anaphase-promoting complex subunit 1

Overview
Nameanaphase-promoting complex subunit 1
Smed IDSMED30022963
Length (bp)5663
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of anaphase-promoting complex subunit 1 (SMED30022963) t-SNE clustered cells

Violin plots show distribution of expression levels for anaphase-promoting complex subunit 1 (SMED30022963) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of anaphase-promoting complex subunit 1 (SMED30022963) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for anaphase-promoting complex subunit 1 (SMED30022963) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022963

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30022963SMESG000010770.1 SMESG000012375.1 tr5_7361mu_Smed_v1PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30022963SMESG000010770.1 SMESG000012375.1 tr5_7361mu_Smed_v1PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
esophagusSMED30022963SMESG000010770.1 SMESG000012375.1 tr5_7361mu_Smed_v1PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
pharynx pouchSMED30022963SMESG000010770.1 SMESG000012375.1 tr5_7361mu_Smed_v1PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30022963SMESG000010770.1 SMESG000012375.1 tr5_7361mu_Smed_v1PMID:25558068
Reuter et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
posterior region of the whole animalSMED30022963SMESG000010770.1 SMESG000012375.1 tr5_7361mu_Smed_v1PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
X1 cellSMED30022963SMESG000012375.1 SmedASXL_017297SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30022963SMESG000012375.1 SmedASXL_017297SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30022963SMESG000012375.1 Contig39113newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022963SMESG000012375.1 Contig39113uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of anaphase-promoting complex subunit 1 vs. Ensembl Human
Match: ANAPC1 (anaphase promoting complex subunit 1 [Source:HGNC Symbol;Acc:HGNC:19988])

HSP 1 Score: 338.191 bits (866), Expect = 6.552e-94
Identity = 316/1168 (27.05%), Postives = 550/1168 (47.09%), Query Frame = 2
Query: 1595 MNRLSDPTDYGFTIHTQSELALRLYLPEMVRLHXXXXXXXXXXXXXPIDTGMTMLCRWYSLNRAVDNNESASAEWRRFVEFLLENMGFARNRQNKAGQQQTQQETHSIVQDVKELCLDNNNGHGIASSSADTDVSMDEICSKKLRTNSGLYSIERR-CLNERDGL----EEYSALCYNVTDRLLSQHAPTVLFCLHLVYECEKLNYSFCRHFKNLAALNCSIACSIGARQYLDYYLQDNPDLMADIAQL----PSLAQYILIPSDITATWNPQPPNWSEILFNLMGTQSPIPNNYRYPIIEDLSEMLIQLVKIWLVMFRPDTLLDNPTSELNRYFYRINFNMSGIPCRFPVHFCHDLNRANRNETLKIDDIYRRTATYLSEIKFHVNDLDFMNDGLASIFRIVFFHCNKFPELYSILHRADLDMQRQLILPIVQESAVPKVLTTPLKKFRSVSEPRRNCHAYWTNNVKPPMAMPKCLDFINRTDNNYLMHVLDSDPIVQLSYPDIRIHEAYKMIQSCCPIKLDAGICSNFTIEDGDTLSTPLKEELEGYLKIINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGKFSLSESG---KPQTIESNASTKVWPNFHNGVAAGLMIAPMNESVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPP-------MDVELTSVTAGFSVGLIMFQQGH--IFDREHN-PEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYMNSMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKAFLIKPTGI---QEKYLDTVNDSYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINIKSNIELMPNVN---RNHYDWALSTLLLSACMISAGSGNLTLLRISRYLQSIHHPKDCG--NYGVFMTYXXXXXXXXXXXXXXXXXNSHRSAAILVIAFFPRFPPTYNGRRYHLQSLRHLYVIATRPRVMCAVDLDT 5008
            ++ + DP     T+   +   +R+ +PE+    +V+ CL  +K +LP +  + ML +WY+++ A     S  +EW  FV  L+  MG+  +R         +     ++   K              S   +D   + + +     N   + + R  CL+  +      E++S      +  LL  H P + F LHLVYE  KLN        +L  L   +A  +    Y+D+Y +D P L+    Q+    P    ++  PS  T+    +PP+  + + + +  +   P  Y  P I + S +++  + I L +   ++L+ + +S+   Y  RI       P +  V    + NR +   +  +  +  R   +++ + F + DL+ +  G+A   R   +HC + P           D    + L I ++    +     L K +SV           +++V       +  D +N   N+ +M ++ S+        D+R+ +  +++QS  P++++  +     + D + +     EE E  L  + CQRT +LP+GRGM  L        T+ LP+P L LTG+     +        I+   +   W +FHNGVAAGL IAP ++ +D  WI+   P       EL+ E AG L  LGLNGHL KL+   I   +   +EM ++ LL+G+SA  +G+ +  +++ +S H   L+P    ++D +P   QV+A++  GL+   +A R  A + L E+GR          PP        D E  S+ AG ++G++    G   I   + N PE+L +   Y+ G +R                    R     +  K   P        ++Q K     EG+  N D+T  GA +A+ +IY+ + +  IA+ L  P+T YLL+ ++   L  R +AR LI+W  + P+  WV+S +PQ +   +  +    +   ++  L+T++ +++ ++ G+C  +G R+AG++N +A   +  + +  +   S     PN +    ++ +  LS +LLS  M+ AGSGNL +L++ R+L    H K  G  NYG  + + +++GLLFLGGG+ +LS S+ S A L+ A +P FP      RYHLQ+LRHLYV+A  PR++  VD+DT
Sbjct:  119 IHSIRDPVHNRVTLELSNGSMVRITIPEIATSELVQTCLQAIKFILPKEIAVQMLVKWYNVHSA-PGGPSYHSEWNLFVTCLMNMMGYNTDRLAWTRNFDFEGSLSPVIAPKKA-----------RPSETGSDDDWEYLLNSDYHQNVESHLLNRSLCLSPSEASQMKDEDFSQNLSLDSSTLLFTHIPAIFFVLHLVYEELKLNTLMGEGICSLVELLVQLARDLKLGPYVDHYYRDYPTLVRTTGQVCTIDPGQTGFMHHPSFFTS----EPPSIYQWVSSCLKGEGMPPYPY-LPGICERSRLVV--LSIALYILGDESLVSDESSQ---YLTRITI----APQKLQVE--QEENRFSFRHSTSVSSLAERLVVWMTNVGFTLRDLETLPFGIALPIRDAIYHCREQPAS---------DWPEAVCLLIGRQDLSKQACEGNLPKGKSV----------LSSDVPSGTETEEEDDGMNDM-NHEVMSLIWSE--------DLRVQDVRRLLQSAHPVRVN--VVQYPELSDHEFI-----EEKENRLLQL-CQRTMALPVGRGMFTL-FSYHPVPTEPLPIPKLNLTGRAPPRNTTVDLNSGNIDVPPNMTSWASFHNGVAAGLKIAPASQ-IDSAWIVYNKPK----HAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKGHEMTSIGLLLGVSAAKLGTMDMSITRLLSIHIPALLPPTSTELD-VPHNVQVAAVVGIGLVYQGTAHRHTAEVLLAEIGR----------PPGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLNVPEQLYQ---YMVGGHR--------------------RFQTGMHREKHKSP--------SYQIK-----EGDTINVDVTCPGATLALAMIYLKTNNRSIADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNSKWVDSNVPQIIRENSISLSEIELPCSEDLNLETLSQAHVYIIAGACLSLGFRFAGSENLSAFNCLHKFAKDFMTYLS----APNASVTGPHNLETCLSVVLLSLAMVMAGSGNLKVLQLCRFL----HMKTGGEMNYGFHLAHHMALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPAHSTDNRYHLQALRHLYVLAAEPRLLVPVDVDT 1161          
BLAST of anaphase-promoting complex subunit 1 vs. Ensembl Human
Match: ANAPC1 (anaphase promoting complex subunit 1 [Source:HGNC Symbol;Acc:HGNC:19988])

HSP 1 Score: 338.576 bits (867), Expect = 3.334e-93
Identity = 322/1196 (26.92%), Postives = 559/1196 (46.74%), Query Frame = 2
Query: 1511 SLLNALVYQPDDPFDDVGMEMSISDINSMNRLSDPTDYGFTIHTQSELALRLYLPEMVRLHXXXXXXXXXXXXXPIDTGMTMLCRWYSLNRAVDNNESASAEWRRFVEFLLENMGFARNRQNKAGQQQTQQETHSIVQDVKELCLDNNNGHGIASSSADTDVSMDEICSKKLRTNSGLYSIERR-CLNERDGL----EEYSALCYNVTDRLLSQHAPTVLFCLHLVYECEKLNYSFCRHFKNLAALNCSIACSIGARQYLDYYLQDNPDLMADIAQL----PSLAQYILIPSDITATWNPQPPNWSEILFNLMGTQSPIPNNYRYPIIEDLSEMLIQLVKIWLVMFRPDTLLDNPTSELNRYFYRINFNMSGIPCRFPVHFCHDLNRANRNETLKIDDIYRRTATYLSEIKFHVNDLDFMNDGLASIFRIVFFHCNKFPELYSILHRADLDMQRQLILPIVQESAVPKVLTTPLKKFRSVSEPRRNCHAYWTNNVKPPMAMPKCLDFINRTDNNYLMHVLDSDPIVQLSYPDIRIHEAYKMIQSCCPIKLDAGICSNFTIEDGDTLSTPLKEELEGYLKIINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGKFSLSESG---KPQTIESNASTKVWPNFHNGVAAGLMIAPMNESVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPP-------MDVELTSVTAGFSVGLIMFQQGH--IFDREHN-PEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYMNSMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKAFLIKPTGI---QEKYLDTVNDSYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINIKSNIELMPNVN---RNHYDWALSTLLLSACMISAGSGNLTLLRISRYLQSIHHPKDCG--NYGVFMTYXXXXXXXXXXXXXXXXXNSHRSAAILVIAFFPRFPPTYNGRRYHLQSLRHLYVIATRPRVMCAVDLDT 5008
            S L+  +Y  D  F  +G          ++ + DP     T+   +   +R+ +PE+    +V+ CL  +K +LP +  + ML +WY+++ A     S  +EW  FV  L+  MG+  +R         +     ++   K              S   +D   + + +     N   + + R  CL+  +      E++S      +  LL  H P + F LHLVYE  KLN        +L  L   +A  +    Y+D+Y +D P L+    Q+    P    ++  PS  T+    +PP+  + + + +  +   P  Y  P I + S +++  + I L +   ++L+ + +S+   Y  RI       P +  V    + NR +   +  +  +  R   +++ + F + DL+ +  G+A   R   +HC + P           D    + L I ++    +     L K +SV           +++V       +  D +N   N+ +M ++ S+        D+R+ +  +++QS  P++++  +     + D + +     EE E  L  + CQRT +LP+GRGM  L        T+ LP+P L LTG+     +        I+   +   W +FHNGVAAGL IAP ++ +D  WI+   P       EL+ E AG L  LGLNGHL KL+   I   +   +EM ++ LL+G+SA  +G+ +  +++ +S H   L+P    ++D +P   QV+A++  GL+   +A R  A + L E+GR          PP        D E  S+ AG ++G++    G   I   + N PE+L +   Y+ G +R                    R     +  K   P        ++Q K     EG+  N D+T  GA +A+ +IY+ + +  IA+ L  P+T YLL+ ++   L  R +AR LI+W  + P+  WV+S +PQ +   +  +    +   ++  L+T++ +++ ++ G+C  +G R+AG++N +A   +  + +  +   S     PN +    ++ +  LS +LLS  M+ AGSGNL +L++ R+L    H K  G  NYG  + + +++GLLFLGGG+ +LS S+ S A L+ A +P FP      RYHLQ+LRHLYV+A  PR++  VD+DT
Sbjct:  564 SKLHDSLYNEDCTFQQLG--------TYIHSIRDPVHNRVTLELSNGSMVRITIPEIATSELVQTCLQAIKFILPKEIAVQMLVKWYNVHSA-PGGPSYHSEWNLFVTCLMNMMGYNTDRLAWTRNFDFEGSLSPVIAPKKA-----------RPSETGSDDDWEYLLNSDYHQNVESHLLNRSLCLSPSEASQMKDEDFSQNLSLDSSTLLFTHIPAIFFVLHLVYEELKLNTLMGEGICSLVELLVQLARDLKLGPYVDHYYRDYPTLVRTTGQVCTIDPGQTGFMHHPSFFTS----EPPSIYQWVSSCLKGEGMPPYPY-LPGICERSRLVV--LSIALYILGDESLVSDESSQ---YLTRITI----APQKLQVE--QEENRFSFRHSTSVSSLAERLVVWMTNVGFTLRDLETLPFGIALPIRDAIYHCREQPAS---------DWPEAVCLLIGRQDLSKQACEGNLPKGKSV----------LSSDVPSGTETEEEDDGMNDM-NHEVMSLIWSE--------DLRVQDVRRLLQSAHPVRVN--VVQYPELSDHEFI-----EEKENRLLQL-CQRTMALPVGRGMFTL-FSYHPVPTEPLPIPKLNLTGRAPPRNTTVDLNSGNIDVPPNMTSWASFHNGVAAGLKIAPASQ-IDSAWIVYNKP----KHAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKGHEMTSIGLLLGVSAAKLGTMDMSITRLLSIHIPALLPPTSTELD-VPHNVQVAAVVGIGLVYQGTAHRHTAEVLLAEIGR----------PPGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLNVPEQLYQ---YMVGGHR--------------------RFQTGMHREKHKSP--------SYQIK-----EGDTINVDVTCPGATLALAMIYLKTNNRSIADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNSKWVDSNVPQIIRENSISLSEIELPCSEDLNLETLSQAHVYIIAGACLSLGFRFAGSENLSAFNCLHKFAKDFMTYLS----APNASVTGPHNLETCLSVVLLSLAMVMAGSGNLKVLQLCRFL----HMKTGGEMNYGFHLAHHMALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPAHSTDNRYHLQALRHLYVLAAEPRLLVPVDVDT 1626          
BLAST of anaphase-promoting complex subunit 1 vs. Ensembl Celegans
Match: mat-2 (Anaphase-promoting complex subunit 1 [Source:UniProtKB/Swiss-Prot;Acc:O18191])

HSP 1 Score: 171.4 bits (433), Expect = 2.108e-42
Identity = 186/713 (26.09%), Postives = 311/713 (43.62%), Query Frame = 2
Query: 3077 DIRIHEAYKMIQSCCPIKLDAGICSNFTIEDGDTLSTPLKEELEGYLKIINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGKFSLSE-SGKPQTIESNASTKVWPNFHNGVAAGLMIAPMNE-SVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPPMDVELTSVTAGFSVGLIMFQQGH------IFDREHNPEELVRLLSYLKGSYRIQ----PKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYMNSMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKAFLIKPTGI------------------QEKYL------DTVNDSYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINIKSNIELMPNVNRNH---------YDWA------LSTLLLSACMISAGSGNLTLLRISRYLQSIHHPKD-----CGNYGVFMTYXXXXXXXXXXXXXXXXXNSHRSAAILVIAFFPRFPPTYNGRRYHLQSLRHLYVIATRPRVMCAVDLDTMIAVPVESRVVFK 5047
            DIR+H    M+ S  PI +   I       + D +     +EL+         RTFS P GR  L  +    + LT  + +P L + G    S  +  P T E       W NF+N +A+ L I       +D  WI+     M    I+ +A   G+  G GLNGHL   +     Q + + ++  ++ALLIGLSA N  + +  + K ++ +   L+     +I    T+ Q +AI   GLL   S +  +A+  + E+GR+      +  P  D     ++AGFS+GLIM  +G+      I  +++ P    RL+  + G  R +    P+       N+VPN                 P S      + Q  N  V+E EY N   +   AAIA+G+++M   +  IAN L  P T   LE+++   +  R +A+ L+MW  ++P+ D+V+S IP  +   A      G+                  +EKY        TV+ ++L  +  +C  + L+++     N +  IV    R+I   + I +MP+   N          Y  A      LS L+ +  ++  G+G+L ++R +R L+    P+         +   M    ++G+L LG G+        S A+ +I+ FP  P + +   ++ Q LR L+ +A  PR++   D+     V V+  +V K
Sbjct:  645 DIRMHNVQLMLNSSRPILIATNILRK---NEDDNM-----KELQDRFLTQTSYRTFSQPFGRAFLDFRTAVPSLLT-SIYIPRLNVGGMIYPSRVTCDPPTTEIFKLCTEWGNFYNSLASALRIGSSETVRIDNEWIV-----MVSKNIKSTAVIGGMTLGFGLNGHLAPFNMYHAHQMLSTFDKFHSVALLIGLSASNFTTCDVQIHKILATYLSFLMGPTPLEIKLDFTI-QTAAISGLGLLFADSGNMTIAKKLVNEIGRAPNR---DEEPVTDRNAYKLSAGFSLGLIMLGKGNGSASTVIPFKQNIPPMSQRLIYMMNGMRRDKCVFLPQVAPPVV-NDVPN----------------LPFSNGGMMTSSQVAN-HVKESEYINIHQSAEPAAIALGMMFMKMNNEFIANALALPGTITELERLKPDSMYSRVLAQCLVMWDSIEPTHDFVKSLIPPVIREYATAALHFGVPIRRDEDGEEVHEAINDAEEKYWAEIVDKGTVSQTFLYAVSAACMAIALKFSSCGGPNEK-NIVNTAFRIIEYYTKI-VMPDGKSNKDMGSIRMCIYSGAYTRTSCLSMLITAMAILRVGTGDLEVMRYARLLRLCDKPESDWIATGKKHFEQMVAHQALGILMLGEGRYAFKKDDLSIALTIISTFPTIPQSVSDNSHYHQPLRFLWSMAVEPRLLVPFDIAESCVVEVDVTIVMK 1319          
BLAST of anaphase-promoting complex subunit 1 vs. Ensembl Fly
Match: shtd (gene:FBgn0004391 transcript:FBtr0074077)

HSP 1 Score: 303.138 bits (775), Expect = 1.984e-82
Identity = 236/753 (31.34%), Postives = 391/753 (51.93%), Query Frame = 2
Query: 3056 IVQLSYPD-IRIHEAYKMIQSCCPIKLDAGICSNFTIEDGDTLSTPLKEELEGYLKIINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGKFSLSESG-KPQTIESNASTKVWPNFHNGVAAGLMIAPMNESVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPPMDVELTSVTAGFSVGLIMFQQGHIFDREHNPEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYMNSMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKAFL------IKPTGIQEKYLDTVNDSYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINIKSNIELMPNVNRNHYDWALSTLLLSACMISAGSGNLTLLRISRYLQSIHHPKDCG-NYGVFMTYXXXXXXXXXXXXXXXXXNSHRSAAILVIAFFPRFPPTYNGRRYHLQSLRHLYVIATRPRVMCAVDLDT-MIAVPVESRVVFKDHSIRHHSRCFVFPAENP--NTIEQVELFDKNNEYYPQIYKSNTEPWNILYQSYQSGGYILVKKQKPEINIQEIFDKLE 5278
            +++L +PD +R+ E  +++ S  P+ ++         +   T      EE E  L  + C RT +LP+GRGM  L+ +     ++ L +P LCL GK  L  +  + Q IE  A+ ++WP+FHNGVA GL I+P  + +D  WI+   P  +      + E AG L  LGLNGHL  LS  ++ + +   +EM  + LL+G+SA + G+ ++  +K +S H   L+P    ++D IP   QV+AI+  GLL   SA R +A + L+E+GR       E    ++ E  ++TAG S+GL+   QG                           +  +G    ++P+ L    +     +K+  PI  +     ++  + +V+EG+  N D+T  GA +A+GL++ NS +  IA  ++ P++ YLL+ +R   L  R I+RGLI+W+ V+P   W ++  P+ + +   L        P      Y + ++ +Y  ++ G+ F +GL+YAGT+N  A   + + I+  +   S   +     R   +  L  LL+S  ++ AGSGN  +LRI R+L+S   P+     YG  M   +S+GLLFLG G+ T+S +  S A LV AFFP+FP   N  RYHLQ+LRHLYV+A  PR+    D+DT  + +   S +      +R   R  + P   P  +T++QV + D+N  Y+P  ++ +   W+ L ++ +    I +KK+   ++  E  D+L+
Sbjct: 1096 LLRLRFPDDMRVDEVRRLLNSSEPVVIEVQ-------QAPGTSDHEFIEEQEKQLFAL-CSRTMTLPVGRGMFTLRTMLPRP-SESLTMPKLCLLGKEPLKGTTIEMQQIEFPANMQMWPSFHNGVATGLKISPQAQDIDSNWIVYNKPKTHSHN---ALEHAGFLMALGLNGHLKTLSFMSVYKYLVKCDEMTNVGLLLGISAAHRGTMDTKTTKLLSVHLEALLPATAMELD-IPQSTQVAAIMGVGLLYQGSAKRHIAEVLLQEIGRPP---GPEMENSIERESYAMTAGLSLGLVTLGQG---------------------------ESPAGLRDLQLPDTLHYYMV---GGVKR--PIGGSQK-EKYRLASFQVREGDTVNIDVTAPGATLALGLMFFNSGNAAIAEWMQPPDSRYLLDMVRPDFLLLRTISRGLILWQDVRPDNAWFQAQFPRALRAHLKLPFYENEYAPEDYDVDY-EAISQAYCNIMAGAAFCIGLKYAGTENLVAFATLRSVIKDFLRFPSR-PMGECAGRTTVESCLMVLLISISLVFAGSGNCEILRIIRFLRSRVGPQYPHITYGSHMAIHMSLGLLFLGAGRFTISQTPESIAALVCAFFPKFPIHSNDNRYHLQALRHLYVLAVEPRLFLPRDIDTNKLCLANISVLEVGATELR---RLPIAPCILPVLSTLQQVVVDDEN--YWPVCFERSRN-WDQLEKALEMSAPIDIKKRTGCLSHLEDPDRLK 1791          

HSP 2 Score: 59.3066 bits (142), Expect = 4.122e-8
Identity = 90/483 (18.63%), Postives = 185/483 (38.30%), Query Frame = 2
Query:  140 KNSGFQTKYLKSNIKNEFTIVRNVS-------NQQMELYVNGCDAVLHNFAAQDSNHMFTGF-------TETPIKCASFVRLSSKVSTNATYESIFQELNDFDPKGVILFTDRIAKYYGFDADIHSCTLPCKVSSAWKFRECLFVEREEMNNF--HDYSPNS-LFVMLHTLAEFTPVVFKDEFGNCGFINDTRFRIVSVCESSFLLLAYDKTDDSFSLWRIRDATQNDFSDLYDMHWDGSIAVKKQKLKSNFISGRSRMESSINHTNFNDNSHISSEYFEISTDVINNSVRTVEDLDIRSPIARSLKNTKDCQIPDKMTLLNETNNCLK-------IHPSYRQMIEPLYPKVCLDFLFSCKAGNVEPTLDGSYADYHSTPNAYNSQKDTANQSKNGKVFGFFSEDFYRRKYLCCLKETNAGNHSILKIVKFNYENDTFCNLEEKSWPVLDAVYLERLQFTIVLELGSTLSIYSGMTFVCKISL 1516
            K  G Q   L + + N   +VR V        N + ELYVN  + V+      D +    G        T+TP++ A F+  S      A  ++     +D      ++  D + + Y  + +     L   VS  W+ +  L +E++  N    H   P   LF M H L E  PVV K   G+ G++ +  + +V   E S L++ YD       + R+R  T  + + +      G   +  + +  N  S   +  ++   TN +     ++     +T  + N     +       + +S + +    +    + +++ +  +K       + P+     +P+ P++C++ ++                    T N Y +Q++    +       F   D   + +LC L   +     ++++  +    +   +    +    DAV L+R+    VL+   +L +Y+G   + K+ +
Sbjct:   93 KRCGLQATSLPNRLLNP-PLVRRVEPMCDYMVNNEEELYVNR-NTVVWTQGVNDDDDTDNGVYRRMCFTTDTPVRFACFLNRSFVRGRLAQLKAAVHPDDDHLTAICVMDQDAL-RVYCSNGEDFLANLDFPVSQLWQTKYGLLLEKDSSNALISHMSIPMPRLFSMSHPLHEACPVVLKTATGSTGYMTEPEYTVVFTTEESDLVMLYDAKFFKHFVARLRKVTPEEINYVSQQMELGQTLMGPRSMAGNSFSSTKQTGATPKATNLS----FAARNINTTTTGMGNQFGLSQSQSFSGVLGQSNRASLGTPLSQLQSSISQQSMSVKDMRKLTHVKPA-----KPIEPELCMEHIW--------------------TENIYGTQREFCEMATR----AFIHTDLVGQTFLCYLLARSC-RLQLVRLTGYG-RGEVQLSTHASTLAAKDAVGLKRMHMIAVLDPSGSLLLYTGTVLISKVHI 537          
BLAST of anaphase-promoting complex subunit 1 vs. Ensembl Zebrafish
Match: anapc1 (anaphase promoting complex subunit 1 [Source:ZFIN;Acc:ZDB-GENE-081107-12])

