPSPARPKNNHTANVYNWDSETQGWILGSFFYGYILTQIPGGYMAGRFGAKW-LMGFGILGTAVFTLLTPLAADLGASYLIAVRVLEGIGEGVSFPAMYTMWAAWAPPLERSRLLTISYLGAQLGTVISLPVSGQIC---FYLGWTYVFYIFGIIGLVWFVLWAFFVFDSPNTHPRISERERLYITNSLKNELSPSAGFI-----PWRAILTSRPLLAIVVAHFSYNWTFYTLLTLLPTYMNDILGFSIQQNGMLSALPYVGCALFAVVSGQIADYLRETCLYPTVTVRKCFSLVGMIGPALFLVAAGFIGCDYT-LAVTFLTLSSSLGGVSASGFNINHLDIAPSYAGILLGITNTFATIPGMVGPVIARALTQHNTIAEWQVVFYIAAAINVVGALFYSVFGRGTVQPWAVSE 486          
BLAST of slc17a-5 vs. Ensembl Medaka
Match: slc17a6a (solute carrier family 17 member 6 [Source:NCBI gene;Acc:101175075])

HSP 1 Score: 316.62 bits (810), Expect = 1.605e-100
Identity = 174/504 (34.52%), Postives = 270/504 (53.57%), Query Frame = 1
Query:   88 KEELTEKYPLCN------SKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDKEKE 1581
            +E+   K PLC+       +R I+A++  +G    + IR NL V I+ M N++ +    N   + K               EKAK     W  +T  +I G FFWGY+VTQIP G +  R +   +    ++L+S   MF P AAR+  G +I +R++ GL  GV +P+ + +WS+WAPP +RS L  L+  G + G  + +P+AG+L +Y    GW S+FY  G FGI W + W  + Y++P++HPTI++ E+ YIE+S+ GE             PWR   TS P +AI V N    W  Y  + S P Y +EV  F +S+ G +SA P++ M I       L D L+   I+S T +RK+MNC G      +++++ Y   +   ++ ++L +G S  +    G  VNH+DIAP+YA +L G++N +G  +G      VGA+TKN     W+ VF + S+++  G +FY IF SG+ Q WA            +++D+  E
Sbjct:   50 REDPERKAPLCDCTCFGLPRRYIIAILSGLGFCISFGIRCNLGVAIVSMVNNSTIH--QNGKIIVK---------------EKAK---FNWDPETVGMIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAIVLTSTLNMFIPSAARSHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATLSFCGSYAGAVIAMPLAGVLVQY---TGWSSVFYVYGSFGIFWYMFWILVSYESPAEHPTITEEERRYIEESI-GESAQLMGPSEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLLSALPHLVMTIIVPLGGQLADYLRSHNIMSTTMVRKIMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFA--ISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKNKTREEWQYVFLIASLVHYGGVVFYGIFASGEKQPWADPEETKEEKCGFIDEDELAE 527          
BLAST of slc17a-5 vs. Ensembl Medaka
Match: SLC17A6 (vesicular glutamate transporter 2.1 [Source:NCBI gene;Acc:101166288])

HSP 1 Score: 315.079 bits (806), Expect = 4.974e-100
Identity = 175/504 (34.72%), Postives = 270/504 (53.57%), Query Frame = 1
Query:   88 KEELTEKYPLCN------SKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDKEKE 1581
            +E   +K PLC+       +R I+A++  +G    + IR NL V I+ M N++ +    N   + K               EKAK     W  +T  +I G FFWGY+VTQIP G +  R +   +    ++L+S   MF P AAR   G +I +R++ GL  GV +P+ + +WS+WAPP +RS L  ++  G + G  + +P+AG+L +Y    GW S+FY  G  GI W I W  + Y++P+DHPTI+D E+ YIE+S+ GE    +        PWR   TS P +AI V N    W  Y  + S P Y +EV  F +S+ G +SA P++ M I       L D L+ + IL+ T +RK+MNC G      +++++ Y   +   ++ ++L +G S  +    G  VNH+DIAP+YA +L G++N +G  +G      VGA+TKN     W+ VF + S+++  G +FY IF SG+ Q WA            +++D+  E