HSP 1 Score: 277.33 bits (708), Expect = 3.989e-75
Identity = 232/800 (29.00%), Postives = 380/800 (47.50%), Query Frame = 2
Query: 2678 IYRRTATYLSEIKFHVNDLDFMNDGLASIFRIVFFHCNKFP------ELYSILHRADLDMQRQLILPIVQESAVPKVLTTPLKKFRSVSEPRRNCHAYWTNNVKPPMAMPKCLDFINRTDNNYLMHVLDSDPIVQLSYPDIRIHEAYKMIQSCCPIKLDAGICSNFTIEDGDTLSTPLKEELEGYLKIINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGKFSLSESG---KPQTIESNASTKVWPNFHNGVAAGLMIAPMNESVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPP-------MDVELTSVTAGFSVGLIMFQQGH--IFDREHN-PEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYMNSMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKAFLIKPTGIQEKY-LDTVNDSYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINIKSNIELMPNVNRNHYDWALSTLLLSACMISAGSGNLTLLRISRYLQSIHHPKDCG--NYGVFMTYXXXXXXXXXXXXXXXXXNSHRSAAILVIAFFPRFPPTYNGRRYHLQSLRHLYVIATRPRVMCAVDLDTM 5011
            +  +   +L+   F + DL+ +  G+A   R   + C + P      E+ +++ R DL  Q                          V+   R         ++PP++     +    TD       L  +    +   D+R+ E  +++QS  P++++        I D + +     EE E  L  + CQRT SLP+GRG+  L        T+ LPVP L LTG+     +        I+   +   WP+FHNGVAAGL IAP ++ V+  WI    P       EL+ E AG L  LGLNGHL KL+   I   +   +EM ++ LL+G+SA  +G+ +  +++ +S H   L+P    ++D +P   QV+A++  GL+   +  R  A + L E+GR          PP        D E  S+ AG ++G++    G   I   + N PE+L +   Y+ G +R                    R     N  K   P        ++Q     ++EG+  N D+T  GA +A+ +IY+ + +  +A+ L+ P+T +LL+ I+   L  R +AR LIMW ++ P+ DWV S +PQ +         T + E   ++T+  ++  ++ G C  +G R+AG+ N +A   +  + +  +   +          N     LS +LL+  M+ +GSGNL +L++ R+L    H +  G  NYG  M + +++GLLFLGGG+ TLS S+ + A L+ A +P FP      RYHLQ+LRHL V+A  PR++  VD+D++
Sbjct:  326 LAEKLVLWLTSAGFTLKDLETVPFGVALPIRDAIYQCREHPCSDWSEEVCALIGRQDLTRQAH-----------------------KVTLANRKSTVGLNVMLEPPVSSEADEEEDGMTD-------LHPEVTALIWSQDLRVQEVRRLLQSSRPVRVNVPHLPE--ISDHEYI-----EEKENKLLQL-CQRTMSLPVGRGLFTL-FSYHPVPTEPLPVPKLNLTGRAPPRNTMVDLNSGNIDVPPNMTSWPSFHNGVAAGLKIAPASQ-VESAWIAYNKPK----SAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKGHEMTSIGLLLGVSAAKLGTMDMSITRLLSIHIPALLPPTSTELD-VPHSVQVAAVVGIGLVYQGTGHRHNAEVLLAEIGR----------PPGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLNVPEQLYQ---YMVGGHR--------------------RTHAGINREKHKSP--------SYQ-----IKEGDTINVDVTCPGATLALAMIYLKTNNRSVADWLKAPDTMFLLDFIKPEFLLLRTLARCLIMWDEIFPNADWVTSNVPQIIQENIGNQDQTPVSEDLNMETLVQAHDYIIAGGCLAVGFRFAGSANSDAFDCLYKFAKNFMQCLTTSTATVTGQYN-LQTCLSMVLLAVSMVMSGSGNLKVLQLCRFL----HKRTFGEMNYGFHMAHHMALGLLFLGGGRYTLSTSNSAIAALLCALYPHFPAHSTDNRYHLQALRHLAVLAAEPRLLVPVDVDSL 1029          
BLAST of anaphase-promoting complex subunit 1 vs. Ensembl Zebrafish
Match: anapc1 (anaphase promoting complex subunit 1 [Source:ZFIN;Acc:ZDB-GENE-081107-12])

HSP 1 Score: 278.87 bits (712), Expect = 5.699e-75
Identity = 232/793 (29.26%), Postives = 378/793 (47.67%), Query Frame = 2
Query: 2699 YLSEIKFHVNDLDFMNDGLASIFRIVFFHCNKFP------ELYSILHRADLDMQRQLILPIVQESAVPKVLTTPLKKFRSVSEPRRNCHAYWTNNVKPPMAMPKCLDFINRTDNNYLMHVLDSDPIVQLSYPDIRIHEAYKMIQSCCPIKLDAGICSNFTIEDGDTLSTPLKEELEGYLKIINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGKFSLSESG---KPQTIESNASTKVWPNFHNGVAAGLMIAPMNESVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPP-------MDVELTSVTAGFSVGLIMFQQGH--IFDREHN-PEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYMNSMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKAFLIKPTGIQEKY-LDTVNDSYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINIKSNIELMPNVNRNHYDWALSTLLLSACMISAGSGNLTLLRISRYLQSIHHPKDCG--NYGVFMTYXXXXXXXXXXXXXXXXXNSHRSAAILVIAFFPRFPPTYNGRRYHLQSLRHLYVIATRPRVMCAVDLDTM 5011
            +L+   F + DL+ +  G+A   R   + C + P      E+ +++ R DL  Q                          V+   R         ++PP++     +    TD       L  +    +   D+R+ E  +++QS  P++++        I D + +     EE E  L  + CQRT SLP+GRG+  L        T+ LPVP L LTG+     +        I+   +   WP+FHNGVAAGL IAP ++ V+  WI    P       EL+ E AG L  LGLNGHL KL+   I   +   +EM ++ LL+G+SA  +G+ +  +++ +S H   L+P    ++D +P   QV+A++  GL+   +  R  A + L E+GR          PP        D E  S+ AG ++G++    G   I   + N PE+L +   Y+ G +R                    R     N  K   P        ++Q     ++EG+  N D+T  GA +A+ +IY+ + +  +A+ L+ P+T +LL+ I+   L  R +AR LIMW ++ P+ DWV S +PQ +         T + E   ++T+  ++  ++ G C  +G R+AG+ N +A   +  + +  +   +          N     LS +LL+  M+ +GSGNL +L++ R+L    H +  G  NYG  M + +++GLLFLGGG+ TLS S+ + A L+ A +P FP      RYHLQ+LRHL V+A  PR++  VD+D++
Sbjct:  929 WLTSAGFTLKDLETVPFGVALPIRDAIYQCREHPCSDWSEEVCALIGRQDLTRQAH-----------------------KVTLANRKSTVGLNVMLEPPVSSEADEEEDGMTD-------LHPEVTALIWSQDLRVQEVRRLLQSSRPVRVNVPHLPE--ISDHEYI-----EEKENKLLQL-CQRTMSLPVGRGLFTL-FSYHPVPTEPLPVPKLNLTGRAPPRNTMVDLNSGNIDVPPNMTSWPSFHNGVAAGLKIAPASQ-VESAWIAYNKPK----SAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKGHEMTSIGLLLGVSAAKLGTMDMSITRLLSIHIPALLPPTSTELD-VPHSVQVAAVVGIGLVYQGTGHRHNAEVLLAEIGR----------PPGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLNVPEQLYQ---YMVGGHR--------------------RTHAGINREKHKSP--------SYQ-----IKEGDTINVDVTCPGATLALAMIYLKTNNRSVADWLKAPDTMFLLDFIKPEFLLLRTLARCLIMWDEIFPNADWVTSNVPQIIQENIGNQDQTPVSEDLNMETLVQAHDYIIAGGCLAVGFRFAGSANSDAFDCLYKFAKNFMQCLTTSTATVTGQYN-LQTCLSMVLLAVSMVMSGSGNLKVLQLCRFL----HKRTFGEMNYGFHMAHHMALGLLFLGGGRYTLSTSNSAIAALLCALYPHFPAHSTDNRYHLQALRHLAVLAAEPRLLVPVDVDSL 1625          

HSP 2 Score: 53.9138 bits (128), Expect = 2.909e-6
Identity = 83/406 (20.44%), Postives = 154/406 (37.93%), Query Frame = 2
Query:  227 ELYVNGCDAVLHNFAAQDSNHMFTGFT-ETPIKCASFVRLSSKVSTNATYESIFQELNDFDPKGVILFTDRIAKYYGFDADIHSCTLPCKVSSAWKFRECLFVEREEMNNFHDYSPNS------LFVMLHTLAEFTPVVFKDEF---GNCGFINDTRFRIVSVCESSFLLLAYDKTDDSFSLWRIRDAT---QNDFSDLYDMHWDGSIAVKKQKLKSNFISGRSRMESSINHTN---FNDNSHISSE---YFEISTDVINN--SVRTVEDLDIRSP-IARSLKNTKDCQIPDKM--TLLNETNNCLKIHPSYRQMIEPLYPKVCLDFLFSCKAGNVEPTLDGSYADYHSTPNAYNSQKDTANQSKNGKVFGFFSEDFYRRKYLCCLKETNAGNHSILKIVKFNYEN 1372
            ELYV G   +    +   ++ ++  FT ++P++ A +         N T     +++ D   + V +        +          LP +VS+ W  +  L +ER+ +      SP S      LF MLH L E  PVV K          +++D+  R+V  C    +++ YD    + ++W +R  T   QN      D               S  +   +R++S  +  +    ++ S I +    +  + +  I+N  ++       I  P  + + +    C  P     ++L   N+ L  + +    +EP+ P +C++ L+                    T  +  S++     SK      F + D    +YLC L E+    H  L+ VKF   N
Sbjct:   90 ELYVAGNMVIWSRGSKNQASCVYKAFTVDSPVQQALWC--------NFTVPQAKKDVKDVVEQTVCIVQSTCVNVHSMSGKDFISPLPFQVSALWPTKFGLLLERKNITVDGHMSPISREPLPTLFSMLHPLDEIAPVVCKSTGLFETRLQYVSDSALRVVFTCLKPSIIMTYDTQQCTHTVWNLRKVTSEEQNTVLKFPDQSGPAHTPNAAPSFLSTHLRNVNRLDSPASPLHCHALHNQSRIPASPALHSRVHSPSISNMAALSRAHSPGIAVPSFSGNQRFNMSCHTPSSRGHSILASPNSTL--NDTLLPEMEPILPDLCIEQLW--------------------TETSAISREKGCQASKV-----FITSDLCENRYLCFLVES----HQQLRCVKFLESN 456          
BLAST of anaphase-promoting complex subunit 1 vs. Ensembl Zebrafish
Match: anapc1 (anaphase promoting complex subunit 1 [Source:ZFIN;Acc:ZDB-GENE-081107-12])

HSP 1 Score: 278.87 bits (712), Expect = 6.759e-75
Identity = 232/793 (29.26%), Postives = 378/793 (47.67%), Query Frame = 2
Query: 2699 YLSEIKFHVNDLDFMNDGLASIFRIVFFHCNKFP------ELYSILHRADLDMQRQLILPIVQESAVPKVLTTPLKKFRSVSEPRRNCHAYWTNNVKPPMAMPKCLDFINRTDNNYLMHVLDSDPIVQLSYPDIRIHEAYKMIQSCCPIKLDAGICSNFTIEDGDTLSTPLKEELEGYLKIINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGKFSLSESG---KPQTIESNASTKVWPNFHNGVAAGLMIAPMNESVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPP-------MDVELTSVTAGFSVGLIMFQQGH--IFDREHN-PEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYMNSMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKAFLIKPTGIQEKY-LDTVNDSYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINIKSNIELMPNVNRNHYDWALSTLLLSACMISAGSGNLTLLRISRYLQSIHHPKDCG--NYGVFMTYXXXXXXXXXXXXXXXXXNSHRSAAILVIAFFPRFPPTYNGRRYHLQSLRHLYVIATRPRVMCAVDLDTM 5011
            +L+   F + DL+ +  G+A   R   + C + P      E+ +++ R DL  Q                          V+   R         ++PP++     +    TD       L  +    +   D+R+ E  +++QS  P++++        I D + +     EE E  L  + CQRT SLP+GRG+  L        T+ LPVP L LTG+     +        I+   +   WP+FHNGVAAGL IAP ++ V+  WI    P       EL+ E AG L  LGLNGHL KL+   I   +   +EM ++ LL+G+SA  +G+ +  +++ +S H   L+P    ++D +P   QV+A++  GL+   +  R  A + L E+GR          PP        D E  S+ AG ++G++    G   I   + N PE+L +   Y+ G +R                    R     N  K   P        ++Q     ++EG+  N D+T  GA +A+ +IY+ + +  +A+ L+ P+T +LL+ I+   L  R +AR LIMW ++ P+ DWV S +PQ +         T + E   ++T+  ++  ++ G C  +G R+AG+ N +A   +  + +  +   +          N     LS +LL+  M+ +GSGNL +L++ R+L    H +  G  NYG  M + +++GLLFLGGG+ TLS S+ + A L+ A +P FP      RYHLQ+LRHL V+A  PR++  VD+D++
Sbjct:  904 WLTSAGFTLKDLETVPFGVALPIRDAIYQCREHPCSDWSEEVCALIGRQDLTRQAH-----------------------KVTLANRKSTVGLNVMLEPPVSSEADEEEDGMTD-------LHPEVTALIWSQDLRVQEVRRLLQSSRPVRVNVPHLPE--ISDHEYI-----EEKENKLLQL-CQRTMSLPVGRGLFTL-FSYHPVPTEPLPVPKLNLTGRAPPRNTMVDLNSGNIDVPPNMTSWPSFHNGVAAGLKIAPASQ-VESAWIAYNKPK----SAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKGHEMTSIGLLLGVSAAKLGTMDMSITRLLSIHIPALLPPTSTELD-VPHSVQVAAVVGIGLVYQGTGHRHNAEVLLAEIGR----------PPGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLNVPEQLYQ---YMVGGHR--------------------RTHAGINREKHKSP--------SYQ-----IKEGDTINVDVTCPGATLALAMIYLKTNNRSVADWLKAPDTMFLLDFIKPEFLLLRTLARCLIMWDEIFPNADWVTSNVPQIIQENIGNQDQTPVSEDLNMETLVQAHDYIIAGGCLAVGFRFAGSANSDAFDCLYKFAKNFMQCLTTSTATVTGQYN-LQTCLSMVLLAVSMVMSGSGNLKVLQLCRFL----HKRTFGEMNYGFHMAHHMALGLLFLGGGRYTLSTSNSAIAALLCALYPHFPAHSTDNRYHLQALRHLAVLAAEPRLLVPVDVDSL 1600          

HSP 2 Score: 53.9138 bits (128), Expect = 2.808e-6
Identity = 83/406 (20.44%), Postives = 154/406 (37.93%), Query Frame = 2
Query:  227 ELYVNGCDAVLHNFAAQDSNHMFTGFT-ETPIKCASFVRLSSKVSTNATYESIFQELNDFDPKGVILFTDRIAKYYGFDADIHSCTLPCKVSSAWKFRECLFVEREEMNNFHDYSPNS------LFVMLHTLAEFTPVVFKDEF---GNCGFINDTRFRIVSVCESSFLLLAYDKTDDSFSLWRIRDAT---QNDFSDLYDMHWDGSIAVKKQKLKSNFISGRSRMESSINHTN---FNDNSHISSE---YFEISTDVINN--SVRTVEDLDIRSP-IARSLKNTKDCQIPDKM--TLLNETNNCLKIHPSYRQMIEPLYPKVCLDFLFSCKAGNVEPTLDGSYADYHSTPNAYNSQKDTANQSKNGKVFGFFSEDFYRRKYLCCLKETNAGNHSILKIVKFNYEN 1372
            ELYV G   +    +   ++ ++  FT ++P++ A +         N T     +++ D   + V +        +          LP +VS+ W  +  L +ER+ +      SP S      LF MLH L E  PVV K          +++D+  R+V  C    +++ YD    + ++W +R  T   QN      D               S  +   +R++S  +  +    ++ S I +    +  + +  I+N  ++       I  P  + + +    C  P     ++L   N+ L  + +    +EP+ P +C++ L+                    T  +  S++     SK      F + D    +YLC L E+    H  L+ VKF   N
Sbjct:   90 ELYVAGNMVIWSRGSKNQASCVYKAFTVDSPVQQALWC--------NFTVPQAKKDVKDVVEQTVCIVQSTCVNVHSMSGKDFISPLPFQVSALWPTKFGLLLERKNITVDGHMSPISREPLPTLFSMLHPLDEIAPVVCKSTGLFETRLQYVSDSALRVVFTCLKPSIIMTYDTQQCTHTVWNLRKVTSEEQNTVLKFPDQSGPAHTPNAAPSFLSTHLRNVNRLDSPASPLHCHALHNQSRIPASPALHSRVHSPSISNMAALSRAHSPGIAVPSFSGNQRFNMSCHTPSSRGHSILASPNSTL--NDTLLPEMEPILPDLCIEQLW--------------------TETSAISREKGCQASKV-----FITSDLCENRYLCFLVES----HQQLRCVKFLESN 456          
BLAST of anaphase-promoting complex subunit 1 vs. Ensembl Zebrafish
Match: anapc1 (anaphase promoting complex subunit 1 [Source:ZFIN;Acc:ZDB-GENE-081107-12])

HSP 1 Score: 274.248 bits (700), Expect = 1.517e-73
Identity = 232/793 (29.26%), Postives = 374/793 (47.16%), Query Frame = 2
Query: 2699 YLSEIKFHVNDLDFMNDGLASIFRIVFFHCNKFP------ELYSILHRADLDMQRQLILPIVQESAVPKVLTTPLKKFRSVSEPRRNCHAYWTNNVKPPMAMPKCLDFINRTDNNYLMHVLDSDPIVQLSYPDIRIHEAYKMIQSCCPIKLDAGICSNFTIEDGDTLSTPLKEELEGYLKIINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGKFSLSESG---KPQTIESNASTKVWPNFHNGVAAGLMIAPMNESVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPP-------MDVELTSVTAGFSVGLIMFQQGH--IFDREHN-PEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYMNSMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKAFLIKPTGIQEKY-LDTVNDSYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINIKSNIELMPNVNRNHYDWALSTLLLSACMISAGSGNLTLLRISRYLQSIHHPKDCG--NYGVFMTYXXXXXXXXXXXXXXXXXNSHRSAAILVIAFFPRFPPTYNGRRYHLQSLRHLYVIATRPRVMCAVDLDTM 5011
            +L+   F + DL+ +  G+A   R   + C + P      E+ +++ R DL  Q                          V+   R         ++PP++     +    TD       L  +    +   D+R+ E  +++QS  P++++        I D + +     EE E  L  + CQRT SLP+GRG+  L        T+ LPVP L LTG+     +        I+   +   WP+FHNGVAAGL IAP ++ V+  WI    P       EL+ E AG L  LGLNGHL KL+   I   +   +EM ++ LL+G+SA  +G+ +  +++ +S H   L+P    ++D +P   QV+A++  GL+   +  R  A + L E+GR          PP        D E  S+ AG ++G++    G   I   + N PE+L +   Y+ G +R                    R     N  K   P        ++Q K     EG+  N D+T  GA +A+ +IY+ + +  +A+ L+ P+T +LL+ I+   L  R +AR LIMW ++ P+ DWV S +PQ +         T + E   ++T+  ++  ++ G C  +G R+AG+ N +A   +                     + +    LS +LL+  M+ +GSGNL +L++ R+L    H +  G  NYG  M + +++GLLFLGGG+ TLS S+ + A L+ A +P FP      RYHLQ+LRHL V+A  PR++  VD+D++
Sbjct:  929 WLTSAGFTLKDLETVPFGVALPIRDAIYQCREHPCSDWSEEVCALIGRQDLTRQAH-----------------------KVTLANRKSTVGLNVMLEPPVSSEADEEEDGMTD-------LHPEVTALIWSQDLRVQEVRRLLQSSRPVRVNVPHLPE--ISDHEYI-----EEKENKLLQL-CQRTMSLPVGRGLFTL-FSYHPVPTEPLPVPKLNLTGRAPPRNTMVDLNSGNIDVPPNMTSWPSFHNGVAAGLKIAPASQ-VESAWIAYNKPK----SAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKGHEMTSIGLLLGVSAAKLGTMDMSITRLLSIHIPALLPPTSTELD-VPHSVQVAAVVGIGLVYQGTGHRHNAEVLLAEIGR----------PPGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLNVPEQLYQ---YMVGGHR--------------------RTHAGINREKHKSP--------SYQIK-----EGDTINVDVTCPGATLALAMIYLKTNNRSVADWLKAPDTMFLLDFIKPEFLLLRTLARCLIMWDEIFPNADWVTSNVPQIIQENIGNQDQTPVSEDLNMETLVQAHDYIIAGGCLAVGFRFAGSANSDAFDCL-------------------TGQYNLQTCLSMVLLAVSMVMSGSGNLKVLQLCRFL----HKRTFGEMNYGFHMAHHMALGLLFLGGGRYTLSTSNSAIAALLCALYPHFPAHSTDNRYHLQALRHLAVLAAEPRLLVPVDVDSL 1607          

HSP 2 Score: 53.9138 bits (128), Expect = 2.905e-6
Identity = 83/406 (20.44%), Postives = 154/406 (37.93%), Query Frame = 2
Query:  227 ELYVNGCDAVLHNFAAQDSNHMFTGFT-ETPIKCASFVRLSSKVSTNATYESIFQELNDFDPKGVILFTDRIAKYYGFDADIHSCTLPCKVSSAWKFRECLFVEREEMNNFHDYSPNS------LFVMLHTLAEFTPVVFKDEF---GNCGFINDTRFRIVSVCESSFLLLAYDKTDDSFSLWRIRDAT---QNDFSDLYDMHWDGSIAVKKQKLKSNFISGRSRMESSINHTN---FNDNSHISSE---YFEISTDVINN--SVRTVEDLDIRSP-IARSLKNTKDCQIPDKM--TLLNETNNCLKIHPSYRQMIEPLYPKVCLDFLFSCKAGNVEPTLDGSYADYHSTPNAYNSQKDTANQSKNGKVFGFFSEDFYRRKYLCCLKETNAGNHSILKIVKFNYEN 1372
            ELYV G   +    +   ++ ++  FT ++P++ A +         N T     +++ D   + V +        +          LP +VS+ W  +  L +ER+ +      SP S      LF MLH L E  PVV K          +++D+  R+V  C    +++ YD    + ++W +R  T   QN      D               S  +   +R++S  +  +    ++ S I +    +  + +  I+N  ++       I  P  + + +    C  P     ++L   N+ L  + +    +EP+ P +C++ L+                    T  +  S++     SK      F + D    +YLC L E+    H  L+ VKF   N
Sbjct:   90 ELYVAGNMVIWSRGSKNQASCVYKAFTVDSPVQQALWC--------NFTVPQAKKDVKDVVEQTVCIVQSTCVNVHSMSGKDFISPLPFQVSALWPTKFGLLLERKNITVDGHMSPISREPLPTLFSMLHPLDEIAPVVCKSTGLFETRLQYVSDSALRVVFTCLKPSIIMTYDTQQCTHTVWNLRKVTSEEQNTVLKFPDQSGPAHTPNAAPSFLSTHLRNVNRLDSPASPLHCHALHNQSRIPASPALHSRVHSPSISNMAALSRAHSPGIAVPSFSGNQRFNMSCHTPSSRGHSILASPNSTL--NDTLLPEMEPILPDLCIEQLW--------------------TETSAISREKGCQASKV-----FITSDLCENRYLCFLVES----HQQLRCVKFLESN 456          
BLAST of anaphase-promoting complex subunit 1 vs. Ensembl Zebrafish
Match: anapc1 (anaphase promoting complex subunit 1 [Source:ZFIN;Acc:ZDB-GENE-081107-12])

HSP 1 Score: 55.0694 bits (131), Expect = 8.300e-7
Identity = 44/192 (22.92%), Postives = 80/192 (41.67%), Query Frame = 2
Query:  227 ELYVNGCDAVLHNFAAQDSNHMFTGFT-ETPIKCASFVRLSSKVSTNATYESIFQELNDFDPKGVILFTDRIAKYYGFDADIHSCTLPCKVSSAWKFRECLFVEREEMNNFHDYSPNS------LFVMLHTLAEFTPVVFKDEF---GNCGFINDTRFRIVSVCESSFLLLAYDKTDDSFSLWRIRDATQND 772
            ELYV G   +    +   ++ ++  FT ++P++ A +         N T     +++ D   + V +        +          LP +VS+ W  +  L +ER+ +      SP S      LF MLH L E  PVV K          +++D+  R+V  C    +++ YD    + ++W +R  T  +
Sbjct:   90 ELYVAGNMVIWSRGSKNQASCVYKAFTVDSPVQQALWC--------NFTVPQAKKDVKDVVEQTVCIVQSTCVNVHSMSGKDFISPLPFQVSALWPTKFGLLLERKNITVDGHMSPISREPLPTLFSMLHPLDEIAPVVCKSTGLFETRLQYVSDSALRVVFTCLKPSIIMTYDTQQCTHTVWNLRKVTSEE 273          
BLAST of anaphase-promoting complex subunit 1 vs. Ensembl Xenopus
Match: crip2 (cysteine-rich protein 2 [Source:Xenbase;Acc:XB-GENE-953187])

HSP 1 Score: 366.696 bits (940), Expect = 5.460e-102
Identity = 402/1630 (24.66%), Postives = 709/1630 (43.50%), Query Frame = 2
Query:  506 WKFRECLFVEREEMNNFHDY--SPN-----SLFVMLHTLAEFTPVVFKDE--FGN--CGFINDTRFRIVSVCESSFLLLAYDKTDDSFSLWRIRDATQNDFSDLYDMHWDGSIAVKKQKLKSNFISGRSRMES---SINHTNFNDNSHISSEYFEISTDVINNSVRTVEDLDIRSPIARSLKNTKDCQIPDKMTLLNETNNCLKIHPSYRQM-----------------IEPLYPKVCLDFLFSCKAGNVEPTLDGSYADYHSTPNAYNSQKDTANQSKNGKVFGFFSEDFYRRKYLCCLKETNAGNHSILKIVKFNYEND-------TFCNLEEKSWPVLDAVYLERLQFTIVLELGSTLSIYSGMTFVCKISL---------LNALVYQPDDPF-----------------DDVGMEMSISDINSMNRLSDPT--------DYGFTIHT-----QSELAL--------RLYLPEMVRLHXXXXXXXXXXXXXPIDTGMTMLCRWYSLNRAVDNNESASAEWRRFVEFLLENMGFARNRQNKAGQQQTQQETHSIVQDVKELCLDNNNGHGIASSSADTDVSMDEICSKKLRTNSGLYSIERRCLNERDGLEEYSALCYNVTDRLLSQHAPTVLFCLHLVYECEKLNYSFCRHFKNLAALNCSIACSIGARQYLDYYLQDNPDLMADIAQL----PSLAQYILIPSDITATWNPQPPNWSEILFNLMGTQSPIPNNYRYPIIEDLSEMLIQLVKIWLVMFRPDTLLDNPTSELNRYFYRINFNMSGIPCRFPVHFCHDLNRANRNETLKIDDIYRRTATYLSEIKFHVNDLDFMNDGLASIFRIVFFHCNKFPE------LYSILHRADLDMQR-QLILPIVQESAVPKVLTTPLKKFRSVSEPRRNCHAYWTNNVKPPMAMPKCLDFINRTDNNYLMHVLDSDPIVQLSYPDIRIHEAYKMIQSCCPIKLDAGICSNFTIEDGDTLSTPLKEELEGYLKIINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGKFSLSESG---KPQTIESNASTKVWPNFHNGVAAGLMIAPMNESVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPP-------MDVELTSVTAGFSVGLIMFQQGH--IFDREHN-PEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYMNSMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKAFLIKPT---GIQEKYLDTVNDSYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINIKSNIELMPNVNRNHYDW--ALSTLLLSACMISAGSGNLTLLRISRYLQSIHHPKDCG--NYGVFMTYXXXXXXXXXXXXXXXXXNSHRSAAILVIAFFPRFPPTYNGRRYHLQSLRHLYVIATRPRVMCAVDLDTMIAVPVESRVVFK 5047
            W  +  L  ER   +  H+   SP      ++F MLH L E TP+V +    FG+    +++D   RIV       +++ YD    S ++W +R     + + + ++     I   +  + ++ ++   R  S   S   + F + S + S+   +S+  I++   +   +   + ++RS            +   N ++N     PS +++                  EP+ P++CLD L++    N+                  NSQ              F + D   +K+LC L E+       L++VKF   ND       +  N+  K     DA  +E +   +VLE    L +Y+G+  V KI +         ++  + +P  P                  D+ GM   + ++    RL + T         +G  IH+      + L L        R+ +P++    +VKKCL  +K +LP +  + ML +WY+ + A     +  +EW  FV  L+  MG+  ++ +       +     ++   K    +         S  D +  ++    + + T+    +++   L+     ++   +    +  LL  HAP + + LHL YE  KLN       ++L  L   +A  +    Y+D+Y +D P L+    Q     P+   ++  PS  TA    +PP+    L + +  +   P  Y  P I + S++++    ++++      L      E  +Y  +I                 D  R +   T  +  +  +   +++ I F + DL+ +  G+A   R   + C + P       +  ++ R DL  Q     LP  + SA P                             P   +P   D     D    M+ L+ + +  +   D+R+ E  +++QS  P++++  +     + D + +     EE E  L  ++ QRT +LP+GRGM  L        T+ LP+P L LTG+     +        I+   +   W NFHNGVAAGL IAP ++ +D  WI+   P       EL+ E AG L  LGLNGHL KL+   I   +   +EM ++ LL+G+SA  +G+ +  +++ +S H   L+P    ++D +P   QV+A+I  GL+   +A R +A + L E+GR          PP        D E  S+ AG ++G++    G   I   + N PE+L +   Y+ G ++                    R+ +  +  K   P        ++Q     ++EG+  N D+T  GA +A+ +IY+ + +  IA+ L  P+T YLL+ ++   L  R +AR LI+W  + P+  WV S +PQ ++  +  +  T     ++  L+T+  +++ ++ G+C  +G R+AGT N +A   +  + +    + +    +      HY+    LS +LLS  M+ AGSGNL +L++ R++    H K  G  NYG  + + +++GLLFLGGG+ +LS S+ S A L+ A +P FP      RYHLQ+LRHLYV+A+ PR++  VD+DT +   V   V +K
Sbjct:  181 WPTKYGLLFERNSNSTLHEVPQSPPREPLPTIFSMLHPLDEITPLVSRSGGIFGSSRVHYVSDPTLRIVFTHSDPSIVMTYDTVQGSHTVWALRKVKAEEQNAVLNLE---QIGTPQHGMTTSSLTAHLRSVSKGESPTASPFQNFSSLHSQSRSVSSPSIHSRSHS-PSISNMAALSRSHSPALGVHSFAGVQRFNFSSNT----PSPKRLGASGSPNSTSSDFLSVETEPIVPELCLDHLWTETVANIR---------------EKNSQATKV----------FITTDLCGQKFLCFLLES----FHQLRLVKFEESNDKSQLIFGSVTNISAK-----DAAPVEAIDTMVVLENNGNLVLYTGVVRVGKIFIQGLAAPSLGMSNPMPRPSTPLESISTPAKPLNKHLAPMDEAGMLSPVPELRDSTRLHESTYLDDCTFHQFGTYIHSVRDPVHNRLTLEINNGSMVRISIPDIATSELVKKCLQAIKYILPKEIAVQMLVKWYNCHNA-PGGPTNHSEWNMFVTCLMNMMGYNTDKLSWTRNCDFEGSLSPVIAPKKARPSETG-------SDEDWEYLINSDYHRNVETHILARALQLDSLDALVAKDDIQNVVSLDSSALLFSHAPAIFYVLHLTYEELKLNTLMREGIQSLVMLLLQLARDLNLDTYMDFYFRDYPTLVKTTNQTCRIEPTQIGFMNYPSFFTA----EPPSIYHWLSSRLKGEKVTPYPY-LPGICERSKLVVLSFALYILGDETAVL-----HEPRKYLCKITAGQRK-------QQLGDDRRYSLKPTPSVSGLSEKLVVWMTNIGFTLQDLESLPFGVALPIRHAIYQCRQQPASDWAQGVCILIGRQDLSKQACDGNLPKAKPSAGPV----------------------------PSPEVPPAADAEEEDDG---MNDLNQEVMSLIWSEDLRVQEVRRLLQSSHPVRVN--VVQMPEVSDHEFI-----EEKENRLLQLS-QRTMALPVGRGMFTL-FSYHPVPTEPLPIPKLNLTGRAPPRNTTVDLNSGNIDVPPNMACWANFHNGVAAGLKIAPASQ-IDSAWIVYNKPK----NAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKGHEMTSIGLLLGVSAAKLGTMDISITRLLSIHIPALLPPTSTELD-VPHNVQVAAVIGIGLVYQGTAHRHIAEVLLAEIGR----------PPGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLNVPEQLYQ---YMVGGHK--------------------RSHVGVSREKHKSP--------SYQ-----IKEGDTINVDVTCPGATLALAMIYLKTNNRSIADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNAQWVNSNVPQIITDNSISLNATEQPSSEDLNLETLAQAHVYIIAGACLALGFRFAGTANLSAFNCLCKFAKDFECLSAQAAGI----TGHYNLETCLSVVLLSLSMVMAGSGNLKVLQLCRFM----HKKTGGEMNYGFHLAHHMALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPVHSTDNRYHLQALRHLYVLASEPRLLVPVDVDTNLPCYVLLEVTYK 1643          
BLAST of anaphase-promoting complex subunit 1 vs. Ensembl Xenopus
Match: crip2 (cysteine-rich protein 2 [Source:Xenbase;Acc:XB-GENE-953187])

HSP 1 Score: 365.925 bits (938), Expect = 7.380e-102
Identity = 399/1629 (24.49%), Postives = 707/1629 (43.40%), Query Frame = 2
Query:  506 WKFRECLFVEREEMNNFHDY--SPN-----SLFVMLHTLAEFTPVVFKDE--FGN--CGFINDTRFRIVSVCESSFLLLAYDKTDDSFSLWRIRDATQNDFSDLYDMHWDGSIAVKKQKLKSNFISGRSRMES---SINHTNFNDNSHISSEYFEISTDVINNSVRTVEDLDIRSPIARSLKNTKDCQIPDKMTLLNETNNCLKIHPSYRQM-----------------IEPLYPKVCLDFLFSCKAGNVEPTLDGSYADYHSTPNAYNSQKDTANQSKNGKVFGFFSEDFYRRKYLCCLKETNAGNHSILKIVKFNYEND-------TFCNLEEKSWPVLDAVYLERLQFTIVLELGSTLSIYSGMTFVCKISL---------LNALVYQPDDPF-----------------DDVGMEMSISDINSMNRLSDPT--------DYGFTIHT-----QSELAL--------RLYLPEMVRLHXXXXXXXXXXXXXPIDTGMTMLCRWYSLNRAVDNNESASAEWRRFVEFLLENMGFARNRQNKAGQQQTQQETHSIVQDVKELCLDNNNGHGIASSSADTDVSMDEICSKKLRTNSGLYSIERRCLNERDGLEEYSALCYNVTDRLLSQHAPTVLFCLHLVYECEKLNYSFCRHFKNLAALNCSIACSIGARQYLDYYLQDNPDLMADIAQL----PSLAQYILIPSDITATWNPQPPNWSEILFNLMGTQSPIPNNYRYPIIEDLSEMLIQLVKIWLVMFRPDTLLDNPTSELNRYFYRINFNMSGIPCRFPVHFCHDLNRANRNETLKIDDIYRRTATYLSEIKFHVNDLDFMNDGLASIFRIVFFHCNKFPE------LYSILHRADLDMQRQLILPIVQESAVPKVLTTPLKKFRSVSEPRRNCHAYWTNNVKPPMAMPKCLDFINRTDNNYLMHVLDSDPIVQLSYPDIRIHEAYKMIQSCCPIKLDAGICSNFTIEDGDTLSTPLKEELEGYLKIINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGKFSLSESG---KPQTIESNASTKVWPNFHNGVAAGLMIAPMNESVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPP-------MDVELTSVTAGFSVGLIMFQQGH--IFDREHN-PEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYMNSMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKAFLIKPT---GIQEKYLDTVNDSYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINIKSNIELMPNVNRNHYDW--ALSTLLLSACMISAGSGNLTLLRISRYLQSIHHPKDCG--NYGVFMTYXXXXXXXXXXXXXXXXXNSHRSAAILVIAFFPRFPPTYNGRRYHLQSLRHLYVIATRPRVMCAVDLDTMIAVPVESRVVFK 5047
            W  +  L  ER   +  H+   SP      ++F MLH L E TP+V +    FG+    +++D   RIV       +++ YD    S ++W +R     + + + ++     I   +  + ++ ++   R  S   S   + F + S + S+   +S+  I++   +   +   + ++RS            +   N ++N     PS +++                  EP+ P++CLD L++    N+                  NSQ              F + D   +K+LC L E+       L++VKF   ND       +  N+  K     DA  +E +   +VLE    L +Y+G+  V KI +         ++  + +P  P                  D+ GM   + ++    RL + T         +G  IH+      + L L        R+ +P++    +VKKCL  +K +LP +  + ML +WY+ + A     +  +EW  FV  L+  MG+  ++ +       +     ++   K    +         S  D +  ++    + + T+    +++   L+     ++   +    +  LL  HAP + + LHL YE  KLN       ++L  L   +A  +    Y+D+Y +D P L+    Q     P+   ++  PS  TA    +PP+    L + +  +   P  Y  P I + S++++ ++ ++L                 + FY    N +       +   H     +   T  +  +  +   +++ I F + DL+ +  G+A   R   + C + P       +  ++ R DL  Q         +  +PK                             P+ +P   D     D    M+ L+ + +  +   D+R+ E  +++QS  P++++  +     + D + +     EE E  L  ++ QRT +LP+GRGM  L        T+ LP+P L LTG+     +        I+   +   W NFHNGVAAGL IAP ++ +D  WI+   P       EL+ E AG L  LGLNGHL KL+   I   +   +EM ++ LL+G+SA  +G+ +  +++ +S H   L+P    ++D +P   QV+A+I  GL+   +A R +A + L E+GR          PP        D E  S+ AG ++G++    G   I   + N PE+L +   Y+ G ++                    R+ +  +  K   P        ++Q K     EG+  N D+T  GA +A+ +IY+ + +  IA+ L  P+T YLL+ ++   L  R +AR LI+W  + P+  WV S +PQ ++  +  +  T     ++  L+T+  +++ ++ G+C  +G R+AGT N +A   +  + +    + +    +      HY+    LS +LLS  M+ AGSGNL +L++ R++    H K  G  NYG  + + +++GLLFLGGG+ +LS S+ S A L+ A +P FP      RYHLQ+LRHLYV+A+ PR++  VD+DT +   V   V +K
Sbjct:  181 WPTKYGLLFERNSNSTLHEVPQSPPREPLPTIFSMLHPLDEITPLVSRSGGIFGSSRVHYVSDPTLRIVFTHSDPSIVMTYDTVQGSHTVWALRKVKAEEQNAVLNLE---QIGTPQHGMTTSSLTAHLRSVSKGESPTASPFQNFSSLHSQSRSVSSPSIHSRSHS-PSISNMAALSRSHSPALGVHSFAGVQRFNFSSNT----PSPKRLGASGSPNSTSSDFLSVETEPIVPELCLDHLWTETVANIR---------------EKNSQATKV----------FITTDLCGQKFLCFLLES----FHQLRLVKFEESNDKSQLIFGSVTNISAK-----DAAPVEAIDTMVVLENNGNLVLYTGVVRVGKIFIQGLAAPSLGMSNPMPRPSTPLESISTPAKPLNKHLAPMDEAGMLSPVPELRDSTRLHESTYLDDCTFHQFGTYIHSVRDPVHNRLTLEINNGSMVRISIPDIATSELVKKCLQAIKYILPKEIAVQMLVKWYNCHNA-PGGPTNHSEWNMFVTCLMNMMGYNTDKLSWTRNCDFEGSLSPVIAPKKARPSETG-------SDEDWEYLINSDYHRNVETHILARALQLDSLDALVAKDDIQNVVSLDSSALLFSHAPAIFYVLHLTYEELKLNTLMREGIQSLVMLLLQLARDLNLDTYMDFYFRDYPTLVKTTNQTCRIEPTQIGFMNYPSFFTA----EPPSIYHWLSSRLKGEKVTPYPY-LPGICERSKLVVLVIFLFL-----------------QGFYHPPMNST-------ILLSHASPVYSLKPTPSVSGLSEKLVVWMTNIGFTLQDLESLPFGVALPIRHAIYQCRQQPASDWAQGVCILIGRQDLSKQ-------ACDGNLPKA---------------------------KPVCVPPAADAEEEDDG---MNDLNQEVMSLIWSEDLRVQEVRRLLQSSHPVRVN--VVQMPEVSDHEFI-----EEKENRLLQLS-QRTMALPVGRGMFTL-FSYHPVPTEPLPIPKLNLTGRAPPRNTTVDLNSGNIDVPPNMACWANFHNGVAAGLKIAPASQ-IDSAWIVYNKPK----NAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKGHEMTSIGLLLGVSAAKLGTMDISITRLLSIHIPALLPPTSTELD-VPHNVQVAAVIGIGLVYQGTAHRHIAEVLLAEIGR----------PPGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLNVPEQLYQ---YMVGGHK--------------------RSHVGVSREKHKSP--------SYQIK-----EGDTINVDVTCPGATLALAMIYLKTNNRSIADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNAQWVNSNVPQIITDNSISLNATEQPSSEDLNLETLAQAHVYIIAGACLALGFRFAGTANLSAFNCLCKFAKDFECLSAQAAGI----TGHYNLETCLSVVLLSLSMVMAGSGNLKVLQLCRFM----HKKTGGEMNYGFHLAHHMALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPVHSTDNRYHLQALRHLYVLASEPRLLVPVDVDTNLPCYVLLEVTYK 1624          
BLAST of anaphase-promoting complex subunit 1 vs. Ensembl Xenopus
Match: crip2 (cysteine-rich protein 2 [Source:Xenbase;Acc:XB-GENE-953187])

HSP 1 Score: 364.385 bits (934), Expect = 2.332e-101
Identity = 399/1629 (24.49%), Postives = 708/1629 (43.46%), Query Frame = 2
Query:  506 WKFRECLFVEREEMNNFHDY--SPN-----SLFVMLHTLAEFTPVVFKDE--FGN--CGFINDTRFRIVSVCESSFLLLAYDKTDDSFSLWRIRDATQNDFSDLYDMHWDGSIAVKKQKLKSNFISGRSRMES---SINHTNFNDNSHISSEYFEISTDVINNSVRTVEDLDIRSPIARSLKNTKDCQIPDKMTLLNETNNCLKIHPSYRQM-----------------IEPLYPKVCLDFLFSCKAGNVEPTLDGSYADYHSTPNAYNSQKDTANQSKNGKVFGFFSEDFYRRKYLCCLKETNAGNHSILKIVKFNYEND-------TFCNLEEKSWPVLDAVYLERLQFTIVLELGSTLSIYSGMTFVCKISL---------LNALVYQPDDPF-----------------DDVGMEMSISDINSMNRLSDPT--------DYGFTIHT-----QSELAL--------RLYLPEMVRLHXXXXXXXXXXXXXPIDTGMTMLCRWYSLNRAVDNNESASAEWRRFVEFLLENMGFARNRQNKAGQQQTQQETHSIVQDVKELCLDNNNGHGIASSSADTDVSMDEICSKKLRTNSGLYSIERRCLNERDGLEEYSALCYNVTDRLLSQHAPTVLFCLHLVYECEKLNYSFCRHFKNLAALNCSIACSIGARQYLDYYLQDNPDLMADIAQL----PSLAQYILIPSDITATWNPQPPNWSEILFNLMGTQSPIPNNYRYPIIEDLSEMLIQLVKIWLVMFRPDTLLDNPTSELNRYFYRINFNMSGIPCRFPVHFCHDLNRANRNETLKIDDIYRRTATYLSEIKFHVNDLDFMNDGLASIFRIVFFHCNKFPE------LYSILHRADLDMQRQLILPIVQESAVPKVLTTPLKKFRSVSEPRRNCHAYWTNNVKPPMAMPKCLDFINRTDNNYLMHVLDSDPIVQLSYPDIRIHEAYKMIQSCCPIKLDAGICSNFTIEDGDTLSTPLKEELEGYLKIINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGKFSLSESG---KPQTIESNASTKVWPNFHNGVAAGLMIAPMNESVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPP-------MDVELTSVTAGFSVGLIMFQQGH--IFDREHN-PEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYMNSMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKAFLIKPT---GIQEKYLDTVNDSYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINIKSNIELMPNVNRNHYDW--ALSTLLLSACMISAGSGNLTLLRISRYLQSIHHPKDCG--NYGVFMTYXXXXXXXXXXXXXXXXXNSHRSAAILVIAFFPRFPPTYNGRRYHLQSLRHLYVIATRPRVMCAVDLDTMIAVPVESRVVFK 5047
            W  +  L  ER   +  H+   SP      ++F MLH L E TP+V +    FG+    +++D   RIV       +++ YD    S ++W +R     + + + ++     I   +  + ++ ++   R  S   S   + F + S + S+   +S+  I++   +   +   + ++RS            +   N ++N     PS +++                  EP+ P++CLD L++    N+                           S+  KVF   + D   +K+LC L E+       L++VKF   ND       +  N+  K     DA  +E +   +VLE    L +Y+G+  V KI +         ++  + +P  P                  D+ GM   + ++    RL + T         +G  IH+      + L L        R+ +P++    +VKKCL  +K +LP +  + ML +WY+ + A     +  +EW  FV  L+  MG+  ++ +       +     ++   K    +         S  D +  ++    + + T+    +++   L+     ++   +    +  LL  HAP + + LHL YE  KLN       ++L  L   +A  +    Y+D+Y +D P L+    Q     P+   ++  PS  TA    +PP+    L + +  +   P  Y  P I + S++++ ++ ++L                 + FY    N +       +   H     +   T  +  +  +   +++ I F + DL+ +  G+A   R   + C + P       +  ++ R DL  Q         +  +PK                             P+ +P   D     D    M+ L+ + +  +   D+R+ E  +++QS  P++++  +     + D + +     EE E  L  ++ QRT +LP+GRGM  L        T+ LP+P L LTG+     +        I+   +   W NFHNGVAAGL IAP ++ +D  WI+   P       EL+ E AG L  LGLNGHL KL+   I   +   +EM ++ LL+G+SA  +G+ +  +++ +S H   L+P    ++D +P   QV+A+I  GL+   +A R +A + L E+GR          PP        D E  S+ AG ++G++    G   I   + N PE+L +   Y+ G ++                    R+ +  +  K   P        ++Q K     EG+  N D+T  GA +A+ +IY+ + +  IA+ L  P+T YLL+ ++   L  R +AR LI+W  + P+  WV S +PQ ++  +  +  T     ++  L+T+  +++ ++ G+C  +G R+AGT N +A   +  + +    + +    +      HY+    LS +LLS  M+ AGSGNL +L++ R++    H K  G  NYG  + + +++GLLFLGGG+ +LS S+ S A L+ A +P FP      RYHLQ+LRHLYV+A+ PR++  VD+DT +   V   V +K
Sbjct:  181 WPTKYGLLFERNSNSTLHEVPQSPPREPLPTIFSMLHPLDEITPLVSRSGGIFGSSRVHYVSDPTLRIVFTHSDPSIVMTYDTVQGSHTVWALRKVKAEEQNAVLNLE---QIGTPQHGMTTSSLTAHLRSVSKGESPTASPFQNFSSLHSQSRSVSSPSIHSRSHS-PSISNMAALSRSHSPALGVHSFAGVQRFNFSSNT----PSPKRLGASGSPNSTSSDFLSVETEPIVPELCLDHLWTETVANIR-----------------------EKNSQATKVF--ITTDLCGQKFLCFLLES----FHQLRLVKFEESNDKSQLIFGSVTNISAK-----DAAPVEAIDTMVVLENNGNLVLYTGVVRVGKIFIQGLAAPSLGMSNPMPRPSTPLESISTPAKPLNKHLAPMDEAGMLSPVPELRDSTRLHESTYLDDCTFHQFGTYIHSVRDPVHNRLTLEINNGSMVRISIPDIATSELVKKCLQAIKYILPKEIAVQMLVKWYNCHNA-PGGPTNHSEWNMFVTCLMNMMGYNTDKLSWTRNCDFEGSLSPVIAPKKARPSETG-------SDEDWEYLINSDYHRNVETHILARALQLDSLDALVAKDDIQNVVSLDSSALLFSHAPAIFYVLHLTYEELKLNTLMREGIQSLVMLLLQLARDLNLDTYMDFYFRDYPTLVKTTNQTCRIEPTQIGFMNYPSFFTA----EPPSIYHWLSSRLKGEKVTPYPY-LPGICERSKLVVLVIFLFL-----------------QGFYHPPMNST-------ILLSHASPVYSLKPTPSVSGLSEKLVVWMTNIGFTLQDLESLPFGVALPIRHAIYQCRQQPASDWAQGVCILIGRQDLSKQ-------ACDGNLPKA---------------------------KPVCVPPAADAEEEDDG---MNDLNQEVMSLIWSEDLRVQEVRRLLQSSHPVRVN--VVQMPEVSDHEFI-----EEKENRLLQLS-QRTMALPVGRGMFTL-FSYHPVPTEPLPIPKLNLTGRAPPRNTTVDLNSGNIDVPPNMACWANFHNGVAAGLKIAPASQ-IDSAWIVYNKPK----NAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKGHEMTSIGLLLGVSAAKLGTMDISITRLLSIHIPALLPPTSTELD-VPHNVQVAAVIGIGLVYQGTAHRHIAEVLLAEIGR----------PPGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLNVPEQLYQ---YMVGGHK--------------------RSHVGVSREKHKSP--------SYQIK-----EGDTINVDVTCPGATLALAMIYLKTNNRSIADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNAQWVNSNVPQIITDNSISLNATEQPSSEDLNLETLAQAHVYIIAGACLALGFRFAGTANLSAFNCLCKFAKDFECLSAQAAGI----TGHYNLETCLSVVLLSLSMVMAGSGNLKVLQLCRFM----HKKTGGEMNYGFHLAHHMALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPVHSTDNRYHLQALRHLYVLASEPRLLVPVDVDTNLPCYVLLEVTYK 1624          
BLAST of anaphase-promoting complex subunit 1 vs. Ensembl Xenopus
Match: crip2 (cysteine-rich protein 2 [Source:Xenbase;Acc:XB-GENE-953187])

HSP 1 Score: 363.999 bits (933), Expect = 2.938e-101
Identity = 404/1629 (24.80%), Postives = 707/1629 (43.40%), Query Frame = 2
Query:  506 WKFRECLFVEREEMNNFHDY--SPN-----SLFVMLHTLAEFTPVVFKDE--FGN--CGFINDTRFRIVSVCESSFLLLAYDKTDDSFSLWRIRDATQNDFSDLYDMHWDGSIAVKKQKLKSNFISGRSRMES---SINHTNFNDNSHISSEYFEISTDVINNSVRTVEDLDIRSPIARSLKNTKDCQIPDKMTLLNETNNCLKIHPSYRQM-----------------IEPLYPKVCLDFLFSCKAGNVEPTLDGSYADYHSTPNAYNSQKDTANQSKNGKVFGFFSEDFYRRKYLCCLKETNAGNHSILKIVKFNYEND-------TFCNLEEKSWPVLDAVYLERLQFTIVLELGSTLSIYSGMTFVCKISL---------LNALVYQPDDPF-----------------DDVGMEMSISDINSMNRLSDPT--------DYGFTIHT-----QSELAL--------RLYLPEMVRLHXXXXXXXXXXXXXPIDTGMTMLCRWYSLNRAVDNNESASAEWRRFVEFLLENMGFARNRQNKAGQQQTQQETHSIVQDVKELCLDNNNGHGIASSSADTDVSMDEICSKKLRTNSGLYSIERRCLNERDGLEEYSALCYNVTDRLLSQHAPTVLFCLHLVYECEKLNYSFCRHFKNLAALNCSIACSIGARQYLDYYLQDNPDLMADIAQL----PSLAQYILIPSDITATWNPQPPNWSEILFNLMGTQSPIPNNYRYPIIEDLSEMLIQLVKIWLVMFRPDTLLDNPTSELNRYFYRINFNMSGIPCRFPVHFCHDLNRANRNETLKIDDIYRRTATYLSEIKFHVNDLDFMNDGLASIFRIVFFHCNKFPE------LYSILHRADLDMQRQLILPIVQESAVPKVLTTPLKKFRSVSEPRRNCHAYWTNNVKPPMAMPKCLDFINRTDNNYLMHVLDSDPIVQLSYPDIRIHEAYKMIQSCCPIKLDAGICSNFTIEDGDTLSTPLKEELEGYLKIINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGKFSLSESG---KPQTIESNASTKVWPNFHNGVAAGLMIAPMNESVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPP-------MDVELTSVTAGFSVGLIMFQQGH--IFDREHN-PEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYMNSMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKAFLIKPT---GIQEKYLDTVNDSYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINIKSNIELMPNVNRNHYDW--ALSTLLLSACMISAGSGNLTLLRISRYLQSIHHPKDCG--NYGVFMTYXXXXXXXXXXXXXXXXXNSHRSAAILVIAFFPRFPPTYNGRRYHLQSLRHLYVIATRPRVMCAVDLDTMIAVPVESRVVFK 5047
            W  +  L  ER   +  H+   SP      ++F MLH L E TP+V +    FG+    +++D   RIV       +++ YD    S ++W +R     + + + ++     I   +  + ++ ++   R  S   S   + F + S + S+   +S+  I++   +   +   + ++RS            +   N ++N     PS +++                  EP+ P++CLD L++    N+                           S+  KVF   + D   +K+LC L E+       L++VKF   ND       +  N+  K     DA  +E +   +VLE    L +Y+G+  V KI +         ++  + +P  P                  D+ GM   + ++    RL + T         +G  IH+      + L L        R+ +P++    +VKKCL  +K +LP +  + ML +WY+ + A     +  +EW  FV  L+  MG+                      +  +L    N+   + +S    +V    I ++ L+ +S         L  +D ++   +L    +  LL  HAP + + LHL YE  KLN       ++L  L   +A  +    Y+D+Y +D P L+    Q     P+   ++  PS  TA    +PP+    L + +  +   P  Y  P I + S++++ ++ ++L                 + FY    N +       +   H     +   T  +  +  +   +++ I F + DL+ +  G+A   R   + C + P       +  ++ R DL  Q         +  +PK                             P+ +P   D     D    M+ L+ + +  +   D+R+ E  +++QS  P++++  +     + D + +     EE E  L  ++ QRT +LP+GRGM  L        T+ LP+P L LTG+     +        I+   +   W NFHNGVAAGL IAP ++ +D  WI+   P       EL+ E AG L  LGLNGHL KL+   I   +   +EM ++ LL+G+SA  +G+ +  +++ +S H   L+P    ++D +P   QV+A+I  GL+   +A R +A + L E+GR          PP        D E  S+ AG ++G++    G   I   + N PE+L +   Y+ G ++                    R+ +  +  K   P        ++Q K     EG+  N D+T  GA +A+ +IY+ + +  IA+ L  P+T YLL+ ++   L  R +AR LI+W  + P+  WV S +PQ ++  +  +  T     ++  L+T+  +++ ++ G+C  +G R+AGT N +A   +  + +    + +    +      HY+    LS +LLS  M+ AGSGNL +L++ R++    H K  G  NYG  + + +++GLLFLGGG+ +LS S+ S A L+ A +P FP      RYHLQ+LRHLYV+A+ PR++  VD+DT +   V   V +K
Sbjct:  181 WPTKYGLLFERNSNSTLHEVPQSPPREPLPTIFSMLHPLDEITPLVSRSGGIFGSSRVHYVSDPTLRIVFTHSDPSIVMTYDTVQGSHTVWALRKVKAEEQNAVLNLE---QIGTPQHGMTTSSLTAHLRSVSKGESPTASPFQNFSSLHSQSRSVSSPSIHSRSHS-PSISNMAALSRSHSPALGVHSFAGVQRFNFSSNT----PSPKRLGASGSPNSTSSDFLSVETEPIVPELCLDHLWTETVANIR-----------------------EKNSQATKVF--ITTDLCGQKFLCFLLES----FHQLRLVKFEESNDKSQLIFGSVTNISAK-----DAAPVEAIDTMVVLENNGNLVLYTGVVRVGKIFIQGLAAPSLGMSNPMPRPSTPLESISTPAKPLNKHLAPMDEAGMLSPVPELRDSTRLHESTYLDDCTFHQFGTYIHSVRDPVHNRLTLEINNGSMVRISIPDIATSELVKKCLQAIKYILPKEIAVQMLVKWYNCHNA-PGGPTNHSEWNMFVTCLMNMMGY----------------------NTDKLSWTRNDWEYLINSDYHRNVET-HILARALQLDS------LDALVAKDDIQNVVSLD---SSALLFSHAPAIFYVLHLTYEELKLNTLMREGIQSLVMLLLQLARDLNLDTYMDFYFRDYPTLVKTTNQTCRIEPTQIGFMNYPSFFTA----EPPSIYHWLSSRLKGEKVTPYPY-LPGICERSKLVVLVIFLFL-----------------QGFYHPPMNST-------ILLSHASPVYSLKPTPSVSGLSEKLVVWMTNIGFTLQDLESLPFGVALPIRHAIYQCRQQPASDWAQGVCILIGRQDLSKQ-------ACDGNLPKA---------------------------KPVCVPPAADAEEEDDG---MNDLNQEVMSLIWSEDLRVQEVRRLLQSSHPVRVN--VVQMPEVSDHEFI-----EEKENRLLQLS-QRTMALPVGRGMFTL-FSYHPVPTEPLPIPKLNLTGRAPPRNTTVDLNSGNIDVPPNMACWANFHNGVAAGLKIAPASQ-IDSAWIVYNKPK----NAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKGHEMTSIGLLLGVSAAKLGTMDISITRLLSIHIPALLPPTSTELD-VPHNVQVAAVIGIGLVYQGTAHRHIAEVLLAEIGR----------PPGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLNVPEQLYQ---YMVGGHK--------------------RSHVGVSREKHKSP--------SYQIK-----EGDTINVDVTCPGATLALAMIYLKTNNRSIADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNAQWVNSNVPQIITDNSISLNATEQPSSEDLNLETLAQAHVYIIAGACLALGFRFAGTANLSAFNCLCKFAKDFECLSAQAAGI----TGHYNLETCLSVVLLSLSMVMAGSGNLKVLQLCRFM----HKKTGGEMNYGFHLAHHMALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPVHSTDNRYHLQALRHLYVLASEPRLLVPVDVDTNLPCYVLLEVTYK 1599          
BLAST of anaphase-promoting complex subunit 1 vs. Ensembl Xenopus
Match: crip2 (cysteine-rich protein 2 [Source:Xenbase;Acc:XB-GENE-953187])