Sbjct:   46 REAAEKKPPLCDCSCFGLPRRYIIAIMSGMGFCISFGIRCNLGVAIVGMVNNSTIH--QNGKIIIK---------------EKAK---FNWDPETVGMIHGSFFWGYIVTQIPGGYICSRLAANRVFGAAIVLTSTLNMFIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATISFCGSYAGAVIAMPLAGILVQY---SGWSSVFYVYGCVGIFWYIFWILVSYESPADHPTITDEERCYIEESI-GESARLSGPGEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLLSALPHLVMTIIVPIGGQLADHLRSKNILTTTTVRKIMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFA--ISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKNKTREEWQYVFLIASLVHYGGVVFYGIFASGEKQPWADPELTSEEKCGFIDEDELAE 523          
BLAST of slc17a-5 vs. Ensembl Medaka
Match: slc17a8 (vesicular glutamate transporter 3 [Source:NCBI gene;Acc:101165727])

HSP 1 Score: 310.457 bits (794), Expect = 2.938e-98
Identity = 168/485 (34.64%), Postives = 264/485 (54.43%), Query Frame = 1
Query:  127 KRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDKEKE 1581
            KR I+A++  +G    + IR NL V I+ M N+  V +          F+                     W  +T  +I G FFWGY+VTQIP G +  + S   +    + L+S+  MF P AAR   G ++ +R++ GL  GV +P+ + LW++WAPP +RS L   +  G + G  + +P+AG+L +Y    GWPS+FY  G+FGI+W ++W  L Y +P+DHPTI++ E+ YIE ++   +N  +K       PWR   TS P +AI V N    W  Y  + S P Y +EV  F +S+ G +SA P++ M I       L D L+ +KI+S T +RKLMNC G      +++++ +       ++ ++L +G S  +    G  VNH+DIAP+YA +L G++N +G  +G      VGA+TKN     W+ VF + S+++ +G IFY IF SG+ Q WA   +   +   ++++D+  E
Sbjct:   72 KRYIIAILSGLGFCISFGIRCNLGVAIVEMVNNNTVYINGTPVLQRAQFN---------------------WDPETVGLIHGSFFWGYIVTQIPGGFIANKLSANRVFGAAIFLTSVLNMFIPSAARVHYGCVLFVRILQGLVEGVTYPACHGLWAKWAPPLERSRLATTSFCGSYAGAVIAMPLAGVLVQY---VGWPSVFYIYGVFGIMWYVMWLLLAYGSPADHPTITEEERLYIEAAIGETVNQLSK----FRTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFPISKVGLLSAVPHMVMTIVVPIGGQLADFLRSKKIMSTTNVRKLMNCGGFGMEATLLLVVGFSHTRGVAISFLVLAVGFSGFA--ISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGALTKNKTRLEWQHVFVIASMVHYSGVIFYAIFASGEQQDWANPESLSEDKCGIIDEDELAE 526          
BLAST of slc17a-5 vs. Ensembl Medaka
Match: ENSORLT00000010015.2 (vesicular glutamate transporter 1-like [Source:NCBI gene;Acc:101167994])

HSP 1 Score: 298.901 bits (764), Expect = 2.161e-94
Identity = 163/483 (33.75%), Postives = 259/483 (53.62%), Query Frame = 1
Query:  127 KRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSV-MFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDK 1572
            +R I+A++  IG    + IR NL V ++ M N   V   +    V   F                      W  +T  +I G FFWGY+VTQIP G + Q+F+   + FGF ++++  + M  P AAR   G +I +R+  GL  GV +P+ + +W++WAPP +RS L      G + G  + +P+AG+L +Y    GW S+FY  G FG++W   W  + Y++P+ HPTI++ E+ YIE+S+ GE   +   V   + PWR   TS P +AI V N    W  Y  + S P Y +EV  F +S+ G VSA P++ M I       + D L+  +I++ T +RKLMNC G      +++++ +   +   +  ++L +G S  +    G  VNH+DIAP+YA +L G++N +G  +G      VGA+TK+     W+ VF + S+++  G IFY +F SG+ Q+WA           +L++D+
Sbjct:   13 RRYIIAILSGIGFCISFGIRCNLGVAVVSMVNSHKVLRGNKEVIVKAQFE---------------------WDPETVGMIHGSFFWGYIVTQIPGGFICQKFAANRV-FGFAIVATSCLNMLIPAAARMHFGCVIIVRIFQGLVEGVSYPACHGIWAKWAPPLERSRLATTAFCGSYAGAVIAMPLAGILVQY---SGWSSVFYVYGSFGVMWYCFWILVSYESPAAHPTITEEERKYIEESI-GE--SAQHTVTKFNTPWRCFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGIVSALPHLVMTIIVPIGGQIADYLRSNQIMTTTNVRKLMNCGGFGMEATLLLVVGFSHTKGVAITFLVLAVGFSGFA--ISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQGVFLIASLVHYGGVIFYGLFASGEKQTWAEPEELSVEKCGILDEDE 465          