HSP 1 Score: 362.459 bits (929), Expect = 8.388e-101
Identity = 400/1627 (24.59%), Postives = 705/1627 (43.33%), Query Frame = 2
Query:  506 WKFRECLFVEREEMNNFHDY--SPN-----SLFVMLHTLAEFTPVVFKDE--FGN--CGFINDTRFRIVSVCESSFLLLAYDKTDDSFSLWRIRDATQNDFSDLYDMHWDGSIAVKKQKLKSNFISGRSRMES---SINHTNFNDNSHISSEYFEISTDVINNSVRTVEDLDIRSPIARSLKNTKDCQIPDKMTLLNETNNCLKIHPSYRQM-----------------IEPLYPKVCLDFLFSCKAGNVEPTLDGSYADYHSTPNAYNSQKDTANQSKNGKVFGFFSEDFYRRKYLCCLKETNAGNHSILKIVKFNYEND-------TFCNLEEKSWPVLDAVYLERLQFTIVLELGSTLSIYSGMTFVCKISL---------LNALVYQPDDPF-----------------DDVGMEMSISDINSMNRLSDPT--------DYGFTIHT-----QSELAL--------RLYLPEMVRLHXXXXXXXXXXXXXPIDTGMTMLCRWYSLNRAVDNNESASAEWRRFVEFLLENMGFARNRQNKAGQQQTQQETHSIVQDVKELCLDNNNGHGIASSSADTDVSMDEICSKKLRTNSGLYSIERRCLNERDGLEEYSALCYNVTDRLLSQHAPTVLFCLHLVYECEKLNYSFCRHFKNLAALNCSIACSIGARQYLDYYLQDNPDLMADIAQL----PSLAQYILIPSDITATWNPQPPNWSEILFNLMGTQSPIPNNYRYPIIEDLSEMLIQLVKIWLVMFRPDTLLDNPTSELNRYFYRINFNMSGIPCRFPVHFCHDLNRANRNETLKIDDIYRRTATYLSEIKFHVNDLDFMNDGLASIFRIVFFHCNKFPE------LYSILHRADLDMQRQLILPIVQESAVPKVLTTPLKKFRSVSEPRRNCHAYWTNNVKPPMAMPKCLDFINRTDNNYLMHVLDSDPIVQLSYPDIRIHEAYKMIQSCCPIKLDAGICSNFTIEDGDTLSTPLKEELEGYLKIINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGKFSLSESG---KPQTIESNASTKVWPNFHNGVAAGLMIAPMNESVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPP-------MDVELTSVTAGFSVGLIMFQQGH--IFDREHN-PEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYMNSMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKAF-LIKPTGIQEKYLDTVNDSYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINIKSNIELMPNVNRNHYDW--ALSTLLLSACMISAGSGNLTLLRISRYLQSIHHPKDCG--NYGVFMTYXXXXXXXXXXXXXXXXXNSHRSAAILVIAFFPRFPPTYNGRRYHLQSLRHLYVIATRPRVMCAVDLDTMIAVPVESRVVFK 5047
            W  +  L  ER   +  H+   SP      ++F MLH L E TP+V +    FG+    +++D   RIV       +++ YD    S ++W +R     + + + ++     I   +  + ++ ++   R  S   S   + F + S + S+   +S+  I++   +   +   + ++RS            +   N ++N     PS +++                  EP+ P++CLD L++    N+                  NSQ              F + D   +K+LC L E+       L++VKF   ND       +  N+  K     DA  +E +   +VLE    L +Y+G+  V KI +         ++  + +P  P                  D+ GM   + ++    RL + T         +G  IH+      + L L        R+ +P++    +VKKCL  +K +LP +  + ML +WY+ + A     +  +EW  FV  L+  MG+  ++ +       +     ++   K    +         S  D +  ++    + + T+    +++   L+     ++   +    +  LL  HAP + + LHL YE  KLN       ++L  L   +A  +    Y+D+Y +D P L+    Q     P+   ++  PS  TA    +PP+    L + +  +   P  Y  P I + S++++ ++ ++L                 + FY    N +       +   H     +   T  +  +  +   +++ I F + DL+ +  G+A   R   + C + P       +  ++ R DL  Q         +  +PK                       +    P   +P   D     D    M+ L+ + +  +   D+R+ E  +++QS  P++++  +     + D + +     EE E  L  ++ QRT +LP+GRGM  L        T+ LP+P L LTG+     +        I+   +   W NFHNGVAAGL IAP ++ +D  WI+   P       EL+ E AG L  LGLNGHL KL+   I   +   +EM ++ LL+G+SA  +G+ +  +++ +S H   L+P    ++D +P   QV+A+I  GL+   +A R +A + L E+GR          PP        D E  S+ AG ++G++    G   I   + N PE+L +   Y+ G ++                    R+ +  +  K   P        ++Q     ++EG+  N D+T  GA +A+ +IY+ + +  IA+ L  P+T YLL+ ++   L  R +AR LI+W  + P+  WV S +PQ  +S +    +    ++  L+T+  +++ ++ G+C  +G R+AGT N +A          L     + E +      HY+    LS +LLS  M+ AGSGNL +L++ R++    H K  G  NYG  + + +++GLLFLGGG+ +LS S+ S A L+ A +P FP      RYHLQ+LRHLYV+A+ PR++  VD+DT +   V   V +K
Sbjct:  181 WPTKYGLLFERNSNSTLHEVPQSPPREPLPTIFSMLHPLDEITPLVSRSGGIFGSSRVHYVSDPTLRIVFTHSDPSIVMTYDTVQGSHTVWALRKVKAEEQNAVLNLE---QIGTPQHGMTTSSLTAHLRSVSKGESPTASPFQNFSSLHSQSRSVSSPSIHSRSHS-PSISNMAALSRSHSPALGVHSFAGVQRFNFSSNT----PSPKRLGASGSPNSTSSDFLSVETEPIVPELCLDHLWTETVANIR---------------EKNSQATKV----------FITTDLCGQKFLCFLLES----FHQLRLVKFEESNDKSQLIFGSVTNISAK-----DAAPVEAIDTMVVLENNGNLVLYTGVVRVGKIFIQGLAAPSLGMSNPMPRPSTPLESISTPAKPLNKHLAPMDEAGMLSPVPELRDSTRLHESTYLDDCTFHQFGTYIHSVRDPVHNRLTLEINNGSMVRISIPDIATSELVKKCLQAIKYILPKEIAVQMLVKWYNCHNA-PGGPTNHSEWNMFVTCLMNMMGYNTDKLSWTRNCDFEGSLSPVIAPKKARPSETG-------SDEDWEYLINSDYHRNVETHILARALQLDSLDALVAKDDIQNVVSLDSSALLFSHAPAIFYVLHLTYEELKLNTLMREGIQSLVMLLLQLARDLNLDTYMDFYFRDYPTLVKTTNQTCRIEPTQIGFMNYPSFFTA----EPPSIYHWLSSRLKGEKVTPYPY-LPGICERSKLVVLVIFLFL-----------------QGFYHPPMNST-------ILLSHASPVYSLKPTPSVSGLSEKLVVWMTNIGFTLQDLESLPFGVALPIRHAIYQCRQQPASDWAQGVCILIGRQDLSKQ-------ACDGNLPK-----------------------SAGPVPSPEVPPAADAEEEDDG---MNDLNQEVMSLIWSEDLRVQEVRRLLQSSHPVRVN--VVQMPEVSDHEFI-----EEKENRLLQLS-QRTMALPVGRGMFTL-FSYHPVPTEPLPIPKLNLTGRAPPRNTTVDLNSGNIDVPPNMACWANFHNGVAAGLKIAPASQ-IDSAWIVYNKPK----NAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKGHEMTSIGLLLGVSAAKLGTMDISITRLLSIHIPALLPPTSTELD-VPHNVQVAAVIGIGLVYQGTAHRHIAEVLLAEIGR----------PPGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLNVPEQLYQ---YMVGGHK--------------------RSHVGVSREKHKSP--------SYQ-----IKEGDTINVDVTCPGATLALAMIYLKTNNRSIADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNAQWVNSNVPQVNNSISLNATEQPSSEDLNLETLAQAHVYIIAGACLALGFRFAGTANLSA-------FNCLCKFAKDFECLSAQATGHYNLETCLSVVLLSLSMVMAGSGNLKVLQLCRFM----HKKTGGEMNYGFHLAHHMALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPVHSTDNRYHLQALRHLYVLASEPRLLVPVDVDTNLPCYVLLEVTYK 1623          
BLAST of anaphase-promoting complex subunit 1 vs. Ensembl Mouse
Match: Anapc1 (anaphase promoting complex subunit 1 [Source:MGI Symbol;Acc:MGI:103097])

HSP 1 Score: 355.525 bits (911), Expect = 1.288e-98
Identity = 358/1381 (25.92%), Postives = 618/1381 (44.75%), Query Frame = 2
Query: 1103 EPLYPKVCLDFLFSCKAGNVEPTLDGSYADYHSTPNAYNSQKDTANQSKNGKVFGFFSEDFYRRKYLCCLKETNAGNHSILKIVKFNYEND-------TFCNLEEKSWPVLDAVYLERLQFTIVLELGSTLSIYSGMTFVCKISL---------LNALVYQPDDPFDDVGMEMSISDI-NSMNRL------------------------------------SDPTDYGFTIHTQSELALRLYLPEMVRLHXXXXXXXXXXXXXPIDTGMTMLCRWYSLNRAVDNNESASAEWRRFVEFLLENMGFARNRQNKAGQQQTQQETHSIVQDVKELCLDNNNGHGIASSSADTDVSMDEICSKKLRT---NSGLYSIERRCLNERDGLEEYSALCYNVTDRLLSQHAPTVLFCLHLVYECEKLNYSFCRHFKNLAALNCSIACSIGARQYLDYYLQDNPDLMADIAQLPSLAQYILIPSDITATWNPQPPNWSEILFNLMGTQSPIPNNYRYPIIEDLSEMLIQLVKIWLVMFRPDTLLDNP--TSELNRYFYRINFNMSGIPCRFPVHFCHDLNRANRNETLKIDDIYRRTATYLSEIKFHVNDLDFMNDGLASIFRIVFFHCNKFPELYSILHRADLDMQRQLILPIVQESAVPKVLTTPLKKFRSVSEPRRNCHAYWTNNVKPPMAMPKCLDFINRTDNNYLMHVLDSDPIVQLSYPDIRIHEAYKMIQSCCPIKLDAGICSNFTIEDGDTLSTPLKEELEGYLKIINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGKFSLSESG---KPQTIESNASTKVWPNFHNGVAAGLMIAPMNESVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPP-------MDVELTSVTAGFSVGLIMFQQGH--IFDREHN-PEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYMNSMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKAFLIKPTGI---QEKYLDTVNDSYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINIKSNIELMPNVNRN---HYDWALSTLLLSACMISAGSGNLTLLRISRYLQSIHHPKDCG--NYGVFMTYXXXXXXXXXXXXXXXXXNSHRSAAILVIAFFPRFPPTYNGRRYHLQSLRHLYVIATRPRVMCAVDLDT 5008
            EP+ P++C+D L++    N+                           S+  KVF   + D   +K+LC L E        L+ VKF   ND       +  N+  K     DA  +E++   +VLE    L +Y+G+  V K+ +         ++ ++ +P  P D VG    +S +  SM+ +                                     DP     T+   +   +R+ +PE+    +V+ CL  +K +LP +  + +L +WY+++ A     S  +EW  FV  LL  MG+  +R         +     ++   K    D         S  D +  ++    + + +   N  L        N +D  E++S      +  LL  H P + F LHLVYE  KLN        +L  L   +A  +    YLD+Y +D+P L+    Q+ ++ Q  +        +  +PP+  + + + +  +   P  Y  P I + S +++  + ++       TL D    + E  +Y  ++    +  P +       + NR     +  +  +  R   +++ + F + DL+ +  G+A   R   +HC + P         D D    + L I ++    +     L + +SV           ++ V       +  D +N   N+ +M ++ S+        D+R+ +  +++QS  P++++  +     + D + +     EE E  L  + CQRT +LP+GRGM  L        T+ LPVP L LTG+     +        I+   +   W +FHNGVAAGL IAP ++ +D  WI+   P       EL+ E AG L  LGLNGHL KL+   I   +   +EM ++ LL+G+SA  +G+ +  +++ +S H   L+P    ++D +P   QV+A++  GL+   +A R  A + L E+GR          PP        D E  S+ AG ++G++    G   I   + N PE+L +   Y+ G +R                    R     +  K   P        ++Q K     EG+  N D+T  GA +A+ +IY+ + +  IA+ L  P+T YLL+ ++   L  R +AR LI+W  + P+  WV+S +PQ +   +  +    +   ++  L+T++ +++ ++ G+C  +G R+AG++N +A   +  + +  +N  S     PN +     + +  LS +LLS  M+ AGSGNL +L++ R+L    H K  G  NYG  + + +++GLLFLGGG+ +LS S+ S A L+ A +P FP      RYHLQ+LRHLYV+A  PR++  VD+DT
Sbjct:  401 EPIVPELCIDHLWTETLPNIR-----------------------EKNSQASKVF--ITTDLCGQKFLCFLVEAQLQ----LRCVKFQESNDKTQLIFGSVTNIHAK-----DAAPVEKIHTMLVLEGNGNLVLYTGVVRVGKVFIPGLPAPSLTMSNMMPRPSTPLDGVGTPKPLSKLLGSMDEVVLLSPVPELRDSSKLNDSLYNEDCTFQQLGTYIHSVRDPVHNRVTLELSNGSMVRITIPEVATSELVQTCLQAIKFILPKEVAIQVLVKWYNVHSA-PGGPSCHSEWSLFVICLLNMMGYNTDRLAWTRSFDFEGSLSPVIAPKKARPSDTG-------SDEDWEYLLNSEYHRNVESHLLNKSLCLTALEVSNAKD--EDFSQNLSLDSSTLLFAHIPAIFFVLHLVYEELKLNTLMGEGICSLIDLLVQLARDLKLDSYLDHYYRDSPTLVKTTGQVCTIDQGQMGFMHHPPFFTSEPPSIYQWVSSCLKGEGMPPYPY-LPGICERSRLVVLSIALY-------TLGDESCVSDETCQYLSKV----TSTPQKPQAE--QEENRFTFRHSASVSVLAERLVVWMASVGFTLRDLETLPFGIALPIRDAIYHCREQP---------DSDWSEAVCLLIGRQDLSKQACEGNLPRGKSV----------LSSEVSSGTEAEEEDDGMNDL-NHEVMSLIWSE--------DLRVQDVRRLLQSAQPVRVN--VVQYPELSDHEFI-----EEKENRLLQL-CQRTMALPVGRGMFTL-FSYHPVPTEPLPVPKLNLTGRAPPRNTTVDLNSGNIDVPPNMASWASFHNGVAAGLKIAPASQ-IDSAWIVYNKPK----HAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKGHEMTSIGLLLGVSAAKLGTMDMSITRLLSIHVPALLPPTSTELD-VPHNVQVAAVVGIGLVYQGTAHRHTAEVLLAEIGR----------PPGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLNVPEQLYQ---YMVGGHR--------------------RFQTGMHREKHKSP--------SYQIK-----EGDTINVDVTCPGATLALAMIYLKTNNRSIADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNSKWVDSNVPQIIRENSISLSEIELPCSEDLNLETLSQAHVYIIAGACLSLGFRFAGSENLSAFSCLHKFAKDFMNYLS----APNASVTGPYNLETCLSVVLLSLAMVMAGSGNLKVLQLCRFL----HMKTGGEMNYGFHLAHHMALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPAHSTDNRYHLQALRHLYVLAAEPRLLVPVDVDT 1626          
BLAST of anaphase-promoting complex subunit 1 vs. Ensembl Mouse
Match: Anapc1 (anaphase promoting complex subunit 1 [Source:MGI Symbol;Acc:MGI:103097])

HSP 1 Score: 159.073 bits (401), Expect = 1.970e-38
Identity = 208/893 (23.29%), Postives = 365/893 (40.87%), Query Frame = 2
Query: 1103 EPLYPKVCLDFLFSCKAGNVEPTLDGSYADYHSTPNAYNSQKDTANQSKNGKVFGFFSEDFYRRKYLCCLKETNAGNHSILKIVKFNYEND-------TFCNLEEKSWPVLDAVYLERLQFTIVLELGSTLSIYSGMTFVCKISL---------LNALVYQPDDPFDDVGMEMSISDI-NSMNRL------------------------------------SDPTDYGFTIHTQSELALRLYLPEMVRLHXXXXXXXXXXXXXPIDTGMTMLCRWYSLNRAVDNNESASAEWRRFVEFLLENMGFARNRQNKAGQQQTQQETHSIVQDVKELCLDNNNGHGIASSSADTDVSMDEICSKKLRT---NSGLYSIERRCLNERDGLEEYSALCYNVTDRLLSQHAPTVLFCLHLVYECEKLNYSFCRHFKNLAALNCSIACSIGARQYLDYYLQDNPDLMADIAQLPSLAQYILIPSDITATWNPQPPNWSEILFNLMGTQSPIPNNYRYPIIEDLSEMLIQLVKIWLVMFRPDTLLDNP--TSELNRYFYRINFNMSGIPCRFPVHFCHDLNRANRNETLKIDDIYRRTATYLSEIKFHVNDLDFMNDGLASIFRIVFFHCNKFPELYSILHRADLDMQRQLILPIVQESAVPKVLTTPLKKFRSVSEPRRNCHAYWTNNVKPPMAMPKCLDFINRTDNNYLMHVLDSDPIVQLSYPDIRIHEAYKMIQSCCPIKLDAGICSNFTIEDGDTLSTPLKEELEGYLKIINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGKFSLSESGKPQTIESNAST-------KVWPNFHNGVAAGLMIAPMNESVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLS 3586
            EP+ P++C+D L++    N+                           S+  KVF   + D   +K+LC L E        L+ VKF   ND       +  N+  K     DA  +E++   +VLE    L +Y+G+  V K+ +         ++ ++ +P  P D VG    +S +  SM+ +                                     DP     T+   +   +R+ +PE+    +V+ CL  +K +LP +  + +L +WY+++ A     S  +EW  FV  LL  MG+  +R         +     ++   K    D         S  D +  ++    + + +   N  L        N +D  E++S      +  LL  H P + F LHLVYE  KLN        +L  L   +A  +    YLD+Y +D+P L+    Q+ ++ Q  +        +  +PP+  + + + +  +   P  Y  P I + S +++  + ++       TL D    + E  +Y  ++    +  P +       + NR     +  +  +  R   +++ + F + DL+ +  G+A   R   +HC + P         D D    + L I ++    +     L + +SV           ++ V       +  D +N   N+ +M ++ S+        D+R+ +  +++QS  P++++  +     + D + +     EE E  L  + CQRT +LP+GRGM  L        T+ LPVP L LTG+       +  T++ N+           W +FHNGVAAGL IAP ++ +D  WI+   P       EL+ E AG L  LGLNGHL KL+
Sbjct:  401 EPIVPELCIDHLWTETLPNIR-----------------------EKNSQASKVF--ITTDLCGQKFLCFLVEAQLQ----LRCVKFQESNDKTQLIFGSVTNIHAK-----DAAPVEKIHTMLVLEGNGNLVLYTGVVRVGKVFIPGLPAPSLTMSNMMPRPSTPLDGVGTPKPLSKLLGSMDEVVLLSPVPELRDSSKLNDSLYNEDCTFQQLGTYIHSVRDPVHNRVTLELSNGSMVRITIPEVATSELVQTCLQAIKFILPKEVAIQVLVKWYNVHSA-PGGPSCHSEWSLFVICLLNMMGYNTDRLAWTRSFDFEGSLSPVIAPKKARPSDTG-------SDEDWEYLLNSEYHRNVESHLLNKSLCLTALEVSNAKD--EDFSQNLSLDSSTLLFAHIPAIFFVLHLVYEELKLNTLMGEGICSLIDLLVQLARDLKLDSYLDHYYRDSPTLVKTTGQVCTIDQGQMGFMHHPPFFTSEPPSIYQWVSSCLKGEGMPPYPY-LPGICERSRLVVLSIALY-------TLGDESCVSDETCQYLSKV----TSTPQKPQAE--QEENRFTFRHSASVSVLAERLVVWMASVGFTLRDLETLPFGIALPIRDAIYHCREQP---------DSDWSEAVCLLIGRQDLSKQACEGNLPRGKSV----------LSSEVSSGTEAEEEDDGMNDL-NHEVMSLIWSE--------DLRVQDVRRLLQSAQPVRVN--VVQYPELSDHEFI-----EEKENRLLQL-CQRTMALPVGRGMFTL-FSYHPVPTEPLPVPKLNLTGR----APPRNTTVDLNSGNIDVPPNMASWASFHNGVAAGLKIAPASQ-IDSAWIVYNKP----KHAELANEYAGFLMALGLNGHLTKLA 1189          
BLAST of anaphase-promoting complex subunit 1 vs. UniProt/SwissProt
Match: sp|P53995|APC1_MOUSE (Anaphase-promoting complex subunit 1 OS=Mus musculus OX=10090 GN=Anapc1 PE=1 SV=2)