BLAST of slc17a-5 vs. Planmine SMEST
Match: SMESG000060615.1 (SMESG000060615.1)

HSP 1 Score: 1029.62 bits (2661), Expect = 0.000e+0
Identity = 503/505 (99.60%), Postives = 504/505 (99.80%), Query Frame = 1
Query:   76 MITMKEELTEKYPLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDKEKEAEC 1590
            MITMKEELTEKYPLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFM+ALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNT DSNNFSLLNKDKEKEAEC
Sbjct:    1 MITMKEELTEKYPLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMMALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTKDSNNFSLLNKDKEKEAEC 505          
BLAST of slc17a-5 vs. Planmine SMEST
Match: SMESG000060615.1 (SMESG000060615.1)

HSP 1 Score: 1024.23 bits (2647), Expect = 0.000e+0
Identity = 500/502 (99.60%), Postives = 501/502 (99.80%), Query Frame = 1
Query:   85 MKEELTEKYPLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDKEKEAEC 1590
            MKEELTEKYPLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFM+ALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNT DSNNFSLLNKDKEKEAEC
Sbjct:    1 MKEELTEKYPLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMMALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTKDSNNFSLLNKDKEKEAEC 502          
BLAST of slc17a-5 vs. Planmine SMEST
Match: SMESG000060615.1 (SMESG000060615.1)

HSP 1 Score: 1017.68 bits (2630), Expect = 0.000e+0
Identity = 498/500 (99.60%), Postives = 499/500 (99.80%), Query Frame = 1
Query:   76 MITMKEELTEKYPLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDKE 1575
            MITMKEELTEKYPLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFM+ALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNT DSNNFSLLNKDKE
Sbjct:    1 MITMKEELTEKYPLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMMALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTKDSNNFSLLNKDKE 500          
BLAST of slc17a-5 vs. Planmine SMEST
Match: SMESG000060615.1 (SMESG000060615.1)

HSP 1 Score: 1011.13 bits (2613), Expect = 0.000e+0
Identity = 495/497 (99.60%), Postives = 496/497 (99.80%), Query Frame = 1
Query:   85 MKEELTEKYPLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDKE 1575
            MKEELTEKYPLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFM+ALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNT DSNNFSLLNKDKE
Sbjct:    1 MKEELTEKYPLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMMALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVNSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTKDSNNFSLLNKDKE 497          
BLAST of slc17a-5 vs. Planmine SMEST
Match: SMESG000066847.1 (SMESG000066847.1)

HSP 1 Score: 324.709 bits (831), Expect = 9.033e-105
Identity = 180/487 (36.96%), Postives = 285/487 (58.52%), Query Frame = 1