HSP 1 Score: 355.525 bits (911), Expect = 9.011e-98
Identity = 358/1381 (25.92%), Postives = 618/1381 (44.75%), Query Frame = 2
Query: 1103 EPLYPKVCLDFLFSCKAGNVEPTLDGSYADYHSTPNAYNSQKDTANQSKNGKVFGFFSEDFYRRKYLCCLKETNAGNHSILKIVKFNYEND-------TFCNLEEKSWPVLDAVYLERLQFTIVLELGSTLSIYSGMTFVCKISL---------LNALVYQPDDPFDDVGMEMSISDI-NSMNRL------------------------------------SDPTDYGFTIHTQSELALRLYLPEMVRLHXXXXXXXXXXXXXPIDTGMTMLCRWYSLNRAVDNNESASAEWRRFVEFLLENMGFARNRQNKAGQQQTQQETHSIVQDVKELCLDNNNGHGIASSSADTDVSMDEICSKKLRT---NSGLYSIERRCLNERDGLEEYSALCYNVTDRLLSQHAPTVLFCLHLVYECEKLNYSFCRHFKNLAALNCSIACSIGARQYLDYYLQDNPDLMADIAQLPSLAQYILIPSDITATWNPQPPNWSEILFNLMGTQSPIPNNYRYPIIEDLSEMLIQLVKIWLVMFRPDTLLDNP--TSELNRYFYRINFNMSGIPCRFPVHFCHDLNRANRNETLKIDDIYRRTATYLSEIKFHVNDLDFMNDGLASIFRIVFFHCNKFPELYSILHRADLDMQRQLILPIVQESAVPKVLTTPLKKFRSVSEPRRNCHAYWTNNVKPPMAMPKCLDFINRTDNNYLMHVLDSDPIVQLSYPDIRIHEAYKMIQSCCPIKLDAGICSNFTIEDGDTLSTPLKEELEGYLKIINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGKFSLSESG---KPQTIESNASTKVWPNFHNGVAAGLMIAPMNESVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPP-------MDVELTSVTAGFSVGLIMFQQGH--IFDREHN-PEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYMNSMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKAFLIKPTGI---QEKYLDTVNDSYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINIKSNIELMPNVNRN---HYDWALSTLLLSACMISAGSGNLTLLRISRYLQSIHHPKDCG--NYGVFMTYXXXXXXXXXXXXXXXXXNSHRSAAILVIAFFPRFPPTYNGRRYHLQSLRHLYVIATRPRVMCAVDLDT 5008
            EP+ P++C+D L++    N+                           S+  KVF   + D   +K+LC L E        L+ VKF   ND       +  N+  K     DA  +E++   +VLE    L +Y+G+  V K+ +         ++ ++ +P  P D VG    +S +  SM+ +                                     DP     T+   +   +R+ +PE+    +V+ CL  +K +LP +  + +L +WY+++ A     S  +EW  FV  LL  MG+  +R         +     ++   K    D         S  D +  ++    + + +   N  L        N +D  E++S      +  LL  H P + F LHLVYE  KLN        +L  L   +A  +    YLD+Y +D+P L+    Q+ ++ Q  +        +  +PP+  + + + +  +   P  Y  P I + S +++  + ++       TL D    + E  +Y  ++    +  P +       + NR     +  +  +  R   +++ + F + DL+ +  G+A   R   +HC + P         D D    + L I ++    +     L + +SV           ++ V       +  D +N   N+ +M ++ S+        D+R+ +  +++QS  P++++  +     + D + +     EE E  L  + CQRT +LP+GRGM  L        T+ LPVP L LTG+     +        I+   +   W +FHNGVAAGL IAP ++ +D  WI+   P       EL+ E AG L  LGLNGHL KL+   I   +   +EM ++ LL+G+SA  +G+ +  +++ +S H   L+P    ++D +P   QV+A++  GL+   +A R  A + L E+GR          PP        D E  S+ AG ++G++    G   I   + N PE+L +   Y+ G +R                    R     +  K   P        ++Q K     EG+  N D+T  GA +A+ +IY+ + +  IA+ L  P+T YLL+ ++   L  R +AR LI+W  + P+  WV+S +PQ +   +  +    +   ++  L+T++ +++ ++ G+C  +G R+AG++N +A   +  + +  +N  S     PN +     + +  LS +LLS  M+ AGSGNL +L++ R+L    H K  G  NYG  + + +++GLLFLGGG+ +LS S+ S A L+ A +P FP      RYHLQ+LRHLYV+A  PR++  VD+DT
Sbjct:  401 EPIVPELCIDHLWTETLPNIR-----------------------EKNSQASKVF--ITTDLCGQKFLCFLVEAQLQ----LRCVKFQESNDKTQLIFGSVTNIHAK-----DAAPVEKIHTMLVLEGNGNLVLYTGVVRVGKVFIPGLPAPSLTMSNMMPRPSTPLDGVGTPKPLSKLLGSMDEVVLLSPVPELRDSSKLNDSLYNEDCTFQQLGTYIHSVRDPVHNRVTLELSNGSMVRITIPEVATSELVQTCLQAIKFILPKEVAIQVLVKWYNVHSA-PGGPSCHSEWSLFVICLLNMMGYNTDRLAWTRSFDFEGSLSPVIAPKKARPSDTG-------SDEDWEYLLNSEYHRNVESHLLNKSLCLTALEVSNAKD--EDFSQNLSLDSSTLLFAHIPAIFFVLHLVYEELKLNTLMGEGICSLIDLLVQLARDLKLDSYLDHYYRDSPTLVKTTGQVCTIDQGQMGFMHHPPFFTSEPPSIYQWVSSCLKGEGMPPYPY-LPGICERSRLVVLSIALY-------TLGDESCVSDETCQYLSKV----TSTPQKPQAE--QEENRFTFRHSASVSVLAERLVVWMASVGFTLRDLETLPFGIALPIRDAIYHCREQP---------DSDWSEAVCLLIGRQDLSKQACEGNLPRGKSV----------LSSEVSSGTEAEEEDDGMNDL-NHEVMSLIWSE--------DLRVQDVRRLLQSAQPVRVN--VVQYPELSDHEFI-----EEKENRLLQL-CQRTMALPVGRGMFTL-FSYHPVPTEPLPVPKLNLTGRAPPRNTTVDLNSGNIDVPPNMASWASFHNGVAAGLKIAPASQ-IDSAWIVYNKPK----HAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKGHEMTSIGLLLGVSAAKLGTMDMSITRLLSIHVPALLPPTSTELD-VPHNVQVAAVVGIGLVYQGTAHRHTAEVLLAEIGR----------PPGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLNVPEQLYQ---YMVGGHR--------------------RFQTGMHREKHKSP--------SYQIK-----EGDTINVDVTCPGATLALAMIYLKTNNRSIADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNSKWVDSNVPQIIRENSISLSEIELPCSEDLNLETLSQAHVYIIAGACLSLGFRFAGSENLSAFSCLHKFAKDFMNYLS----APNASVTGPYNLETCLSVVLLSLAMVMAGSGNLKVLQLCRFL----HMKTGGEMNYGFHLAHHMALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPAHSTDNRYHLQALRHLYVLAAEPRLLVPVDVDT 1626          
BLAST of anaphase-promoting complex subunit 1 vs. UniProt/SwissProt
Match: sp|Q9H1A4|APC1_HUMAN (Anaphase-promoting complex subunit 1 OS=Homo sapiens OX=9606 GN=ANAPC1 PE=1 SV=1)

HSP 1 Score: 338.576 bits (867), Expect = 1.601e-92
Identity = 322/1196 (26.92%), Postives = 559/1196 (46.74%), Query Frame = 2
Query: 1511 SLLNALVYQPDDPFDDVGMEMSISDINSMNRLSDPTDYGFTIHTQSELALRLYLPEMVRLHXXXXXXXXXXXXXPIDTGMTMLCRWYSLNRAVDNNESASAEWRRFVEFLLENMGFARNRQNKAGQQQTQQETHSIVQDVKELCLDNNNGHGIASSSADTDVSMDEICSKKLRTNSGLYSIERR-CLNERDGL----EEYSALCYNVTDRLLSQHAPTVLFCLHLVYECEKLNYSFCRHFKNLAALNCSIACSIGARQYLDYYLQDNPDLMADIAQL----PSLAQYILIPSDITATWNPQPPNWSEILFNLMGTQSPIPNNYRYPIIEDLSEMLIQLVKIWLVMFRPDTLLDNPTSELNRYFYRINFNMSGIPCRFPVHFCHDLNRANRNETLKIDDIYRRTATYLSEIKFHVNDLDFMNDGLASIFRIVFFHCNKFPELYSILHRADLDMQRQLILPIVQESAVPKVLTTPLKKFRSVSEPRRNCHAYWTNNVKPPMAMPKCLDFINRTDNNYLMHVLDSDPIVQLSYPDIRIHEAYKMIQSCCPIKLDAGICSNFTIEDGDTLSTPLKEELEGYLKIINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGKFSLSESG---KPQTIESNASTKVWPNFHNGVAAGLMIAPMNESVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPP-------MDVELTSVTAGFSVGLIMFQQGH--IFDREHN-PEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYMNSMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKAFLIKPTGI---QEKYLDTVNDSYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINIKSNIELMPNVN---RNHYDWALSTLLLSACMISAGSGNLTLLRISRYLQSIHHPKDCG--NYGVFMTYXXXXXXXXXXXXXXXXXNSHRSAAILVIAFFPRFPPTYNGRRYHLQSLRHLYVIATRPRVMCAVDLDT 5008
            S L+  +Y  D  F  +G          ++ + DP     T+   +   +R+ +PE+    +V+ CL  +K +LP +  + ML +WY+++ A     S  +EW  FV  L+  MG+  +R         +     ++   K              S   +D   + + +     N   + + R  CL+  +      E++S      +  LL  H P + F LHLVYE  KLN        +L  L   +A  +    Y+D+Y +D P L+    Q+    P    ++  PS  T+    +PP+  + + + +  +   P  Y  P I + S +++  + I L +   ++L+ + +S+   Y  RI       P +  V    + NR +   +  +  +  R   +++ + F + DL+ +  G+A   R   +HC + P           D    + L I ++    +     L K +SV           +++V       +  D +N   N+ +M ++ S+        D+R+ +  +++QS  P++++  +     + D + +     EE E  L  + CQRT +LP+GRGM  L        T+ LP+P L LTG+     +        I+   +   W +FHNGVAAGL IAP ++ +D  WI+   P       EL+ E AG L  LGLNGHL KL+   I   +   +EM ++ LL+G+SA  +G+ +  +++ +S H   L+P    ++D +P   QV+A++  GL+   +A R  A + L E+GR          PP        D E  S+ AG ++G++    G   I   + N PE+L +   Y+ G +R                    R     +  K   P        ++Q K     EG+  N D+T  GA +A+ +IY+ + +  IA+ L  P+T YLL+ ++   L  R +AR LI+W  + P+  WV+S +PQ +   +  +    +   ++  L+T++ +++ ++ G+C  +G R+AG++N +A   +  + +  +   S     PN +    ++ +  LS +LLS  M+ AGSGNL +L++ R+L    H K  G  NYG  + + +++GLLFLGGG+ +LS S+ S A L+ A +P FP      RYHLQ+LRHLYV+A  PR++  VD+DT
Sbjct:  564 SKLHDSLYNEDCTFQQLG--------TYIHSIRDPVHNRVTLELSNGSMVRITIPEIATSELVQTCLQAIKFILPKEIAVQMLVKWYNVHSA-PGGPSYHSEWNLFVTCLMNMMGYNTDRLAWTRNFDFEGSLSPVIAPKKA-----------RPSETGSDDDWEYLLNSDYHQNVESHLLNRSLCLSPSEASQMKDEDFSQNLSLDSSTLLFTHIPAIFFVLHLVYEELKLNTLMGEGICSLVELLVQLARDLKLGPYVDHYYRDYPTLVRTTGQVCTIDPGQTGFMHHPSFFTS----EPPSIYQWVSSCLKGEGMPPYPY-LPGICERSRLVV--LSIALYILGDESLVSDESSQ---YLTRITI----APQKLQVE--QEENRFSFRHSTSVSSLAERLVVWMTNVGFTLRDLETLPFGIALPIRDAIYHCREQPAS---------DWPEAVCLLIGRQDLSKQACEGNLPKGKSV----------LSSDVPSGTETEEEDDGMNDM-NHEVMSLIWSE--------DLRVQDVRRLLQSAHPVRVN--VVQYPELSDHEFI-----EEKENRLLQL-CQRTMALPVGRGMFTL-FSYHPVPTEPLPIPKLNLTGRAPPRNTTVDLNSGNIDVPPNMTSWASFHNGVAAGLKIAPASQ-IDSAWIVYNKP----KHAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKGHEMTSIGLLLGVSAAKLGTMDMSITRLLSIHIPALLPPTSTELD-VPHNVQVAAVVGIGLVYQGTAHRHTAEVLLAEIGR----------PPGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLNVPEQLYQ---YMVGGHR--------------------RFQTGMHREKHKSP--------SYQIK-----EGDTINVDVTCPGATLALAMIYLKTNNRSIADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNSKWVDSNVPQIIRENSISLSEIELPCSEDLNLETLSQAHVYIIAGACLSLGFRFAGSENLSAFNCLHKFAKDFMTYLS----APNASVTGPHNLETCLSVVLLSLAMVMAGSGNLKVLQLCRFL----HMKTGGEMNYGFHLAHHMALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPAHSTDNRYHLQALRHLYVLAAEPRLLVPVDVDT 1626          
BLAST of anaphase-promoting complex subunit 1 vs. UniProt/SwissProt
Match: sp|Q9FFF9|APC1_ARATH (Anaphase-promoting complex subunit 1 OS=Arabidopsis thaliana OX=3702 GN=APC1 PE=2 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 1.215e-58
Identity = 197/630 (31.27%), Postives = 311/630 (49.37%), Query Frame = 2
Query: 3317 VPLLCLTGKFSLSESGKPQ---TIESNASTKVWPNFHNGVAAGLMIAPMNESVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPPMDVELTSVTAGFSVGLIMFQQGHIFDREHNPEELV-RLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYMNSMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKAFLIKP--TGIQEKYLDTVNDSYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINIKSNIELMPN----------VNRNHYDWALSTLLLSACMISAGSGNLTLLRISRYLQSIHHPKDCGNYGVFMTYXXXXXXXXXXXXXXXXXNSHRSAAILVIAFFPRFPPTYNGRRYHLQSLRHLYVIATRPRVMCAVDLDTMIAVPVESRVVFKDHSIRHHSR-CFVFPAENPNTIEQVELFDKNNEYYPQ 5155
            VP L L G+    ++        I +    K WP FHN VAAGL +AP+   V   WI    P       E +A  AG+L+GLGL G+L+ L+   I Q     +E  T+ L++GL+A   G+    ++K + FH          + + IPTL Q +A++S G+L   SA ++  ++ L E+GR        G   ++ E  +V+AGFS+GL+   +G   D   + + LV RLL YL                       + R+IL           S  D  +A Q     + +G   N DIT  GA IA+ L+Y+ + S +I + L  P+T Y LE +R   +  R IAR LIMW ++ P+ DW++S +P+ V +    ++     + E  ++ +  +Y+ ++ G+C  +GLR+AGT + NAR  + +Y   L+N    +   P           V+R   +  L  +++S  ++ AGSG+L + R+ R+L+S +      NYG  M  SL+ G LFLGGG  T S ++ S A+L+I  +PR P   N  R HLQ+ RHLYV+AT  R +  +D+D+ + V     V  K+  +   ++ C + P   P       +      Y+PQ
Sbjct:  897 VPKLVLAGRLPSQQNAIVNLDPNIRNIQELKTWPEFHNAVAAGLRLAPLQGKVSRTWIRYNKPG------EPNAVHAGLLFGLGLQGYLHVLNLSDIYQYFTQDHESTTVGLMLGLAASYRGTMQPDIAKALFFHVPARYQASYTEFE-IPTLLQSAALVSVGMLFEGSAHQQTMQLLLGEIGRRSA-----GDNVLEREGYAVSAGFSLGLVALGRGG--DALGSMDSLVNRLLLYLGAK--------------------EERSILVP---------SLEDHRSAAQ-----ITDGSTSNVDITAPGAIIALTLMYLKTESEVIFSKLSIPQTHYDLECVRPDFIMLRVIARNLIMWSRICPTCDWIQSQVPEVVKNGISQLRDDMDNMYEVDVEALVQAYVNIVAGACISLGLRFAGTRDGNARDLLNSYALYLLNEIKPLSATPGNAFPRGISKFVDRGTLEMCLYLIIISLSVVMAGSGDLQVFRLLRFLRSRNSADGHANYGTQMAVSLATGFLFLGGGMRTFSTNNGSLAMLLITLYPRLPSGPNDNRCHLQAFRHLYVLATEARWLQTIDVDSGLPVYAPLEVTVKETKLYSETKFCEITPCILPERAILKRICVCGPRYWPQ 1478          
BLAST of anaphase-promoting complex subunit 1 vs. UniProt/SwissProt
Match: sp|P24686|BIME_EMENI (Negative regulator of mitosis OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bimE PE=2 SV=2)

HSP 1 Score: 208.764 bits (530), Expect = 1.429e-52
Identity = 187/689 (27.14%), Postives = 316/689 (45.86%), Query Frame = 2
Query: 3236 RTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGKFSLSESGKPQTIESNASTK-------VWPNFHNGVAAGLMIAPMNESVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPPMDV---ELTSVTAGFSVGLIMFQQGHIFDREHNPEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYMNSMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKAFLIKPTGIQEKYLDTVNDSYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINIKSNIELMPNVN------RNHYDWALSTLLLSACMISAGSGNLTLLRISRYLQSIHHPKDCGN-YGVFMTYXXXXXXXXXXXXXXXXXNSHRSAAILVIAFFPRFPPTYNGRRYHLQSLRHLYVIATRPRVMCAVDLDTMIAVPVESRVVFKDHSIRHHSRCFVFPAENPNTIEQVELFDKNNEYYPQIYKSNTEPWNILYQSYQSGGYILVKKQKPEIN 5251
            RT S+P GR ML     +   LT+KLP+P       FSL    KP  +  +A           W  FHNGV+ GL I+  ++ +D  WIL   P       EL+   AG L  LGLNGHL  L+     + +   + M ++ LL+GLSA  +G+ ++++++ +S H  R++P    +++  P L Q + I+  GLL   S  R+M+ + L E+  + +    EG+   D    E   + AGF++G I   +G       +   + RLL+   G+                          KN D+                           +  D   +GA IA+ +I+M +    +A  ++ P+T    + +R  +   R +AR +IMW ++Q   +W   ++P+    +  L   TG+  + L + +  +  ++ G CF +GLR+AG+ +   R  +++Y+++ I I      +P  N      RN        + LS   + AG+G+L L    R L+S+H   D    YG  M   ++IG+LFLGGG  TL  S+ + A L+ + +P FP T      HLQ+ RHL+V+A  PR +   DLD+   + +   V   D      +   + P  + N I +VE+   + +Y+P +   ++ P   + + +Q G   +  ++K   N
Sbjct: 1261 RTLSIPTGRAMLAFS-GRLPLLTEKLPIP------SFSLQCVMKPSNVTISADRASFHEEKICWAFFHNGVSTGLAISKNSKGIDTSWILFNKPQ------ELTNRHAGFLLALGLNGHLRSLAKWVAFKYLTPKHTMTSIGLLLGLSASYLGTMDTLVTRLLSVHVTRMLPMGAAELNLSP-LTQTAGIMGIGLLYCNSQHRRMSEVMLSEIENADQE---EGSATNDYLRNEGYRLAAGFALGFINLGKGKDLKGMRDMHIVERLLAVAVGT--------------------------KNVDLA--------------------------HVLDRATAGATIALAIIFMKTNDETLAQKVDIPDTTVRFDYVRPDLFLLRTLARHIIMWDRIQACDEWFIGSLPEVYRRRYRL---TGV--RRLKSNDMPFFNIIAGLCFALGLRFAGSPDPTVRDILLSYLDQFIRISR----LPAPNYDARLARNSVRHCQDVVALSLAAVMAGTGDLALF---RRLRSLHGRVDPDTPYGSHMAAHMAIGMLFLGGGSYTLGTSNLAVASLICSLYPIFPTTVLDNECHLQAFRHLWVLAAEPRCIVPRDLDSRRPISMPITVTDSDGVSGTLTAPCLLP--DLNRIAKVEVL--SPDYWPLVLDFDSNP--GVREKFQQGDQSIYLRRKATYN 1862          
BLAST of anaphase-promoting complex subunit 1 vs. UniProt/SwissProt
Match: sp|Q9URV2|APC1_SCHPO (Anaphase-promoting complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cut4 PE=1 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 6.407e-49
Identity = 190/687 (27.66%), Postives = 322/687 (46.87%), Query Frame = 2
Query: 3077 DIRIHEAYKMIQSCCPIKLDAGICSNFTIEDGDTLSTPLKEELEGYLKIINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGK-FSLSESGKPQT--IESNAS-----TKVWPNFHNGVAAGLMIAPMNESVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSRE-HLSVEGTPPMDVELTSVTAGFSVGLIMFQQGHIFDREHNPEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYMNSMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKAFLIKPTGIQEKYLDTVNDSYL-QMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINIKSNIELMPNVNRNHYDWALSTL------LLSACMISAGSGNLTLLRISRYLQSIHHPKDCGNYGVFMTYXXXXXXXXXXXXXXXXXNSHRSAAILVIAFFPRFPPTYNGRRYHLQSLRHLYVIATRPRVMCAVDLDTMIAVPVESRVVFKDHSIRHHSRCFVFP 5089
            D R+ E  K++     I +   +  +F   D D  S P+++++   +    C RT S+PIG GML            K P+P   +T + F+ +    P T  I+ N          WP F+ GVA GL I+  ++ ++  WI+   P        L+A  AG L+GLGLNGHL  L+       + S ++  ++ LL+GL++  +GS ++ ++K +S H   L+P   ++++  P L Q + I+  GLL   S  R+M+ + +EE+  S E  L  EG          + AGFS+GLI   +G                S L G                  +DL++ + L+         IS   ++ + +  +P               GA +A+ +IYM +    +A  ++ P++ YLL+  R  ++  R   + LIMW +V+   +WV+  IP  + S+        +QEK + + +D  L  +L G CF +GLR+AGT N  A+  ++ +++  I +      +P    +    A++ +       LS+  + AG  +L +LR  R L     P    NYG  M   +++G+L LGGG+ +LS S+ + A L+I+F+P+FP T    R HLQ+ R+L+ +A   R +   + DT     V   VV K  +++      + P
Sbjct:  702 DRRLAEVNKLLNYSSQITI---MTEHF---DVDLSSVPMQQKVAQCI----CVRTLSVPIGAGMLTY--------GSKNPLPTEKVTPRLFNFTLHLHPGTLIIQPNKEFVTQELTEWPEFNVGVALGLSISKFSKEINTSWIMFNRPET------LTAYHAGFLFGLGLNGHLKALATWHSFIYLTSKHDTTSIGLLLGLASSYLGSMDAKVTKLLSVHISALLPVGSNELNISP-LTQTAGILGIGLLFHDSCHRRMSEVTMEEILASNESELKNEGY--------KLAAGFSLGLINLGRG----------------SNLPGM-----------------SDLKLVSRLQVG-------ISSQATFQSLEAGSP---------------GAIMALTMIYMKTNDLEVAKKIDIPKSRYLLDFYRPDLILLRVAGKNLIMWDEVKADYEWVKYQIPDIMLSQF------DLQEKKVLSSDDLLLYNVLAGICFSLGLRFAGTGNPKAKEILINFLDSFIRLCH----LPAKTHDERVTAVTVIRCTQIVALSSSCVMAGYCDLDVLRRLRVLHGRMEPV---NYGAQMATHMALGILSLGGGRYSLSRSNLAIAALLISFYPQFPRTTQDNRAHLQAARNLWALAVEERCIIPRNQDTKQPCIVPLNVVQKSGAVQKLEAPILLP 1287          
BLAST of anaphase-promoting complex subunit 1 vs. TrEMBL
Match: A0A3Q0JJH9 (anaphase-promoting complex subunit 1 OS=Diaphorina citri OX=121845 GN=LOC103519557 PE=4 SV=1)

HSP 1 Score: 382.874 bits (982), Expect = 4.718e-104
Identity = 420/1631 (25.75%), Postives = 723/1631 (44.33%), Query Frame = 2
Query:  389 ELNDFDPKGVILFTDRIAKYYGFDADIHSCTLPCKVSSAWKFRECLFVER---EEMNNFHDYSPNSLFVMLHTLAEFTPVVFKDEFGNCGFINDTRFRIVSVCESSFLLLAYDKTDDSFSLWRIRDATQNDFSDL----YDMHWDGSIAVKKQKLKSNFISGRSRMESSINHTNFNDNSHISSEYFEISTDVIN----NSVRTVEDLDIRSPIARSLKNTKDCQIPDKMTLLNETNNCLKIHPSYRQMIEPLYPKVCLDFLFSCKAGNVEPTLDGSYADYHSTPNAYNSQKDTANQSKNGKVFG-----FFSEDFYRRKYLC-CLKETNAGNHSILKIVKFNYENDTFCNLEEKSWPVLDAVYLERLQFTIVLELGSTLSIYSGMTFVCKI-------------------------SLLNALV------------YQPDDP-------FDDVGMEMSISDINSMNRLSDPTDYGFTIHTQSELALRLYLPEMVRLHXXXXXXXXXXXXXPIDTGMTMLCRWYSLNRAVDNNE-SASAEWRRFVEFLLENMGFARNRQNKAGQQQTQQETHSIVQDVKELCLDNNNGHGIASSSADTDVSMDEICSKKLRTNSGLYSIERRCLNERDGLEEYSALCYNVTDRLLSQHAPTVLFCLHLVYECEKLNYSFCRHFKNLAALNCSIACSIGARQYLDYYLQDNPDLMADIAQLPSLAQYILIPSDITATWNPQPPNWSEILFNLMGTQSPIPNNYRYPIIEDLSEMLIQLVKIWLVMFRPDTLLDNPTSELNRYFYRINFNMSGIPCRFP-VHFCHDLNRANRNETLKIDDIYRRTATYLSEIKFHVNDLDFMNDGLASIFRIVFFHCNKFPEL------YSILHRADLDMQRQLILPIVQESAVPKVLTTPLKKFRSVSEPRRNCHAYW---TNNVKPPMAMPKCLDFINRTDNNYL--------MHVLDSDPIVQLSY-PDIRIHEAYKMIQSCCPIKLDAGICSNFTIEDGDTLSTPLKEELEGYLKIINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGKFSLSESGKPQT-IESNASTKVWPNFHNGVAAGLMIAPMNESVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPPMDVELTSVTAGFSVGLIMFQQGHIFDREHNPEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYMNSMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKAFLIKPTG--IQEKYLD--TVNDSYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINI--KSNIELMPNVNRNHYDWALSTLLLSACMISAGSGNLTLLRISRYLQSIHHPK----DCGNYGVFMTYXXXXXXXXXXXXXXXXXNSHRSAAILVIAFFPRFPPTYNGRRYHLQSLRHLYVIATRPRVMCAVDLD 5005
            +++ F PKG I +T                 L  K+SS W  ++ L +ER    + +N       +LF +LH L E  P++ K + G   F+N+T  +IV+  +   + L YD+   + S+WR+R  T  + + +    Y M      +       SN  + RS M S+ +    N+ S I S+   + +   +    +    + +    S +   L N     I +  T L+ ++  L +   +   +EP+ P +CL++ ++                            DT+N  K+G+V       FFS DF  +K+LC  + E +    S  K+ + N  N              DAV+L +L  T VL   + + +YSG+T+V K+                         SLL++ V            Y P  P       F   G   S + + ++  L DP     T+   +    RL LP +    +V KCL+ LK +L  D  + +L  WY+   A   ++ S   EW  FV+ LL+++G+        G+  T    H  +     +         ++ S    D +   +   K+  N  L     R  +++D   E S    N T  +L     ++LF  HL+YE  KL+         L  L   +      ++Y  +Y  D P L     +   +   I +P+ +     P PPN  + L+ ++  Q+P   N  YP I  ++     L++++ ++ +  + L  P      +   +  +M      +P   F  D N  +  E         R   Y+ ++     +L  +  G+A       +   + P +      Y +  R DL  Q   ++P   ES         +K F ++    ++C ++    + N+         +  I+R D+N          M  +D + +++L +  D R+ +  + +QS  P+ ++  I     + D + +     EE E +L  I C RT +LP+GRGM  L+ +    +T+ LP+P LCLTGK     +    + I+   +  +WP FHNGVAAGL I+P    +   WIL   P       E+  E AG L  LGLNGHL+ + +  I + +    EM ++ LL+GL+A   G+ ++ ++K +S H   L+P    ++D +  + QV+A++  GL+   +  R +A + L E+GR       E    +D E  +++AG  +G+++  +G                            D +G     +P+ L    I  N      +P++ +     +++ + +++EG+  N DIT   A IA+GL+Y  + +  +A+ +  P T YLL+ +    L  R IARGLI+W  V P+++WVES IP  +     L KP    ++++ +D  T+N +Y  ++ G+C  MGLR+AG+ N +A   ++ Y     ++  KS  EL     +   +  L+ +LLS  M+ +G+G+L +LRI RYL++    +       +YG ++   +++GLLFLGGG  TLS S  + A LV AFFP+FP      R+HLQ+LRHLYV+A  PR++   D+D
Sbjct:  133 KISVFSPKGEIFYT----------------PLQFKISSVWSIKQGLLLERFSSSQGDNLSVSELPTLFSLLHPLDEIAPLLIKKQNGMVSFMNETNMKIVATFQDPSICLLYDRKTGTHSVWRVRSPTSEEKTAMARTDYSMSNQSFGSFSSMSNLSNISAFRSSMSSTSSVFGANNKSFIESQVSPVPSRFSSPKNMSGSMNITNKPCNSVLKPFLSNKLQTSILNSSTALSGSDIRLGMSQVFEAGVEPIVPDICLEYAWT----------------------------DTSN--KSGEVLRPASKVFFSTDFIDQKFLCYVIVEQDRLYCS--KVTQNNENNGVLIFGNTSVIEAKDAVFLPKLNMTAVLNESNGVILYSGVTYVGKLLVNGISSALATPVQLGRTTTFEKRNSLLSSTVVDDSLSDVFSDNYIPLSPVTPANKLFRSAGNNKSGNTLQTLQGLRDPVSDKLTLVYSNNSMYRLSLPPLSSSALVTKCLNTLKIILLKDVALNVLISWYTARNAPGPHDISPEQEWNLFVQVLLKSIGYR-------GETITSLSFHPCLASETPVAPKKTR---LSESGTPEDYTY--LLKSKMYKNFVLKYQRTREQSDQDEFNE-SGPDIN-TSAILYSSLYSILFSFHLLYEEIKLDSLLLDSLPLLVRLLYVLCVDFDMKEYSHHYWLDYPYLCKRTTKRKPVKHSINVPAYV----EPTPPNIFKHLYQIV-QQTP---NSLYPFINKVNNRSRDLIQLFGMLRKISSPLVKPV-----FIPGVKNSM------WPDTGFKFDNNDKSPIE---------RAIQYMVQMNITRYELQTLPPGVALFLSDAIYQIREKPPIDWNESAYRLTLRPDLAYQA--VIPTDIES---------IKVFDAI---HKDCSSWCEIESGNIPYESRWHDKMPEISRGDSNEEEDDDEDDGMCGMDQE-VLKLRWNEDRRLSDVRRFLQSSAPVTIN--ITQRPEVSDHEFI-----EEQEKHLYTI-CTRTMALPLGRGMFTLRTMMP-VVTEPLPIPKLCLTGKAPPRGTTVDLSHIDVAPNMNLWPLFHNGVAAGLRISPYAADIFSTWILYNKPKGG---PEVLPEHAGFLMALGLNGHLSNIPELYIYEYLIRSQEMTSVGLLLGLAAAKRGTMDTGITKMLSIHIESLLPPTSLELDIMHNV-QVAALLGIGLIYQGTGHRHIAEVLLSEIGRPP---GPEMENSIDRESYALSAGLGLGMVVLGKG---------------------------SDQAGLSDLHLPDTLHYFMIGGNK-----RPLTGSQK-EKYKSPSYQIREGDSVNIDITAPAATIALGLMYFKTGNRAVADWMNAPNTQYLLDFVCPDFLMLRMIARGLILWDDVMPTVEWVESHIPSTIIPYC-LRKPRANSVEDEAVDFETMNQAYCNIVAGACMAMGLRFAGSANKHAYNVLINYCNLFTSLSAKSIAEL---AGKFTIETCLNVILLSLAMVMSGTGDLEVLRICRYLRTRVESRPPLSSVISYGSYVAVHMALGLLFLGGGMYTLSTSPPAIAALVTAFFPKFPTHSLDNRFHLQALRHLYVLAVEPRLLIPRDID 1605          
BLAST of anaphase-promoting complex subunit 1 vs. TrEMBL
Match: A0A1S3ICG9 (anaphase-promoting complex subunit 1 OS=Lingula unguis OX=7574 GN=LOC106163017 PE=4 SV=1)

HSP 1 Score: 374.785 bits (961), Expect = 2.092e-101
Identity = 432/1730 (24.97%), Postives = 721/1730 (41.68%), Query Frame = 2
Query:  416 VILFTDRIAKYYGFDADIHSCTLPCKVSSAWKFRECLFVER----EEMNNFHDYSP-NSLFVMLHTLAEFTPVVFKDEFG----NCGFINDTRFRIVSVCESSFLLLAYDKTDDSFSLWRIRDATQNDFSDLYDMHWDGSIAVKKQKLKSNFISGR------------------------------SRMESSINHTNFNDNSHISSEYFEI-STDVINNSVRTVEDLDIRSPIARSLKNTKDCQIPDKMTLLNETNNCLKIHPSYRQMIEPLYPKVCLDFLFSCKAGNVEPTLDGSYADYHSTPNAYNSQKDTANQSKNGKVFGFFSEDFYRRKYLCCLKETNAGNHSILKIVKFNYEND--TFCNLEEKSWPVLDAVYLERLQFTIVLELGSTLSIYSGMTFVCKISLLN--------ALVYQP------DDPFD--------DVGMEMSI-------SDINSMNRL---------------------SDPTDYGFTIHTQSELALRLYLPEMVRLHXXXXXXXXXXXXXPIDTGMTMLCRWYSLNRAVDNNESASAEWRRFVEFLLENMGFARNRQNKAGQQQTQQETHSIVQDVKELCLDNNNGHGIASSSADTDVSMDEICSKKLRTNSGLYSIERRCLNERDGLEEYSALCYNV----TDRLLSQHAPTVLFCLHLVYECEKLNYSFCRHFKNLAALNCSIACSIGARQYLDYYLQDNPDLMADIAQLPSLAQYILIPSDITATWNPQPPNWSEILFNLMGTQSPIPNNYRYPIIEDLSEMLIQLVKIWLVMFRPDTLLDNPTSELNRYFYRINFNMSGIPCRFPVHFCHDLNRANRNETLKIDDIYRRTATYLSEIKFHVNDLDFMNDGLASIFRIVFFHCNKFP------ELYSILHRADLDMQRQLILPIVQESAVPKVLTTPLKKFRSVSEPRRNCHAYWTNNVKPPMAMPKCLDFINRTDNNYLMHVLDSDPIVQLSY-PDIRIHEAYKMIQSCCPIKLDAGICSNFTIEDGDTLSTPLKEELEGYLKIINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGKFSLSESGKPQT-IESNASTKVWPNFHNGVAAGLMIAPMNESVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPPMDVELTSVTAGFSVGLIMFQQGHIFDREHNPEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYMNSMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKAFLIKPTGIQEKY---------LDTVNDSYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINIKSNIELMPNVNRNHYDWALSTLLLSACMISAGSGNLTLLRISRYLQSIHHPK-DCGNYGVFMTYXXXXXXXXXXXXXXXXXNSHRSAAILVIAFFPRFPPTYNGRRYHLQSLRHLYVIATRPRVMCAVDLDTMIAVPVESRVVFK-DHSIRHHSRCFVFPAENPNTIEQVELFDKNNEYYPQIYKSNTEPWNILYQSYQSGGYILVKKQKPEINIQE 5260
            V +FTD    Y          TLP +VS AW  +  L  ER     EM N    +P   LF MLH L E  PV+ K   G       F+     +IV   E   L + YD      S+W+IR A   +      M   GS+ V  Q   +  + G                               SR+ S  + +  + +   S+   ++ S  V +NS+   +     SP  RS        +    TL N+T  C +         EPL P VCL+ +++         L  +    HS               +  KVF   + D   ++YLC L  T       L+ +KF   ND          + P  DA  LE L   +VL+ GS L +Y+G T V  I +          +L Y P        PF         D G E  +       ++ N  ++L                      DP +  FT+   +       LP++    +V+ CL  + ++LP D G+ +L +WY++  A     S+ +EW +FV+ +   MG+   +     +         ++   K    D    HG         +S D     KL  N+  YS+    + E   L+  S  C+ V       LL  H P V+F LHL YE  KLN       K++A +   ++  +    Y+D+Y +D P L   + +    +   L        ++  PP+    L+ ++    P      +P + +++  +  +V ++ V      L  N   E ++  Y      +G     P      L+++    +     I       ++E+      ++ +  G+A   R   +H  + P      E Y ++ R DL  Q                                  H   T    PP +       +   ++   M+ LD + +++L +  D RI E  K+++S  P+K+   +     + D D +     EE   +L  I C RT +LP+GRGM  L       +T+ LP+P LCLTG+     +    + IE+ A+  VWP FHNGVAAGL IA  ++ VD  WI+   P  N    EL+ E AG L  LGLNGHL+ L+   +   +   ++M  + LL+G++A   G+ +    + +S H   ++P    ++D +P + QVSAI+  GL+   +A R +A + L E+GR       E     D E  S+ +G ++G++M  +G       +     +L  ++ G ++ +P  G                      + K +          +++ + +++EG+  N ++T  GA +A+G+++  S ++ +A  L  P+T +LL+ +R   L  R I++GL++W  V PS  W+E  IPQ +   AF       ++KY          +T++ +Y  ++ G C  + L++AG+ N  A   ++ Y +  I   +    +    ++  +  L  ++LS  M+ AG+G+L +LRI R L++   P  +   YG  M  S+++GLLFLGGG+ TLS    + A ++ AFFP+FP   N  RYHLQ+ RHLYV+A   R++   D+DT     V  ++  K   S        + P   P   +  ++      Y+P  + ++ + WN L     + G + VK++   +   E
Sbjct:  145 VNVFTDEGKDYIS--------TLPFQVSGAWVIKNGLMFERTVTHREMANSKRVTPLPVLFTMLHPLDELAPVISKSTGGMNASKVQFVTSHSHQIVFTSEDPSLAVLYDTVHGVHSIWKIRRAKLEEGFSASGMDLMGSLPV--QSAATTPLPGHSHSSSSSSLSRVTFSSLSPSSSMSPFRSHPSRVNSPASRSISSPSLTQSASLNQMQSPSVASNSLYRFQ---TPSPGVRSPACLSRTPVTHNTTLWNDT--CAEAG-------EPLTPDVCLEQVWT--------DLGITGGRRHS--------------GRASKVF--ITTDLREQQYLCYLIPTEKQ----LRCLKFEESNDRSQLIFGTALTIPARDAGPLETLNMMVVLDPGSNLVLYTGTTQVNSIHVPGIPLATPSTSLSYPPVPDSPARGPFSSSRPPSAMDTGFEEEVNLLSPVPTEFNESSQLLDGSLAEELSSWQFPSIIAGIKDPVENQFTVELANGQLFHTGLPDLAESPLVRLCLKAVSQVLPRDVGIQVLVKWYAVRNAA-GIVSSQSEWTKFVKCMFNLMGYDAGKLALTKKYNMDSSASPVMTTKKARTSD----HG-TEEDWQYLLSSDH---HKLSQNTHSYSL---GVEEAIPLQSPSLSCHTVGTADVQALLFSHIPAVMFALHLAYENAKLNRLLSEELKSIATVLHQLSRDLKCEAYIDHYCRDFPHLFNVLQERSQFSSENLQKMHRPHFFSVNPPSIYRWLYQVLKGAEP----DVFPYLPNVTLSVRNIVILFTV------LCTNSGQEPDKEKYLKKIAAAG---HRPTSTNVSLSKSFAGSSQA--SISTNILQLMTELGITFESIENLLLGVALPLREAIYHGRETPPSTLPEEAYQLIGREDLAKQ---------------------------------VHCEHTPYTAPPGSHETSAKNVREDEDG--MNNLDKE-LLRLRFNEDHRIQEVRKLLRSSKPVKI--MLTQKPEVSDHDFI-----EEQSRHLYSI-CIRTMALPLGRGMFTLSTYHP-VVTETLPIPKLCLTGRVPPRNTTIDLSHIETPANMNVWPQFHNGVAAGLKIANSSQ-VDSTWIIYNKPKSN----ELTNEHAGFLMALGLNGHLSNLATMNVHDYLCRGHDMTGVGLLLGIAAAKRGTMDHATVRLLSIHIAAMLPPTSTELD-VPHVVQVSAILGMGLVYQGTAHRHVAEVLLAEIGRPP---GPEMDNATDRESYSLASGLALGMVMLGRGSETLGLSDLNMADQLYHFMVGGHK-RPMTG----------------------LNKER----------YKSPSYQIKEGDAVNVNVTSPGATLALGMMFFKSNNSAVAQWLMAPDTQFLLDFVRPDFLMLRVISQGLVLWDSVLPSKLWIEQNIPQVIKMYAF------NRDKYQNDPTCDTDFETMSQAYCNIVAGGCMAIALKFAGSANQEAFECLLDYAKVFIQYLNTASSIEQAGKSSLESCLIVVVLSLAMVMAGTGHLEVLRICRLLRTRVGPSYNYVLYGSHMAVSMAVGLLFLGGGRYTLSTKPEAVAAMLCAFFPKFPNHSNDNRYHLQAFRHLYVLAADSRILIPRDVDTGCPSYVPLQITVKPSSSCPPKEYQVMAPCLLPELNQLQQVVVTGERYWPVSFCAD-QNWNKLQHILSTSGTLYVKQRAGHLTYME 1703          
BLAST of anaphase-promoting complex subunit 1 vs. TrEMBL
Match: A0A2Y9RVD3 (anaphase-promoting complex subunit 1 isoform X1 OS=Trichechus manatus latirostris OX=127582 GN=LOC101355919 PE=4 SV=1)

HSP 1 Score: 374.4 bits (960), Expect = 2.905e-101
Identity = 408/1705 (23.93%), Postives = 746/1705 (43.75%), Query Frame = 2
Query:  227 ELYVNGCDAVLHNFAAQDSNHMFTGFT-ETPIKCASFVR-LSSKVSTNATYESIFQELNDFDPKGVILFTDRIAKYYGFDADIHSCTLPCKVSSAWKFRECLFVEREEMNNFHDYSPN-----SLFVMLHTLAEFTPVVFKDE--FGN--CGFINDTRFRIVSVCESSFLLLAYDKTDDSFSLWRIRDATQNDFSDLYDMHWDGSIA--VKKQKLKSNFISGRSRMESSINHTNFNDNSHISSEYFEISTDVINNSVRTVEDLDI----RSPI--------ARSLKNTKDCQIPDKMTLL---NETNNCLKIHPSYRQMIEPLYPKVCLDFLFSCKAGNVEPTLDGSYADYHSTPNAYNSQKDTANQSKNGKVFGFFSEDFYRRKYLCCLKETNAGNHSILKIVKFNYEND-------TFCNLEEKSWPVLDAVYLERLQFTIVLELGSTLSIYSGMTFVCKISL---------LNALVYQPDDPFDDVGMEMSISDINS-------------------------------------MNRLSDPTDYGFTIHTQSELALRLYLPEMVRLHXXXXXXXXXXXXXPIDTGMTMLCRWYSLNRAVDNNESASAEWRRFVEFLLENMGFARNRQNKAGQQQTQQETHSIVQDVKELCLDNNNGHGIASSSADTDVSMDEICSKKLRTNSGLYSIERR-CLNERD----GLEEYSALCYNVTDRLLSQHAPTVLFCLHLVYECEKLNYSFCRHFKNLAALNCSIACSIGARQYLDYYLQDNPDLMADIAQLPSLAQ----YILIPSDITATWNPQPPNWSEILFNLMGTQSPIPNNYRYPIIEDLSEMLIQLVKIWLVMFRPDTLLDNPTSELNRYFYRINFNMSGIPCRFPVHFCHDLNRANRNETLKIDDIYRRTATYLSEIKFHVNDLDFMNDGLASIFRIVFFHCNKFPELYSILHRADLDMQRQLILPIVQESAVPKVLTTPLKKFRSVSEPRRNCHAYWTNNVKPPMAMPKCLDFINRTDNNYLMHVLDSDPIVQLSYPDIRIHEAYKMIQSCCPIKLDAGICSNFTIEDGDTLSTPLKEELEGYLKIINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGKFSLSESG---KPQTIESNASTKVWPNFHNGVAAGLMIAPMNESVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPP-------MDVELTSVTAGFSVGLIMFQQGH--IFDREHN-PEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYMNSMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKAFLIKPTGI---QEKYLDTVNDSYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINIKSNIELMPNVNRN---HYDWALSTLLLSACMISAGSGNLTLLRISRYLQSIHHPKDCG--NYGVFMTYXXXXXXXXXXXXXXXXXNSHRSAAILVIAFFPRFPPTYNGRRYHLQSLRHLYVIATRPRVMCAVDLDT 5008
            ELYV G   +    +   +  ++  FT ++P++ A +   ++S+  +   Y        D   K + +        +  +   +  +LP +V++ W  +  L  ER   ++     P      +LF MLH L E TP+V K    FG+    ++ D   +IV +     +++ YD      S+W +R     + + +      G     V      +  +   S+ +SS+  + F + S I S+    S+  +++   ++ ++       SP          +    +   Q P + ++    N T+N     P      EP+ P++C+D L+                    T    N+++  +  SK      F + D   +K+LC   E+       L+ VKF   ND       +  N++ K     DA  +E++   ++LE G  L +Y+G+  V K+ +         ++  + +P  P D +     +S + +                                     ++ + DP     T+   +   +R+ +PE+    +V+ CL  +K +LP +  + ML +WY+++ A     S  +EW  FV  L+  MG+  +R         +     ++   K              S   +D   + + +     N   + + R  CL+  +      EE+S      +  LL  H P + F LHLVYE  KLN       ++L  L   +A  +    Y+D+Y +D P L+    Q+ ++ Q    ++  PS  T+    +PP+  + + + +  +   P  Y  P I + S++++  + ++++           + E ++Y  RI      +          + NR +   +  +  +  R   +++ + F + DL+ +  G+A   R   +HC + P           D    + L I ++    +     L K +SV           +++V       +  D +N   N  +M ++ S+        D+R+ +  +++QS  P++++  +     + D + +     EE E  L  + CQRT +LP+GRGM  L        T+ LP+P L LTG+     +        I+   +   W +FHNGVAAGL IAP ++ +D  WI+   P       EL+ E AG L  LGLNGHL KL+   I   +   +EM ++ LL+G+SA  +G+ +  +++ +S H   L+P    ++D +P   QV+A++  GL+   +A R  A + L E+GR          PP        D E  S+ AG ++G++    G   I   + N PE+L +   Y+ G +R                  + +A +     K               + + +++EG+  N D+T  GA +A+ +IY+ + +  IA+ L  P+T YLL+ ++   L  R +AR LI+W  + P+  WV+S +PQ +   +  +    +   ++  L+T++ +++ ++ G+C  +G R+AG++N +A   +  + +  +   S     PN +     + +  LS +LLS  M+ AGSGNL +L++ R+L    H K  G  NYG  + + +++GLLFLGGG+ +LS S+ S A L+ A +P FP      RYHLQ+LRHLYV+A  PR++  VD+DT
Sbjct:   92 ELYVAGNMVIWSKGSKSQALAVYKAFTVDSPVQQALWCDFITSQDKSEKAYS------GDEVEKCICILQSSCINMHSIEGKDYIASLPFQVANVWPTKYGLLFERSSSSHEVPAVPPRKPLPTLFSMLHPLDEITPLVCKSGSLFGSSRVQYVVDHAMKIVFLNTDPSIVMTYDTVQGLHSVWALRRVKPEEENVVLKFSEQGGTPQNVATSSSLTAHLRSLSKGDSSVT-SPFQNYSSIHSQSRSTSSPSLHSRSPSISNMAALSRAHSPALGVHSFSGVQRFNLSSHNQSPKRHSISHSPNSTSNDSFFAPE----TEPIVPELCIDHLW--------------------TETITNTREKHSQASKV-----FITCDLCGQKFLCFFVESQFQ----LRCVKFQESNDKAQLIFGSVTNIQAK-----DAAPVEKIDTMLILECGGNLVLYTGVVRVGKVFIPGLPAPSLTMSNTMPRPSTPLDSISTPKPLSKLLTSLDEVVLLSPVPELRDSSKLHDSLYNEDCTFQQLGTYIHSIRDPVHNRVTLELSNGSMVRITIPEIATSELVRTCLQAIKFILPKEVAVQMLVKWYNVHSA-PGGPSYHSEWNLFVTCLMNMMGYNTDRLAWTRNFDFEGSLSPVIAPKKA-----------RPSETGSDDDWEYLLNSDYHQNVESHLLTRSLCLSPLEVSQMKDEEFSQNLSLDSSTLLFTHIPAIFFVLHLVYEELKLNTLMGEGIRSLVDLLVQLARDLKLGPYVDHYYRDYPALVRTTGQVCTIDQGQTGFMHHPSFFTS----EPPSIYQWVSSCLKGEGIPPYPY-LPGICERSKLIVLSMALYILGDESSV-----SDEASQYLSRITIAPQNLQAE------QEENRFSFRHSTSVSSLAERLVVWMTNVGFTLRDLETLPFGIALPIRDAIYHCREQPAS---------DWPEAVCLLIGRQDLSKQACEGNLPKGKSV----------LSSDVPSGTEAEEEDDGMNDM-NQEVMSLIWSE--------DLRVQDVRRLLQSAHPVRVN--VVQYPELSDHEFI-----EEKENRLLQL-CQRTMALPVGRGMFTL-FSYHPVPTEPLPIPKLNLTGRAPPRNTTVDLNSGNIDVPPNMTSWASFHNGVAAGLKIAPASQ-IDSAWIVYNKP----KHAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKGHEMTSIGLLLGVSAAKLGTMDMSITRLLSIHIPALLPPTSTELD-VPHNVQVAAVVGIGLVYQGTAHRHTAEVLLAEIGR----------PPGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLNVPEQLYQ---YMVGGHR------------------RFQAGMHREKHK---------------SPSYQIKEGDTINVDVTCPGATLALAMIYLKTNNRSIADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNSKWVDSNVPQIIRENSISLSEIELPCSEDLNLETLSQAHVYIIAGACLSLGFRFAGSENLSAFNCLHKFAKDFMTYLS----APNASVTGPYNLETCLSVVLLSLAMVMAGSGNLKVLQLCRFL----HMKTGGEMNYGFHLAHHMALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPAHSTDNRYHLQALRHLYVLAAEPRLLVPVDVDT 1626          
BLAST of anaphase-promoting complex subunit 1 vs. TrEMBL
Match: A0A3Q2TZ07 (Anaphase promoting complex subunit 1 OS=Gallus gallus OX=9031 GN=ANAPC1 PE=4 SV=1)