Query:   88 KEELTEKY--PLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNHTAVDLMDNHSFVPK-NFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGVFFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFMIALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTLPIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDGEKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNGYTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKRKILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATSALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDV-NSWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTN 1536
             E   EK+    C   R ++A+ GF+G   +Y++R+NLSV IL M N++A+      +  P+   SN++K +         KDG+ VW +  + ++LG FFWGY+  QIPAG +  +   KW     ++ +SL  + TP+AAR   G++I LR++ G    + +P+++ +   WAP  + + + G+  SG   G  + L  +  L E    GGWPS+FY  G+ GI+W I+W+F+ + TP++HP I+  EK +IE S+     + + NV     PW++I  S P WAI+V N    W+ YT +TS P Y + VL F+++QNG+V+A PY+   I  +    + DI++ RK LS T  RKL N +GM    + +V ++Y+ C ++ L V  L I ++  ++   G  VNH+D+APQYAG+L+G+TN++    G      VG +T + +    W+IVF++ S I + GAIF+LIFGSG  QSWAI+ + 
Sbjct:   31 SESPKEKWYNRFCIPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIK-DPGLNLTPECPNSNLSKVT---------KDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYIPGIIGIVWFIIWSFVAFSTPANHPRITMTEKRFIESSVNLSSEERHSNV-----PWKSILLSLPVWAISVANFCSMWSLYTLLTSLPLYFEHVLGFSIAQNGYVNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTVGMTINAIFIVAISYIGC-NKVLVVTFLCIAVALGTSNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKQWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSE 501          
The following BLAST results are available for this feature:
BLAST of slc17a-5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC17A54.514e-10135.67solute carrier family 17 member 5 [Source:HGNC Sym... [more]
SLC17A61.416e-9734.00solute carrier family 17 member 6 [Source:HGNC Sym... [more]
SLC17A71.704e-9434.16solute carrier family 17 member 7 [Source:HGNC Sym... [more]
SLC17A81.881e-9332.73solute carrier family 17 member 8 [Source:HGNC Sym... [more]
SLC17A73.924e-9334.48solute carrier family 17 member 7 [Source:HGNC Sym... [more]
back to top
BLAST of slc17a-5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc-17.23.162e-9932.93Uncharacterized transporter slc-17.2 [Source:UniP... [more]
slc-17.16.572e-7829.94SLC (SoLute Carrier) homolog [Source:UniProtKB/Tr... [more]
slc-17.17.191e-7829.94SLC (SoLute Carrier) homolog [Source:UniProtKB/Tr... [more]
eat-41.783e-7434.66Probable vesicular glutamate transporter eat-4 [S... [more]
eat-43.181e-7434.66Probable vesicular glutamate transporter eat-4 [S... [more]
back to top
BLAST of slc17a-5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Picot5.317e-9633.13gene:FBgn0024315 transcript:FBtr0087115[more]
CG69781.609e-9535.12gene:FBgn0029727 transcript:FBtr0070715[more]
MFS103.731e-9531.69gene:FBgn0030452 transcript:FBtr0339677[more]
MFS103.731e-9531.69gene:FBgn0030452 transcript:FBtr0073724[more]
MFS103.731e-9531.69gene:FBgn0030452 transcript:FBtr0339678[more]
back to top
BLAST of slc17a-5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc17a51.643e-9934.51solute carrier family 17 member 5 [Source:ZFIN;Acc... [more]