HSP 1 Score: 372.859 bits (956), Expect = 9.906e-101
Identity = 426/1676 (25.42%), Postives = 717/1676 (42.78%), Query Frame = 2
Query:  410 KGVILFTDRIAKYYGFDADIHSCTLPCKVSSAWKFRECLFVER-----EEMNNFHDYSPNSLFVMLHTLAEFTPVVFKDEFGNCG-----FINDTRFRIVSVCESSFLLLAYDKTDDSFSLW---RIRDATQN---DFSDLYDMHWDGSIAVKKQKLKSNFISGRSRMESSINHTNFNDNSHISSEYFEISTDVINNSVRTVEDL--------------------------DIRSPIARSLKNTKDCQIPDKMTLLNETNNCLKIHPSYRQMIEPLYPKVCLDFLFSCKAGNVEPTLDGSYADYHSTPNAYNSQKDTANQSKNGKVFGFFSEDFYRRKYLCCLKETNAGNHSILKIVKFNYEND-------TFCNLEEKSWPVLDAVYLERLQFTIVLELGSTLSIYSGMTFVCKISL---------LNALVYQPDDPFDDVGM--------------EMSISDINSM------------------------NRLSDPTDYGFTIHTQSELALRLYLPEMVRLHXXXXXXXXXXXXXPIDTGMTMLCRWYSLNRAVDNNESASAEWRRFVEFLLENMGFARNRQNKAGQQQTQQETHSIVQDVKELCLDNNNGHGIASSSADTDVSMDEICSKKLRTNSGLYSIER-------RCLNERDGLEEYSALCYNVTDRLLSQHAPTVLFCLHLVYECEKLNYSFCRHFKNLAALNCSIACSIGARQYLDYYLQDNPDLMADIAQLPSLAQYILIPSDITATWNPQPPNWSEILFNLMGTQSPIPNNYRYPIIEDLSEMLIQLVKIWLVMFRPDTLLDNPTSELNRYFYRINFNMSGIPCRFPVHFCHDLNRANRNETLKIDDIYRRTATYLSEIKFHVNDLDFMNDGLASIFRIVFFHCNK-----FPELYSIL-HRADLDMQRQLILPIVQESAVPKVLTTPLKKFRSVSEPRRNCHAYWTNNVKPPMAMPKCLDFINRTDNNYLMHVLDSDPIVQLSYPDIRIHEAYKMIQSCCPIKLDAGICSNFTIEDGDTLSTPLKEELEGYLKIINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGKFSLSESG---KPQTIESNASTKVWPNFHNGVAAGLMIAPMNESVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPP-------MDVELTSVTAGFSVGLIMFQQGH--IFDREHN-PEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYMNSMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKAFLIKPTGI---QEKYLDTVNDSYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINIKSNIELMPNVN-RNHYDW--ALSTLLLSACMISAGSGNLTLLRISRYLQSIHHPKDCG--NYGVFMTYXXXXXXXXXXXXXXXXXNSHRSAAILVIAFFPRFPPTYNGRRYHLQSLRHLYVIATRPRVMCAVDLDTMIAVPVESRVVFK 5047
            K V +        +  D   +   LP +V++ W  +  L +ER     E   +       ++F MLH L E TP+V K   G  G     ++ D   RIV V     +++ YD      ++W   R++   QN    FS+      + + +        +   G S M S      F + S I S+   +S+  + +   ++ ++                          +I+SP   S+ ++ +    D   L+ ET              EP+ P++C+D L++                      A    ++  +Q+   KVF   + D   +K+LC L E+       L+ VKF   ND       +  N++ K     DA  ++ +   +VLE    L +YSG+  V K+ +         ++  + +P  P D V                 M +S +  +                        + L DP     T+   S   +R+ +PE+    +VK CL  +K +LP +  + ML +WY+   A     S   EW  FV  L+  MG+            T++ T +   +V       +       S   +D   + + S     N   + + R         L  +D   +  +L Y+    LL  H P + F LHLVYE  KLN       ++L  L   +A  +    Y+DYY +D P L+    Q   + Q  +      A ++ +PP+  + L + +   S  P  Y  P I + S+++I  + + L +   ++ + N   E + Y Y+I    SG   +      HD NR     +  I  +  +   +L+ I F + DL+ +  G+A   R   ++C +     +PE   +L  R DL  Q      +  +S+V  VL++         E          NN+                 N+ +M ++ S         D+R+ E  +++QS  P++++  +       D D +     EE E  L  + CQRT +LP+GRGM  L         ++LP+P L LTG+     S        I+   +   W +FHNGVAAGL IAP +  +D  WI+   P       E + E AG L  LGL+GHL KL+   I   +   +EM ++ LL+G+SA  +G+ +  +++ +S H   L+P    ++D +P   QV+A+I  GL+   +A R  A + L E+GR          PP        D E  S+ +G ++G++    G   I   + N PE+L +   Y+ G +R                  + +A +     K               + + +++EG+  N D+T  GA +A  +IY+ + +  IA+ L+ P+T YLL+ ++   L  R +AR LI+W  + PS +WV+S +PQ +   +  +  T +   ++  L+T+  +++ ++ G+C  +G R+AG++N  A   +  Y    +   S     P  +   HY+    LS LLLS  M+ AGSGNL +L++ R++    H K  G  NYG  + + +++GLLFLGGG+ +LS S+ S A L+ A +P FP      RYHLQ+LRHLYV+A  PR++  VD+D+         V FK
Sbjct:  152 KCVCILQSSCVNVHSIDGKDYVAALPFQVANIWPTKFGLLLERSGSSHEVPPSPPREPLPTMFSMLHPLDEITPLVCKSGAGVFGSARVQYVADYTLRIVFVNAEPSIVMTYDTVQSLHTVWALRRVKPEEQNMVLKFSEQLGTPQNVAASSSLTAQLRSLSKGDSPMASP-----FQNYSSIHSQSRSVSSPSMQSRSPSISNMAALSRSHSPALGVHSFSGVQRFNSSSNIQSPRRHSITHSPESTCSDSF-LVTET--------------EPIVPELCIDHLWT---------------------EAITKMREKNSQAS--KVF--ITTDLCGQKFLCFLVESQLQ----LRCVKFQESNDKSQLIFGSVTNIQAK-----DAAPVQGVDTLLVLEGSGNLVLYSGIVRVGKVFIPGLPAPSLTMSNQMPRPSTPLDSVSTPSKTLNKHLGPLEESMLLSPVPELRDSSKLHDSTYVEDCTFQQHGTFIHALRDPVHNRVTLELSSNTMVRITIPEIATSELVKTCLQGVKAILPKEIAVQMLVKWYNAYNA-PGGPSYRLEWNLFVTCLMNMMGY-----------NTEKLTWTRNLNVGGSPSPVSAPKKARPSETGSDEDWEYLLSSDYHRNFESHPLSRVLGLDPLEVLAPKDDFLQSLSLDYST---LLFTHIPAIFFVLHLVYEEFKLNLLMGEENRSLVVLLVQLARDLKLEAYIDYYYRDYPALVKSSGQTCIIDQGFM---HHPAFFSAEPPSIFQWLSSCLKGGSVQPYPY-LPGICERSKLVI--LSVALYVLGDESAVSN---EASPYLYKIT---SG---QQKQQIEHDDNRCCFGHSASISSLAEKLIIWLTNIGFTLRDLETLPFGVALPIRDAIYYCREQPASDWPEAVCVLIGRQDLSRQACDGNLLKSKSSVGPVLSSDSPSGAESEEDEDG-----MNNM-----------------NDEVMSLIWSK--------DLRVQEVRRLLQSARPVRVN--VVQMPEASDHDFI-----EEKENRLLQL-CQRTMALPVGRGMFTL-FSYHPIPAEQLPIPKLNLTGRAPPRNSTVDLNSGNIDVPPNMACWASFHNGVAAGLKIAPASR-IDSSWIIYNKP----KNAEQANEYAGFLMALGLSGHLTKLATLNIHDYLTKGHEMTSIGLLLGVSAAKLGTMDMAITRLLSIHIPALLPPTSTELD-VPHNVQVAAVIGIGLVYQGTAHRHTAEVLLAEIGR----------PPGPEMEYCTDRESYSLASGLALGMVCLGHGSNLIGMSDLNVPEQLYQ---YMVGGHR------------------RFQAGMHREKHK---------------SPSYQIKEGDTINVDVTCPGATLAFAMIYLKTNNRSIADWLQAPDTMYLLDFVKPEFLLLRTLARCLILWDDIMPSTEWVDSNVPQIIRENSIPLHATELPSSEDLSLETLMQAHVYIIAGACLSLGFRFAGSENKAAFNCLDKYATDFLKSLS----APTASIIGHYNLETCLSVLLLSLAMVVAGSGNLKVLQLCRFM----HKKTGGEMNYGFHLAHHMALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPVHSTDNRYHLQALRHLYVLAADPRLLIPVDVDSNTPCYALIEVTFK 1644          
BLAST of anaphase-promoting complex subunit 1 vs. TrEMBL
Match: A0A3Q2U7I1 (Anaphase promoting complex subunit 1 OS=Gallus gallus OX=9031 GN=ANAPC1 PE=4 SV=1)

HSP 1 Score: 365.925 bits (938), Expect = 1.410e-98
Identity = 422/1668 (25.30%), Postives = 705/1668 (42.27%), Query Frame = 2
Query:  410 KGVILFTDRIAKYYGFDADIHSCTLPCKVSSAWKFRECLFVER-----EEMNNFHDYSPNSLFVMLHTLAEFTPVVFKDEFGNCG-----FINDTRFRIVSVCESSFLLLAYDKTDDSFSLW---RIRDATQN---DFSDLYDMHWDGSIAVKKQKLKSNFISGRSRMES-------------------------SINHTNFNDNSHISSEYFEISTDVINNSVRTVEDLDIRSPIARSLKNTKDCQIPDKMTLLNETNNCLKIHPSYRQMIEPLYPKVCLDFLFSCKAGNVEPTLDGSYADYHSTPNAYNSQKDTANQSKNGKVFGFFSEDFYRRKYLCCLKETNAGNHSILKIVKFNYENDTFCNLEEKSWPVLDAVYLERLQFTIVLELGSTLSIYSGMTFVCKISL---------LNALVYQPDDPFDDVGM--------------EMSISDINSM------------------------NRLSDPTDYGFTIHTQSELALRLYLPEMVRLHXXXXXXXXXXXXXPIDTGMTMLCRWYSLNRAVDNNESASAEWRRFVEFLLENMGFARNRQNKAGQQQTQQETHSIVQDVKELCLDNNNGHGIASSSADTDVSMDEICSKKLRTNSGLYSIER-------RCLNERDGLEEYSALCYNVTDRLLSQHAPTVLFCLHLVYECEKLNYSFCRHFKNLAALNCSIACSIGARQYLDYYLQDNPDLMADIAQLPSLAQYILIPSDITATWNPQPPNWSEILFNLMGTQSPIPNNYRYPIIEDLSEMLIQLVKIWLVMFRPDTLLDNPTSELNRYFYRINFNMSGIPCRFPVHFCHDLNRANRNETLKIDDIYRRTATYLSEIKFHVNDLDFMNDGLASIFRIVFFHCNK-----FPELYSIL-HRADLDMQRQLILPIVQESAVPKVLTTPLKKFRSVSEPRRNCHAYWTNNVKPPMAMPKCLDFINRTDNNYLMHVLDSDPIVQLSYPDIRIHEAYKMIQSCCPIKLDAGICSNFTIEDGDTLSTPLKEELEGYLKIINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGKFSLSESG---KPQTIESNASTKVWPNFHNGVAAGLMIAPMNESVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPP-------MDVELTSVTAGFSVGLIMFQQGH--IFDREHN-PEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYMNSMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKAFLIKPTGI---QEKYLDTVNDSYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINIKSNIELMPNVN-RNHYDW--ALSTLLLSACMISAGSGNLTLLRISRYLQSIHHPKDCG--NYGVFMTYXXXXXXXXXXXXXXXXXNSHRSAAILVIAFFPRFPPTYNGRRYHLQSLRHLYVIATRPRVMCAVDLDTMIAVPVESRVVFK 5047
            K V +        +  D   +   LP +V++ W  +  L +ER     E   +       ++F MLH L E TP+V K   G  G     ++ D   RIV V     +++ YD      ++W   R++   QN    FS+      + + +        +   G S M S                         SI++      SH  +    +     +   R     +I+SP   S+ ++ +    D   L+ ET              EP+ P++C+D L++                      A    ++  +Q+   KVF   + D   +K+LC L E+       L+ VKF   N               A  ++ +   +VLE    L +YSG+  V K+ +         ++  + +P  P D V                 M +S +  +                        + L DP     T+   S   +R+ +PE+    +VK CL  +K +LP +  + ML +WY+   A     S   EW  FV  L+  MG+            T++ T +   +V       +       S   +D   + + S     N   + + R         L  +D   +  +L Y+    LL  H P + F LHLVYE  KLN       ++L  L   +A  +    Y+DYY +D P L+    Q   + Q  +      A ++ +PP+  + L + +   S  P  Y  P I + S+++I  + + L +   ++ + N   E + Y Y+I    SG   +      HD NR     +  I  +  +   +L+ I F + DL+ +  G+A   R   ++C +     +PE   +L  R DL  Q      +  +S+V  VL++         E          NN+                 N+ +M ++ S         D+R+ E  +++QS  P++++  +       D D +     EE E  L  + CQRT +LP+GRGM  L         ++LP+P L LTG+     S        I+   +   W +FHNGVAAGL IAP +  +D  WI+   P       E + E AG L  LGL+GHL KL+   I   +   +EM ++ LL+G+SA  +G+ +  +++ +S H   L+P    ++D +P   QV+A+I  GL+   +A R  A + L E+GR          PP        D E  S+ +G ++G++    G   I   + N PE+L +   Y+ G +R                  + +A +     K               + + +++EG+  N D+T  GA +A  +IY+ + +  IA+ L+ P+T YLL+ ++   L  R +AR LI+W  + PS +WV+S +PQ +   +  +  T +   ++  L+T+  +++ ++ G+C  +G R+AG++N  A   +  Y    +   S     P  +   HY+    LS LLLS  M+ AGSGNL +L++ R++    H K  G  NYG  + + +++GLLFLGGG+ +LS S+ S A L+ A +P FP      RYHLQ+LRHLYV+A  PR++  VD+D+         V FK
Sbjct:  152 KCVCILQSSCVNVHSIDGKDYVAALPFQVANIWPTKFGLLLERSGSSHEVPPSPPREPLPTMFSMLHPLDEITPLVCKSGAGVFGSARVQYVADYTLRIVFVNAEPSIVMTYDTVQSLHTVWALRRVKPEEQNMVLKFSEQLGTPQNVAASSSLTAQLRSLSKGDSPMASPFQNYSSIHSQSRSVSSPSMQSRSPSISNMAALSRSHSPA----LGVHSFSGVQRFNSSSNIQSPRRHSITHSPESTCSDSF-LVTET--------------EPIVPELCIDHLWT---------------------EAITKMREKNSQAS--KVF--ITTDLCGQKFLCFLVESQLQ----LRCVKFQESN---------------AAPVQGVDTLLVLEGSGNLVLYSGIVRVGKVFIPGLPAPSLTMSNQMPRPSTPLDSVSTPSKTLNKHLGPLEESMLLSPVPELRDSSKLHDSTYVEDCTFQQHGTFIHALRDPVHNRVTLELSSNTMVRITIPEIATSELVKTCLQGVKAILPKEIAVQMLVKWYNAYNA-PGGPSYRLEWNLFVTCLMNMMGY-----------NTEKLTWTRNLNVGGSPSPVSAPKKARPSETGSDEDWEYLLSSDYHRNFESHPLSRVLGLDPLEVLAPKDDFLQSLSLDYST---LLFTHIPAIFFVLHLVYEEFKLNLLMGEENRSLVVLLVQLARDLKLEAYIDYYYRDYPALVKSSGQTCIIDQGFM---HHPAFFSAEPPSIFQWLSSCLKGGSVQPYPY-LPGICERSKLVI--LSVALYVLGDESAVSN---EASPYLYKIT---SG---QQKQQIEHDDNRCCFGHSASISSLAEKLIIWLTNIGFTLRDLETLPFGVALPIRDAIYYCREQPASDWPEAVCVLIGRQDLSRQACDGNLLKSKSSVGPVLSSDSPSGAESEEDEDG-----MNNM-----------------NDEVMSLIWSK--------DLRVQEVRRLLQSARPVRVN--VVQMPEASDHDFI-----EEKENRLLQL-CQRTMALPVGRGMFTL-FSYHPIPAEQLPIPKLNLTGRAPPRNSTVDLNSGNIDVPPNMACWASFHNGVAAGLKIAPASR-IDSSWIIYNKP----KNAEQANEYAGFLMALGLSGHLTKLATLNIHDYLTKGHEMTSIGLLLGVSAAKLGTMDMAITRLLSIHIPALLPPTSTELD-VPHNVQVAAVIGIGLVYQGTAHRHTAEVLLAEIGR----------PPGPEMEYCTDRESYSLASGLALGMVCLGHGSNLIGMSDLNVPEQLYQ---YMVGGHR------------------RFQAGMHREKHK---------------SPSYQIKEGDTINVDVTCPGATLAFAMIYLKTNNRSIADWLQAPDTMYLLDFVKPEFLLLRTLARCLILWDDIMPSTEWVDSNVPQIIRENSIPLHATELPSSEDLSLETLMQAHVYIIAGACLSLGFRFAGSENKAAFNCLDKYATDFLKSLS----APTASIIGHYNLETCLSVLLLSLAMVVAGSGNLKVLQLCRFM----HKKTGGEMNYGFHLAHHMALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPVHSTDNRYHLQALRHLYVLAADPRLLIPVDVDSNTPCYALIEVTFK 1627          
BLAST of anaphase-promoting complex subunit 1 vs. Ensembl Cavefish
Match: anapc1 (anaphase promoting complex subunit 1 [Source:ZFIN;Acc:ZDB-GENE-081107-12])

HSP 1 Score: 278.485 bits (711), Expect = 6.047e-75
Identity = 212/663 (31.98%), Postives = 339/663 (51.13%), Query Frame = 2
Query: 3077 DIRIHEAYKMIQSCCPIKLDAGICSNFTIEDGDTLSTPLKEELEGYLKIINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGKFSLSESG---KPQTIESNASTKVWPNFHNGVAAGLMIAPMNESVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPP-------MDVELTSVTAGFSVGLIMFQQGH--IFDREHN-PEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYMNSMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKAFLIKPTGIQEKY-LDTVNDSYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINIKSNIELMPNVNRNHYDW--ALSTLLLSACMISAGSGNLTLLRISRYLQSIHHPKDCG--NYGVFMTYXXXXXXXXXXXXXXXXXNSHRSAAILVIAFFPRFPPTYNGRRYHLQSLRHLYVIATRPRVMCAVDLDTM 5011
            D+R+ E  +++QS  P++++     + +  +         EE E  L  + CQRT +LP+GRG+  L        T+ LPVP L LTG+     +        I+   +   WP+FHNGVAAGL IAP ++ V+  WI    P       EL+ E AG L  LGLNGHL KL+   I   +   +EM ++ LL+G+SA  +G+ +  +++ +S H   L+P    ++D +P   QV+A+++ GL+   +  R  A + L E+GR          PP        D E  S+ AG ++G++    G   I   + N PE+L +   Y+ G +R                    R     N  K   P        ++Q K     EG+  N D+T  GA +A+ +IY+ + +  IA+ L+ P+T +LL+ I+   L  R +AR +IMW ++ P+ +WV S +PQ +     L +   I E   ++T+  ++  ++ G+C  +G R+AG+ N +A   +  +     N   ++          Y+    LS +LL+  M+ AGSGNL +L++ R+L    H +  G  NYG  M + +++GLLFLGGG+ TLS S+ + A L+ A +P FP      RYHLQ+LRHL V+A  PR++  VD+DT+
Sbjct:  869 DLRVQEVRRLLQSSRPVRVNVPHLPDVSEHE-------YIEEKENKLLQL-CQRTMALPVGRGLFTL-FSYHPVPTEPLPVPKLNLTGRAPPRNTMVDLNSGNIDVPPNMTSWPSFHNGVAAGLKIAPASQ-VESAWIAYNKPK----SAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKGHEMTSIGLLLGVSAAKLGTMDMSITRLLSIHIPALLPPTSTELD-VPHSVQVAAVVAIGLVYQGTGHRHNAEVLLAEIGR----------PPGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMTDLNVPEQLYQ---YMVGGHR--------------------RTHAGINREKHKSP--------SYQIK-----EGDTINVDVTCPGATLALAMIYLKTNNRSIADWLKAPDTMFLLDFIKPEFLLLRTLARCIIMWDEILPNDEWVTSNVPQIIQENIGLQEEALISEDLNMETLVQAHDYIIAGACMAVGFRFAGSANSDAFDCLYKFAR---NFMLSLTTTTTTTSGPYNLQTCLSMVLLATSMVMAGSGNLKVLQLCRFL----HKRTFGEMNYGFHMAHHMALGLLFLGGGRYTLSTSNSAIAALLCALYPHFPAHSTDNRYHLQALRHLCVLAAEPRLLVPVDVDTL 1463          

HSP 2 Score: 79.337 bits (194), Expect = 3.650e-14
Identity = 104/446 (23.32%), Postives = 169/446 (37.89%), Query Frame = 2
Query: 1100 IEPLYPKVCLDFLFSCKAGNVEPTLDGSYADYHSTPNAYNSQKDTANQSKNGKVFGFFSEDFYRRKYLCCLKETNAGNHSILKIVKFNYENDT----FCNLEEKSWPVLDAVYLERLQFTIVLELGSTLSIYSGMTFVCKISLLNALV----------------------YQPDDP-----------------FDDVGMEMSISDINSMNRLSDPTDYGFTIHTQSELALRLYLPEMVRLHXXXXXXXXXXXXXPIDTGMTMLCRWYSLNRAVDNNESASAEWRRFVEFLLENMGFARNRQNKAGQQQTQQETHSIVQDVKELCLDNNNGHGIASSSADTDVSMDEICSKKLRTNSGLYSIERRCLNERDGLEEYSALCYNVTDRLLSQHAPTVLFCLHLVYECEKLNYSFCRHFKNLAALNCSIACSIGARQYLDYYLQDNPDLM 2308
            +EP+ P +C++ L+                    T  A  S ++ ++Q+       F + D    KYLC L E+    H  L+ VKF   N+T    F +L   + P  DA  LE +   +VLE   +L +Y+G+T V K+ +   L                        +PD P                  DD   + +   I S   L DP     T+   +   LR+ +PE+    +VK+CL  ++ +LP D  M +L +WY++  A     S   EW  F+   +  MG+   R         +     ++   K    D  +        A      D  C   +R   G+  +E        G+E+           LL  H P + + LHL+YE  KL+       + L  L   +A  +   +Y+D Y +D P  +
Sbjct:  286 MEPILPDLCIEQLW--------------------TETATTSHREKSSQASRV----FITSDLCESKYLCFLVES----HQQLRCVKFLESNETNQLIFASL--TTIPAKDAAPLEDIDALLVLETNGSLVLYTGVTRVSKVFVPGLLSPNFGLPNHLPPLNTHLDNVSTPAKPDMPSPVSEVRSLVQHHESSWLDDSPFQQAAPHIQS---LRDPVSNRVTLELSNGSMLRITIPEVATSELVKRCLQAIRFILPKDIAMKVLVKWYNIYNA-PGGPSLHQEWNLFITCFMTLMGYNTERLTWTRNLHFEVPLSPVIAPKKARPADTGSDEDWVYLCAS-----DYHCQVLVRPVPGIPDLESTV--PPVGMEDSGLTVGLEPSALLFPHIPALFYVLHLLYEDLKLDELQRSGARALVGLLQQLARDLQLEEYIDLYWRDYPSFI 690          
BLAST of anaphase-promoting complex subunit 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007291.1 (pep scaffold:Pmarinus_7.0:GL476479:97265:137320:-1 gene:ENSPMAG00000006552.1 transcript:ENSPMAT00000007291.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 253.062 bits (645), Expect = 9.368e-68
Identity = 203/665 (30.53%), Postives = 330/665 (49.62%), Query Frame = 2
Query: 3056 IVQLSYP-DIRIHEAYKMIQSCCPIKLDAGICSNFTIEDGDTLSTPLKEELEGYLKIINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGKFSLSESGKPQT---------IESNASTKVWPNFHNGVAAGLMIAPMNE-SVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPPMDVELTSVTAGFSVGLIMFQQGHIFDREHNPEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYMNSMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKA--FLIKPTGIQ----EKYLDTVNDSYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINIKSN--IELMPNVNRNHYDWALSTLLLSACMISAGSGNLTLLRISRYLQSIHHPKDCG--NYGVFMTYXXXXXXXXXXXXXXXXXNSHRSAAILVIAFFPRFPP--TYNGRRYHLQSLRHLYVIATRPR 4981
            ++ L +P D+R  E  +++QS  P++++  +     + D D +     EE E    +  CQRT +LP+GRGM  L        T+ LP+       KF+L+    P+          I+  A+   WP+FHNGVA GL IAP     +   W+         + I    E AGVL  LGL+GHLN L    +   +   +EM T+ LL+G+SA  +G+ +  +++ ++ H   L+P    ++D +    QV+A ++ GL+   +A R +    L E+GR+      E     D E  S+TAG  +G++    G       +     +L  Y+ G +R   +  SG                               S    ++ + +++EG+  N D+T  GA +A+ +IY+ + +  IA+ LE PET YLL+ ++   L  R +A+GLIMW +V P+  W+ S +P  V      F ++    Q    +  L T+  +++ ++ G+C  MGLR+AG+ ND+A   +     R + + S+  +EL   V R+  +  LS  LL+  ++ AG+GNL  L++ R++    H +  G  NYG  M   +++G LFLG G+ +LS S+ + A L+ A +PRFP   T N  RYHLQ+LRHL   A  PR
Sbjct: 1047 VMSLVWPGDLRAQEVRRLLQSTRPVRIN--VVQRPEVSDHDFI-----EEKEARWLLQLCQRTMALPVGRGMFTL-FTHHPLPTEPLPI------TKFNLTGRAPPRNMIVDLSSGNIDMPANMASWPSFHNGVACGLRIAPAQRLRLHAPWLSYNNRPQAGEPIP---EYAGVLLALGLSGHLNDLPIMHVHDYLTKGHEMTTIGLLLGVSAAQLGTMDMAVTRLLAVHLPALLPPSTTEMD-VAHGVQVAAAMAVGLVYQGTAYRHITETLLNEIGRAP---GPEMENCTDRESYSLTAGLGLGMVCLGHGSNLIGMSDLNVPDQLYQYMVGGHR---RSTSGA------------------------------SRERHKSPSYQIKEGDSVNVDVTCPGATLALAMIYLKTNNRSIADWLEAPETQYLLDFVKPDFLMLRILAKGLIMWDEVLPTEAWINSNVPAIVRQYGLDFDVENGAAQVLEHDVNLQTMWQAHVNIIAGACMAMGLRFAGSANDSACTCLYKCARRFLGMTSDPVVEL---VGRHTLESCLSVTLLALALVMAGTGNLQALQLCRFM----HYRTGGELNYGAHMASHMALGFLFLGAGRCSLSTSNSAIAALLCALYPRFPAHSTDNRPRYHLQALRHLTKGADCPR 1650          