slc17a84.909e-9935.27solute carrier family 17 member 8 [Source:NCBI gen... [more]
slc17a86.616e-9935.27solute carrier family 17 member 8 [Source:NCBI gen... [more]
slc17a6b5.944e-9835.26solute carrier family 17 member 6b [Source:NCBI ge... [more]
slc17a6a1.809e-9734.27solute carrier family 17 member 6a [Source:NCBI ge... [more]
back to top
BLAST of slc17a-5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nbeal23.181e-10237.97neurobeachin like 2 [Source:Xenbase;Acc:XB-GENE-60... [more]
lrpap16.250e-9934.19LDL receptor related protein associated protein 1 ... [more]
lrpap19.422e-9933.84LDL receptor related protein associated protein 1 ... [more]
lrpap11.798e-9834.19LDL receptor related protein associated protein 1 ... [more]
lrpap12.058e-9834.19LDL receptor related protein associated protein 1 ... [more]
back to top
BLAST of slc17a-5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc17a58.448e-10336.49solute carrier family 17 (anion/sugar transporter)... [more]
Slc17a76.449e-9834.74solute carrier family 17 (sodium-dependent inorgan... [more]
Slc17a62.618e-9733.80solute carrier family 17 (sodium-dependent inorgan... [more]
Slc17a76.725e-9534.48solute carrier family 17 (sodium-dependent inorgan... [more]
Slc17a88.794e-9533.61solute carrier family 17 (sodium-dependent inorgan... [more]
back to top
BLAST of slc17a-5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9MZD1|S17A5_SHEEP7.296e-10336.64Sialin OS=Ovis aries OX=9940 GN=SLC17A5 PE=2 SV=1[more]
sp|Q8BN82|S17A5_MOUSE5.909e-10236.49Sialin OS=Mus musculus OX=10090 GN=Slc17a5 PE=1 SV... [more]
sp|Q9NRA2|S17A5_HUMAN2.168e-10035.67Sialin OS=Homo sapiens OX=9606 GN=SLC17A5 PE=1 SV=... [more]
sp|Q1L8X9|VGLU3_DANRE3.706e-9835.27Vesicular glutamate transporter 3 OS=Danio rerio O... [more]
sp|Q03567|SL172_CAEEL4.022e-9832.93Uncharacterized transporter slc-17.2 OS=Caenorhabd... [more]
back to top
BLAST of slc17a-5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YK800.000e+0100.00Slc17a-5 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A1S3H0J29.250e-14443.43sialin isoform X1 OS=Lingula unguis OX=7574 GN=LOC... [more]
A0A1S3GXU69.279e-14443.17sialin isoform X2 OS=Lingula unguis OX=7574 GN=LOC... [more]
R7UX605.388e-14142.54MFS domain-containing protein OS=Capitella teleta ... [more]
A0A4Z2CSR01.335e-13641.63Sialin isoform 2 OS=Schistosoma japonicum OX=6182 ... [more]
back to top
BLAST of slc17a-5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch1073-513e17.12.182e-10035.71sialin-like [Source:NCBI gene;Acc:103042153][more]
slc17a6b6.043e-9834.00vesicular glutamate transporter 2.1 [Source:NCBI g... [more]
slc17a6b1.533e-9734.27vesicular glutamate transporter 2.1 [Source:NCBI g... [more]
slc17a86.708e-9735.06solute carrier family 17 member 8 [Source:NCBI gen... [more]
slc17a84.357e-9635.06solute carrier family 17 member 8 [Source:NCBI gen... [more]
back to top
BLAST of slc17a-5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc17a6b1.857e-7330.53solute carrier family 17 member 6b [Source:NCBI ge... [more]
ENSPMAT00000010352.11.996e-6039.77pep scaffold:Pmarinus_7.0:GL492704:416:4460:1 gene... [more]
back to top
BLAST of slc17a-5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc17a-5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO486712.169e-10339.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455146.161e-10336.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317044.151e-9935.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317123.078e-8634.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463664.198e-8434.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc17a-5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc17a54.665e-10736.65solute carrier family 17 member 5 [Source:NCBI gen... [more]
slc17a6a1.605e-10034.52solute carrier family 17 member 6 [Source:NCBI gen... [more]
SLC17A64.974e-10034.72vesicular glutamate transporter 2.1 [Source:NCBI g... [more]
slc17a82.938e-9834.64vesicular glutamate transporter 3 [Source:NCBI gen... [more]
ENSORLT00000010015.22.161e-9433.75vesicular glutamate transporter 1-like [Source:NCB... [more]
back to top
BLAST of slc17a-5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060615.10.000e+099.60SMESG000060615.1[more]
SMESG000060615.10.000e+099.60SMESG000060615.1[more]
SMESG000060615.10.000e+099.60SMESG000060615.1[more]
SMESG000060615.10.000e+099.60SMESG000060615.1[more]
SMESG000066847.19.033e-10536.96SMESG000066847.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30022974
GenBankAKN21528.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022974 ID=SMED30022974|Name=slc17a-5|organism=Schmidtea mediterranea sexual|type=transcript|length=1674bp
TTTATTATTTTAAATGTATTTCAAGGTCAAGTTTTTAATTAGAAATTTCA
TCATAATTATTAACTGTAGAAAACGATGATTACCATGAAAGAAGAGTTAA
CGGAGAAATATCCATTGTGTAATTCCAAGCGATTGATTGTTGCTTTAATT
GGATTTATTGGCACGTTGAATTTGTATTCTATTCGAATGAATTTGAGTGT
TGGCATATTATGCATGACGAATCATACTGCTGTCGATCTTATGGATAATC
ATAGTTTTGTTCCGAAGAATTTTTCCAATGTCACCAAGACATCGTGCGCG
TTATTGGGAGAAGAGAAAGCAAAGGACGGTGATTTAGTATGGAGCAAGCA
AACTCGTAGTATCATTCTAGGAGTGTTTTTCTGGGGTTATTTGGTGACTC
AGATACCTGCTGGTATGCTCGTCCAACGATTCAGTCCGAAATGGATATTA
TTTGGATTTATGATGTTGTCATCGTTGTCAGTGATGTTTACTCCGTTGGC
AGCTCGGACTAGTGTTGGGTTTATGATTGCATTGAGGGTGATATGTGGGC
TGTGTTCGGGAGTCTGGTTTCCTAGCATTTATCAGCTCTGGTCTCGGTGG
GCACCGCCGCAAGATCGATCCCTATTGGTTGGGCTGACTAATTCAGGTCT
TCATGTTGGAAACGCCTTAACTCTGCCAATTGCTGGATTGCTTTGTGAAT
ATGGATTTGCTGGAGGTTGGCCGTCTATATTTTATACCTCAGGTTTGTTC
GGAATATTATGGTGCATTCTTTGGGCATTTTTGATCTACGATACCCCTTC
TGACCATCCGACTATATCTGATGGTGAGAAAAATTATATTGAAAAAAGCT
TATGCGGTGAAATAAATGATAGTAATAAAAATGTAAATATTTGTGATTTG
CCATGGAGAGCAATAGCTACTTCTAAACCGTTCTGGGCAATTGCTGTAAT
CAACATCATGTTCGACTGGAATGGGTATACATTCATAACAAGCACCCCTA
CATACATGAAAGAAGTACTGAAATTCAACATGTCCCAAAACGGATTCGTT
TCTGCAGCTCCATATATTGGGATGGGTATTGGTCAAATATGCTTTGCAAT
ACTCTGCGATATATTACAGAAACGGAAAATACTCTCGGTGACAAGAATTC
GGAAATTAATGAATTGTTTAGGCATGTTGACTCCCGGATTGATAGTCGTC
ATTCTTGCCTATCTCAAATGTGAAAGCCGATATTTGGCAGTCGTTTTGCT
AACTATCGGATTATCTGCCACATCTGCACTATTTGTGGGTGCTTTTGTCA
ATCATGTGGATATCGCTCCACAATACGCCGGTCTTCTTTTCGGACTCACC
AATACACTCGGGGCTTTTACTGGATTCTTTTCCTCCTATTTTGTAGGAGC
TGTCACCAAAAATAATGATGTAAACAGTTGGAGGATCGTGTTCTTCGTAT
GCTCCATCATTTACGTGGCAGGTGCAATTTTCTATCTTATATTTGGTTCT
GGCAAATTGCAGTCTTGGGCCATACAGAATACTAACGATTCAAATAATTT
TAGTCTTTTAAACAAGGATAAAGAGAAAGAAGCAGAATGCTAAGTTTGAT
GGAATCAAATTGATGCAATAATCATAACTTTATATATTAAAAAAATTTTG
TATGGAAATTATATTGTATTCGTC
back to top

protein sequence of SMED30022974-orf-1

>SMED30022974-orf-1 ID=SMED30022974-orf-1|Name=SMED30022974-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=506bp
MITMKEELTEKYPLCNSKRLIVALIGFIGTLNLYSIRMNLSVGILCMTNH
TAVDLMDNHSFVPKNFSNVTKTSCALLGEEKAKDGDLVWSKQTRSIILGV
FFWGYLVTQIPAGMLVQRFSPKWILFGFMMLSSLSVMFTPLAARTSVGFM
IALRVICGLCSGVWFPSIYQLWSRWAPPQDRSLLVGLTNSGLHVGNALTL
PIAGLLCEYGFAGGWPSIFYTSGLFGILWCILWAFLIYDTPSDHPTISDG
EKNYIEKSLCGEINDSNKNVNICDLPWRAIATSKPFWAIAVINIMFDWNG
YTFITSTPTYMKEVLKFNMSQNGFVSAAPYIGMGIGQICFAILCDILQKR
KILSVTRIRKLMNCLGMLTPGLIVVILAYLKCESRYLAVVLLTIGLSATS
ALFVGAFVNHVDIAPQYAGLLFGLTNTLGAFTGFFSSYFVGAVTKNNDVN
SWRIVFFVCSIIYVAGAIFYLIFGSGKLQSWAIQNTNDSNNFSLLNKDKE
KEAEC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
GO:0005313L-glutamate transmembrane transporter activity
GO:0015293symporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000065flame cell
PLANA:0000087proximal tubule
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR011701MFS
IPR020846MFS_dom
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0006810transport
GO:0006811ion transport
GO:0006814sodium ion transport
GO:0006836neurotransmitter transport
GO:0050803regulation of synapse structure or activity
GO:0050957equilibrioception
GO:0060005vestibular reflex
GO:0089711L-glutamate transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
GO:0030054cell junction
GO:0030672synaptic vesicle membrane
GO:0031410cytoplasmic vesicle
GO:0043005neuron projection
GO:0045202synapse
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 46..436
e-value: 3.6E-55
score: 187.3
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 273..479
e-value: 5.8E-31
score: 109.4
NoneNo IPR availablePANTHERPTHR11662SODIUM-DEPENDENT PHOSPHATE TRANSPORTERScoord: 17..481
NoneNo IPR availableCDDcd17318MFS_SLC17coord: 23..474
e-value: 2.23081E-135
score: 395.064
NoneNo IPR availableTMHMMTMhelixcoord: 94..116
NoneNo IPR availableTMHMMTMhelixcoord: 215..237
NoneNo IPR availableTMHMMTMhelixcoord: 183..205
NoneNo IPR availableTMHMMTMhelixcoord: 386..408
NoneNo IPR availableTMHMMTMhelixcoord: 361..380
NoneNo IPR availableTMHMMTMhelixcoord: 322..344
NoneNo IPR availableTMHMMTMhelixcoord: 123..145
NoneNo IPR availableTMHMMTMhelixcoord: 285..307
NoneNo IPR availableTMHMMTMhelixcoord: 20..38
NoneNo IPR availableTMHMMTMhelixcoord: 452..474
NoneNo IPR availableTMHMMTMhelixcoord: 420..442
NoneNo IPR availableTMHMMTMhelixcoord: 149..171
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 18..478
score: 17.609
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 12..474