HSP 2 Score: 83.5741 bits (205), Expect = 4.480e-16
Identity = 143/636 (22.48%), Postives = 244/636 (38.36%), Query Frame = 2
Query: 1220 SQKDTANQSKNGKVF-GFFSEDFYRRKYLCCLKETNAGNHSILKIVKFNYEND---TFCNLEEKSWPVLDAVYLERLQFTIVLELGSTLSIYSGMTFVCKI--------SLLNALV---YQPDDPFDD------------------------------VGMEMSISDINS----------MNRLSDPTDYGFTIHTQSELALRLYLPEMVRLHXXXXXXXXXXXXXPIDTGMTMLCRWYSLNRAVDNNESASAEWRRFVEFLLENMGFARNRQNKAGQQQTQQET--HSIVQDVKELCLDNNNGHGIASSSADTDVSMDEICSKKLRTNS--GLYSIE-RRCLNERDGLEEYSALCYNVTDRLLSQHAPTVLFCLHLVYECEKLNYSFCRHFKNLAALNCSIACSIGARQYLDYYLQDNPDLMADI---------AQLPSLAQYILIPSDITATWNPQPPNWSEILFNLMGTQS-----PIPNNYRYPIIEDLSEMLIQLVKIWLVMFRPDTLLDNPTSELNRYFYRINFNMSGIPCRFPVHFCHDLNRANRNETLKIDDIYRRTATYLSEIKFHVNDLDFMNDGLASIFRIVFFHCNKFP------ELYSILHRADLDMQRQLILPIVQESAVPK 2887
            ++K   N+  N +    F + D   R++LC L +     H  L+ VKF   ND   +F        P  DA  LE L   +VL+   +L +++G+  V K+        SL ++L+    +P  P D                               +GM +  SD++           +  L DP     T+        R+  PE+    +V+ CL      LP DT + +  RWY+    + +   AS EW  F + LL   G+  + +N    Q  +QE     ++   K    D       A +  D +  ++    + L ++   G+  ++     N   G+EE   L     D  L  H PTV + LHLVYE  KL+ +     + L  L   IA  +    Y D+YL+DNP L+            AQL ++AQY  +  D        PP     L +++G ++     P P+    P + + + +++    I+++       L     E ++Y  +I           P     D     +  +L       +   +L+ + F ++DL  +  G+A         C   P        Y+++ R DL +Q +       E +VP+
Sbjct:  433 TEKVLTNRISNSQASKAFITTDLCGRRFLCYLMD----GHHELRCVKFEESNDNPSSFVFGVVTDIPARDAAPLESLNMMLVLDDTRSLVLFTGLIKVSKVYVTGLPTPSLCHSLLQPMLRPSTPLDSNSTPARPYGTSAVTMHEAMLVSPVPEMSESMGMRLE-SDLDDSLFHTSRPSCITGLRDPVLSRLTLELVGGTMRRVSFPEIASCSLVRMCLGAACYALPRDTALQLQLRWYTARNRMGSPGLAS-EWALFRDCLLTASGY--DMENLPWAQLAEQEPCLSPVLTPKKPRTSD-------AGTDEDWEFLLNSSYHQSLLSHPLVGMLGLDMSESANPDGGVEEVHILN---PDAPLFTHLPTVFWALHLVYEDSKLDSALAETGRALGTLLYQIASDLRLTSYCDHYLRDNPTLLKSFGQNAVLMPQAQLKTMAQYHAVTRD--------PPCVCRWLCHMIGWRAGGAPPPFPS---VPGVCERTRLVVLSFAIYILGDESAAFL-----EPSKYLDKI-----------PAGKVKDTICTEQLSSLP--SPAEKLVFFLANMGFTLHDLASLPFGVALPLHEAICRCRPAPPERWPLAAYALVGRQDLSLQARTA--SEHEKSVPR 1019          
BLAST of anaphase-promoting complex subunit 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007301.1 (pep scaffold:Pmarinus_7.0:GL476479:103938:135367:-1 gene:ENSPMAG00000006552.1 transcript:ENSPMAT00000007301.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 251.906 bits (642), Expect = 1.337e-67
Identity = 205/666 (30.78%), Postives = 331/666 (49.70%), Query Frame = 2
Query: 3056 IVQLSYP-DIRIHEAYKMIQSCCPIKLDAGICSNFTIEDGDTLSTPLKEELEGYLKIINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGKFSLSESGKPQT---------IESNASTKVWPNFHNGVAAGLMIAPMNE-SVDGVWI-LKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPPMDVELTSVTAGFSVGLIMFQQGHIFDREHNPEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYMNSMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKA--FLIKPTGIQ----EKYLDTVNDSYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINIKSN--IELMPNVNRNHYDWALSTLLLSACMISAGSGNLTLLRISRYLQSIHHPKDCG--NYGVFMTYXXXXXXXXXXXXXXXXXNSHRSAAILVIAFFPRFPP--TYNGRRYHLQSLRHLYVIATRPR 4981
            ++ L +P D+R  E  +++QS  P++++  +     + D D +     EE E  L  + CQRT +LP+GRGM  L        T+ LP+       KF+L+    P+          I+  A+   WP+FHNGVA GL IAP     +   W+     P       E   E AGVL  LGL+GHLN L    +   +   +EM T+ LL+G+SA  +G+ +  +++ ++ H   L+P    ++D +    QV+A ++ GL+   +A R +    L E+GR+      E     D E  S+TAG  +G++    G       +     +L  Y+ G +R   +  SG                               S    ++ + +++EG+  N D+T  GA +A+ +IY+ + +  IA+ LE PET YLL+ ++   L  R +A+GLIMW +V P+  W+ S +P  V      F ++    Q    +  L T+  +++ ++ G+C  MGLR+AG+ ND+A   +     R + + S+  +EL   V R+  +  LS  LL+  ++ AG+GNL  L++ R++    H +  G  NYG  M   +++G LFLG G+ +LS S+ + A L+ A +PRFP   T N  RYHLQ+LRHL   A  PR
Sbjct:  918 VMSLVWPGDLRAQEVRRLLQSTRPVRIN--VVQRPEVSDHDFI-----EEKEARLLQL-CQRTMALPVGRGMFTL-FTHHPLPTEPLPI------TKFNLTGRAPPRNMIVDLSSGNIDMPANMASWPSFHNGVACGLRIAPAQRLRLHAPWLSYNNRPQAG----EPIPEYAGVLLALGLSGHLNDLPIMHVHDYLTKGHEMTTIGLLLGVSAAQLGTMDMAVTRLLAVHLPALLPPSTTEMD-VAHGVQVAAAMAVGLVYQGTAYRHITETLLNEIGRAP---GPEMENCTDRESYSLTAGLGLGMVCLGHGSNLIGMSDLNVPDQLYQYMVGGHR---RSTSGA------------------------------SRERHKSPSYQIKEGDSVNVDVTCPGATLALAMIYLKTNNRSIADWLEAPETQYLLDFVKPDFLMLRILAKGLIMWDEVLPTEAWINSNVPAIVRQYGLDFDVENGAAQVLEHDVNLQTMWQAHVNIIAGACMAMGLRFAGSANDSACTCLYKCARRFLGMTSDPVVEL---VGRHTLESCLSVTLLALALVMAGTGNLQALQLCRFM----HYRTGGELNYGAHMASHMALGFLFLGAGRCSLSTSNSAIAALLCALYPRFPAHSTDNRPRYHLQALRHLTKGADCPR 1520          

HSP 2 Score: 63.1586 bits (152), Expect = 7.518e-10
Identity = 92/390 (23.59%), Postives = 152/390 (38.97%), Query Frame = 2
Query: 1739 DTGMTMLCRWYSLNRAVDNNESASAEWRRFVEFLLENMGFARNRQNKAGQQQTQQETHSIVQDVKELCLDNNNGHGIASSSADTDVSMDEICS-KKLRT-NSGLYSIERRCLNERDGLEE--YSALCYNVTDRLLSQHAPTVLFCLHLVYECEKLNYSFCRHFKNLAALNCSIACSIGARQYLDYYLQDNPDLMADI---------AQLPSLAQYILIPSDITATWNPQPPNWSEILFNLMGTQ---SPIPNNYRYPIIEDLSEMLIQLVKIWLVMFRPDTLLDNPTSELNRYFYRINFNMSGIPCRFPVHFCHDLNRANRNETLKIDDIYRRTATYLSEIKFHVNDLDFMNDGLASIFRIVFFHCNKFP------ELYSILHRADLDMQ 2842
            DT + +  RWY+    + +   AS EW  F + LL   G+       A      Q +H  V+      L          + A+ +  +  + + KK RT ++G        LN+R   E   +S +     D  L  H PTV + LHLVYE  KL+ +     + L  L   IA  +    Y D+YL+DNP L+            AQL ++AQY  +  D        PP     L +++G +   +P P    +P +  + E      +  LV+     LL+      +R+  R    + G    F    C +       +   +     +   +L+ + F ++DL  +  G+A         C   P        Y+++ R DL +Q
Sbjct:  509 DTALQLQLRWYTARNRMGSPGLAS-EWALFRDCLLTASGYDMENLPWA------QLSHGTVRLPLTPPLHAPVLTQCRCTRAEQEPCLSPVLTPKKPRTSDAGTDEDWEFLLNQRGEAERGPFSRVHILNPDAPLFTHLPTVFWALHLVYEDSKLDSALAETGRALGTLLYQIASDLRLTSYCDHYLRDNPTLLKSFGQMCMCMGAAQLKTMAQYHAVTRD--------PPCVCRWLCHMIGWRAGGAPPP----FPSVPGVCE------RTRLVVLTVHILLEGHDMVGHRWSRRPAGELMG---GFLFRICTE-------QLSSLPSPAEKLVFFLANMGFTLHDLASLPFGVALPLHEAICRCRPAPPERWPLAAYALVGRQDLSLQ 863          
BLAST of anaphase-promoting complex subunit 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007288.1 (pep scaffold:Pmarinus_7.0:GL476479:97265:137320:-1 gene:ENSPMAG00000006552.1 transcript:ENSPMAT00000007288.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 252.292 bits (643), Expect = 1.506e-67
Identity = 204/663 (30.77%), Postives = 329/663 (49.62%), Query Frame = 2
Query: 3056 IVQLSYP-DIRIHEAYKMIQSCCPIKLDAGICSNFTIEDGDTLSTPLKEELEGYLKIINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGK-------FSLSESGKPQTIESNASTKVWPNFHNGVAAGLMIAPMNE-SVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPPMDVELTSVTAGFSVGLIMFQQGHIFDREHNPEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYMNSMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKA--FLIKPTGIQ----EKYLDTVNDSYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINIKSN--IELMPNVNRNHYDWALSTLLLSACMISAGSGNLTLLRISRYLQSIHHPKDCG--NYGVFMTYXXXXXXXXXXXXXXXXXNSHRSAAILVIAFFPRFPP--TYNGRRYHLQSLRHLYVIATRPR 4981
            ++ L +P D+R  E  +++QS  P++++  +     + D D +     EE E    +  CQRT +LP+GRGM  L        T+ LP+    LTG+         LS       I+  A+   WP+FHNGVA GL IAP     +   W+         + I    E AGVL  LGL+GHLN L    +   +   +EM T+ LL+G+SA  +G+ +  +++ ++ H   L+P    ++D +    QV+A ++ GL+   +A R +    L E+GR+      E     D E  S+TAG  +G++    G       +     +L  Y+ G +R   +  SG                               S    ++ + +++EG+  N D+T  GA +A+ +IY+ + +  IA+ LE PET YLL+ ++   L  R +A+GLIMW +V P+  W+ S +P  V      F ++    Q    +  L T+  +++ ++ G+C  MGLR+AG+ ND+A   +     R + + S+  +EL   V R+  +  LS  LL+  ++ AG+GNL  L++ R++    H +  G  NYG  M   +++G LFLG G+ +LS S+ + A L+ A +PRFP   T N  RYHLQ+LRHL   A  PR
Sbjct: 1058 VMSLVWPGDLRAQEVRRLLQSTRPVRIN--VVQRPEVSDHDFI-----EEKEARWLLQLCQRTMALPVGRGMFTL-FTHHPLPTEPLPITKFNLTGRAPPRNMIVDLSSG----NIDMPANMASWPSFHNGVACGLRIAPAQRLRLHAPWLSYNNRPQAGEPIP---EYAGVLLALGLSGHLNDLPIMHVHDYLTKGHEMTTIGLLLGVSAAQLGTMDMAVTRLLAVHLPALLPPSTTEMD-VAHGVQVAAAMAVGLVYQGTAYRHITETLLNEIGRAP---GPEMENCTDRESYSLTAGLGLGMVCLGHGSNLIGMSDLNVPDQLYQYMVGGHR---RSTSGA------------------------------SRERHKSPSYQIKEGDSVNVDVTCPGATLALAMIYLKTNNRSIADWLEAPETQYLLDFVKPDFLMLRILAKGLIMWDEVLPTEAWINSNVPAIVRQYGLDFDVENGAAQVLEHDVNLQTMWQAHVNIIAGACMAMGLRFAGSANDSACTCLYKCARRFLGMTSDPVVEL---VGRHTLESCLSVTLLALALVMAGTGNLQALQLCRFM----HYRTGGELNYGAHMASHMALGFLFLGAGRCSLSTSNSAIAALLCALYPRFPAHSTDNRPRYHLQALRHLTKGADCPR 1661          

HSP 2 Score: 84.7297 bits (208), Expect = 2.033e-16
Identity = 140/619 (22.62%), Postives = 242/619 (39.10%), Query Frame = 2
Query: 1220 SQKDTANQSKNGKVF-GFFSEDFYRRKYLCCLKETNAGNHSILKIVKFNYEND---TFCNLEEKSWPVLDAVYLERLQFTIVLELGSTLSIYSGMTFVCKI--------SLLNALV---YQPDDPFDD------------------------------VGMEMSISDINS----------MNRLSDPTDYGFTIHTQSELALRLYLPEMVRLHXXXXXXXXXXXXXPIDTGMTMLCRWYSLNRAVDNNESASAEWRRFVEFLLENMGFARNRQNKAGQQQTQQET--HSIVQDVKELCLDNNNGHGIASSSADTDVSMDEICSKKLRTNS--GLYSIE-RRCLNERDGLEEYSALCYNVTDRLLSQHAPTVLFCLHLVYECEKLNYSFCRHFKNLAALNCSIACSIGARQYLDYYLQDNPDLMADIAQ----LP-SLAQYILI-PSDITATWNPQPPNWSEILFNLMGTQS-----PIPNNYRYPIIEDLSEMLIQLVKIWLVMFRPDTLLDNPTSELNRYFYRINFN-MSGIPCRFPVHFCHDLNRANRNETLKIDDIYRRTATYLSEIKFHVNDLDFMNDGLASIFRIVFFHCNKFP------ELYSILHRADLDMQ 2842
            ++K   N+  N +    F + D   R++LC L +     H  L+ VKF   ND   +F        P  DA  LE L   +VL+   +L +++G+  V K+        SL ++L+    +P  P D                               +GM +  SD++           +  L DP     T+        R+  PE+    +V+ CL      LP DT + +  RWY+    + +   AS EW  F + LL   G+  + +N    Q  +QE     ++   K    D       A +  D +  ++    + L ++   G+  ++     N   G+EE   L     D  L  H PTV + LHLVYE  KL+ +     + L  L   IA  +    Y D+YL+DNP L+    Q    +P   AQ + I PS+        PP     L +++G ++     P P+    P + + + +++    I+++       L+ P+  L++      ++ M     RF    C +       +   +     +   +L+ + F ++DL  +  G+A         C   P        Y+++ R DL +Q
Sbjct:  432 TEKVLTNRISNSQASKAFITTDLCGRRFLCYLMD----GHHELRCVKFEESNDNPSSFVFGVVTDIPARDAAPLESLNMMLVLDDTRSLVLFTGLIKVSKVYVTGLPTPSLCHSLLQPMLRPSTPLDSNSTPARPYGTSAVTMHEAMLVSPVPEMSESMGMRLE-SDLDDSLFHTSRPSCITGLRDPVLSRLTLELVGGTMRRVSFPEIASCSLVRMCLGAACYALPRDTALQLQLRWYTARNRMGSPGLAS-EWALFRDCLLTASGY--DMENLPWAQLAEQEPCLSPVLTPKKPRTSD-------AGTDEDWEFLLNSSYHQSLLSHPLVGMLGLDMSESANPDGGVEEVHILN---PDAPLFTHLPTVFWALHLVYEDSKLDSALAETGRALGTLLYQIASDLRLTSYCDHYLRDNPTLLKSFGQNAVLMPQGTAQQLTIHPSNAYHAVTRDPPCVCRWLCHMIGWRAGGAPPPFPS---VPGVCERTRLVVLSFAIYILGDESAAFLE-PSKYLDKIPAGHGWSQMEQETSRFLFRICTE-------QLSSLPSPAEKLVFFLANMGFTLHDLASLPFGVALPLHEAICRCRPAPPERWPLAAYALVGRQDLSLQ 1021          
BLAST of anaphase-promoting complex subunit 1 vs. Ensembl Yeast
Match: APC1 (Largest subunit of the Anaphase-Promoting Complex/Cyclosome; APC/C is a ubiquitin-protein ligase required for degradation of anaphase inhibitors, including mitotic cyclins, during the metaphase/anaphase transition; component of the platform domain of the APC/C, based on structural analysis; localizes to nuclear foci that become diffuse upon DNA replication stress [Source:SGD;Acc:S000005116])

HSP 1 Score: 78.1814 bits (191), Expect = 1.119e-14
Identity = 113/462 (24.46%), Postives = 197/462 (42.64%), Query Frame = 2
Query: 3404 WPNFHNGVAAGLMIAPMNESVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPPMDVELTSVTAGFSVGLIMFQQGHIFDREHNPEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEAD-SWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYMNSMSTIIANHLECPETFYLLEKI--RSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKAFLIKPTGIQEKYLDTVND--SYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINI-----KSNIELMPNVNRNHYDWALSTLLLSACMISAGSGNLTLLRISRYLQSI 4759
            W  FH GV++GL I+     + G WI    P       EL A   G L GLGLNGHL  L +  I   +   N   ++ LL+G+S+   GS +S L K IS H    +P     ++ I    Q + II  G+L   S  ++M+     ++      L+V      D E   + AG S+GLI    G    R+ +   L                 G G   +++P D+   + ++ N M +       +   + +  +N  + E    N+ I   GA IAI  +++ S +  I+N L+      L   I  R  +L +R+ A  +I+W  +   +              +F++K   I  K+ +   D       + G    MG+R+A T N   R  +++ +++ + +     K N++    ++    +   + +++S  M+   SG+L +LR  +YL  +
Sbjct: 1009 WGQFHAGVSSGLRISKKATGITGSWIAFNKPK------ELDAYHGGFLLGLGLNGHLKNLEEWHIYNYLSPRNTHISIGLLLGMSSSMKGSMDSKLIKVISVHLVAFLPSGSSDLN-IDLKLQTAGIIGMGMLYLNSRHKRMSDSIFAQL---VSLLNVNDEMVADEEY-RLAAGISLGLINLGAGQTKLRKWDSSLL-----------------GLG---DDLPEDVYDSSDVEQNVMYEDLTTKLLEIVTSTYDVENDWIPE----NSQI---GAVIAIMFLFLKSNNFGISNMLKVDLKEILKANINTRPELLMYREWASNMILWEFIGDDL--------------SFIMKDVDIGVKFSELNTDLLPIYYTMAGRILAMGIRFASTGNLKIRNILLSLVDKFLPLYQYPGKQNLDFRLTISV--INVLTNVIVVSLSMVMCASGDLEVLRRVKYLHEV 1416          
BLAST of anaphase-promoting complex subunit 1 vs. Ensembl Nematostella
Match: EDO40201 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7Y3])

HSP 1 Score: 267.7 bits (683), Expect = 3.127e-74
Identity = 189/632 (29.91%), Postives = 303/632 (47.94%), Query Frame = 2
Query: 3221 IINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGKFSLSESGKPQT-------IESNASTKVWPNFHNGVAAGLMIAPMNESVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPPMD----VELTSVTAGFSVGLIMFQQGHIFDREHNPEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYMNSMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKAFLIKPTGIQ----EKYLDTVNDSYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINIKSNIELMPNVNRNHYDWALSTLLLSACMISAGSGNLTLLRISRYLQSIHHPKDCGNYGVFMTYXXXXXXXXXXXXXXXXXNSHRSAAILVIAFFPRFPPTYNGRRYHLQSLRHLYVIATRPRVMCAVDLDTMIAVPVESRVVFKDHSIRHHS 5071
            ++ C+R  +L +GRGM  L   +   LT+ LP+P L LTG+        P+        ++  A  +VWP FHNGVAAGL IAP    +D  WI+   P       EL+ E AG L  LGLNGHL  LS   +   +   +E+ T+ LL+G+SA    S +   +K +S H   L+P    ++D +P   QV+ ++  GL+   +A R+MA + L E+GR          P M+     E  S+ AG ++GL+M Q G+      + +   +L  Y+ G  + +P+ G+                                    F++ +  ++EG+  N D+T +GA +A+GL++M + ++ +A+ L+ P+T +LL+ +R   L  R ++RGLIMW  +QP  DWVES IP  V   AF   P  ++    +  L T++ +   ++ G C  MG+R+AG+ N  A   ++ Y +   ++  +  +     +   +  +   L+S  ++ AGSGNL +LRI+R L    H  D  +YG  M                     H S  +L +           G RYHLQ+ RHLYV+A  PRV+   +++   A  V  +V  K     H +
Sbjct:  127 LLMCKRVMALSVGRGMFTLATSRP-ILTETLPIPTLELTGR------APPRNTVVGLDHVDCPADMRVWPQFHNGVAAGLKIAPGISQIDSTWIVYNKPK------ELTNEHAGFLMALGLNGHLGNLSYMNLHDYLCKGHELTTVGLLLGISAARRASMDLSTTKVLSIHVDALLPPTSAELD-VPHSAQVAGVLGVGLVYEGTAHRRMAEVLLSEIGRP-------AGPDMENAVNRESYSLAAGLALGLVMLQHGNDALGVSDLKMADQLFQYMVGGQK-KPQTGT--------------------------------QKEKFKSPSYLIKEGDTVNIDVTAAGATLALGLMFMKTNNSSVASWLDAPDTQFLLDSVRPDFLLLRLLSRGLIMWDSIQPCKDWVESHIPDIVQKYAFCADPETLKVDDSDIDLQTLSQAKASIIAGCCLAMGMRFAGSANQEAFTCLMHYTKYFKDLLGS-AVGEQAGKPTLETCMDVCLISVALVMAGSGNLEVLRITRQLHK-RHSADV-SYGSHMAV-------------------HMSIGLLFL----------GGGRYHLQAFRHLYVLAAEPRVLVTREVENNTACYVPIQVTLKSTEFYHET 672          
BLAST of anaphase-promoting complex subunit 1 vs. Ensembl Medaka
Match: anapc1 (anaphase promoting complex subunit 1 [Source:NCBI gene;Acc:101154801])

HSP 1 Score: 281.567 bits (719), Expect = 5.011e-76
Identity = 214/673 (31.80%), Postives = 348/673 (51.71%), Query Frame = 2
Query: 3077 DIRIHEAYKMIQSCCPIKLDAGICSNFTIEDGDTLSTPLKEELEGYLKIINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGKFSLSESG---KPQTIESNASTKVWPNFHNGVAAGLMIAPMNESVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPP-------MDVELTSVTAGFSVGLIMFQQGH--IFDREHN-PEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYMNSMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKAFLIKPTGIQEKYLDTVNDSYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINIKSNIELMPNVNRNHYDWALSTLLLSACMISAGSGNLTLLRISRYLQSIHHPKDCG--NYGVFMTYXXXXXXXXXXXXXXXXXNSHRSAAILVIAFFPRFPPTYNGRRYHLQSLRHLYVIATRPRVMCAVDLDTMIAVPVESRVVFKD 5050
            D+R+ E  +++QS  P+++   +     + D + +     EE E  L  + CQRT +LP+GRG+  L        T+ LPVP L LTG+     +        I+   +   WP+FHNGVAAGL IAP ++ V+  WI    P       EL+ E AG L  LGLNGHL KL+   I   +   +EM ++ LL+G+S+  +G+ +  +++ +S H   L+P    ++D +P   QV+A+I  GL+   +  R  A + L E+GR          PP        D E  S+ AG ++G++    G   I   + N PE+L +   Y+ G +R                    RA +  N  +   P        ++Q K     EG+  N D+T  GA +A+ +IY+ + +  IA+ L+ P+T++LL+ I+   L  R +AR +IMW ++ P+ +WV+S IPQ +      + P+  ++  +D +  +   +  G+C  +GLR+AG+ N +A   +  + +  + I   +      +  +    LS +LL+  MI AG+G+L +L++ R+L    H +  G  NYG  M + +++GLLFLGGG+ TLS S+ + A L+ A +P FP      RYHLQ+LRHL V+A  PR++  VD+D++    V   V +KD
Sbjct:  783 DLRVQEVRRLLQSSRPVRVS--VVQLPEVSDHEYI-----EEKENKLLQL-CQRTMALPVGRGLFTL-FSYHPVPTEPLPVPKLNLTGRAPPRNTMVDLNSGNIDVPPNMTSWPSFHNGVAAGLKIAPASQ-VESAWIAYNKPKTP----ELANEYAGFLMALGLNGHLTKLATLNIHDYLTKGHEMTSIGLLLGVSSARLGTMDMSITRLLSIHIPALLPPTSTELD-VPHNVQVAAVIGIGLVYQGTGHRHNAEVLLSEIGR----------PPGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMTDLNVPEQLYQ---YMVGGHR--------------------RAQVGANRERHKSP--------SYQIK-----EGDTINVDVTCPGATLALAMIYLKTNNRSIADWLKPPDTWFLLDFIKPEFLLLRTLARCIIMWDEILPNTEWVKSNIPQIIREN---VDPS--EDINMDAMTQAQDYITAGACMALGLRFAGSANSDAFDCLHEFAKTFMKI---MAFAGTTSYYNLQTGLSMILLAMSMIMAGTGDLKVLQLCRFL----HKRTGGEMNYGFHMAHHMALGLLFLGGGRYTLSTSNSAIAALLCALYPHFPAHSTDNRYHLQALRHLAVLAAEPRLLVPVDVDSLKPCYVLLEVTYKD 1382          
BLAST of anaphase-promoting complex subunit 1 vs. Planmine SMEST
Match: SMESG000012375.1 (SMESG000012375.1)

HSP 1 Score: 3802.29 bits (9859), Expect = 0.000e+0
Identity = 1853/1865 (99.36%), Postives = 1861/1865 (99.79%), Query Frame = 2
Query:   56 MNIKMIGPRSIYQQKPLGKNILQEKRELKNSGFQTKYLKSNIKNEFTIVRNVSNQQMELYVNGCDAVLHNFAAQDSNHMFTGFTETPIKCASFVRLSSKVSTNATYESIFQELNDFDPKGVILFTDRIAKYYGFDADIHSCTLPCKVSSAWKFRECLFVEREEMNNFHDYSPNSLFVMLHTLAEFTPVVFKDEFGNCGFINDTRFRIVSVCESSFLLLAYDKTDDSFSLWRIRDATQNDFSDLYDMHWDGSIAVKKQKLKSNFISGRSRMESSINHTNFNDNSHISSEYFEISTDVINNSVRTVEDLDIRSPIARSLKNTKDCQIPDKMTLLNETNNCLKIHPSYRQMIEPLYPKVCLDFLFSCKAGNVEPTLDGSYADYHSTPNAYNSQKDTANQSKNGKVFGFFSEDFYRRKYLCCLKETNAGNHSILKIVKFNYENDTFCNLEEKSWPVLDAVYLERLQFTIVLELGSTLSIYSGMTFVCKISLLNALVYQPDDPFDDVGMEMSISDINSMNRLSDPTDYGFTIHTQSELALRLYLPEMVRLHXXXXXXXXXXXXXPIDTGMTMLCRWYSLNRAVDNNESASAEWRRFVEFLLENMGFARNRQNKAGQQQTQQETHSIVQDVKELCLDNNNGHGIASSSADTDVSMDEICSKKLRTNSGLYSIERRCLNERDGLEEYSALCYNVTDRLLSQHAPTVLFCLHLVYECEKLNYSFCRHFKNLAALNCSIACSIGARQYLDYYLQDNPDLMADIAQLPSLAQYILIPSDITATWNPQPPNWSEILFNLMGTQSPIPNNYRYPIIEDLSEMLIQLVKIWLVMFRPDTLLDNPTSELNRYFYRINFNMSGIPCRFPVHFCHDLNRANRNETLKIDDIYRRTATYLSEIKFHVNDLDFMNDGLASIFRIVFFHCNKFPELYSILHRADLDMQRQLILPIVQESAVPKVLTTPLKKFRSVSEPRRNCHAYWTNNVKPPMAMPKCLDFINRTDNNYLMHVLDSDPIVQLSYPDIRIHEAYKMIQSCCPIKLDAGICSNFTIEDGDTLSTPLKEELEGYLKIINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGKFSLSESGKPQTIESNASTKVWPNFHNGVAAGLMIAPMNESVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPPMDVELTSVTAGFSVGLIMFQQGHIFDREHNPEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYMNSMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKAFLIKPTGIQEKYLDTVNDSYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINIKSNIELMPNVNRNHYDWALSTLLLSACMISAGSGNLTLLRISRYLQSIHHPKDCGNYGVFMTYXXXXXXXXXXXXXXXXXNSHRSAAILVIAFFPRFPPTYNGRRYHLQSLRHLYVIATRPRVMCAVDLDTMIAVPVESRVVFKDHSIRHHSRCFVFPAENPNTIEQVELFDKNNEYYPQIYKSNTEPWNILYQSYQSGGYILVKKQKPEINIQEIFDKLEIDCNHRFHGYQLVDHDLLDTFINKTNDFQFYPSGMILNGKIIHFLEAYSHDLKRIFLRLRSGLDVEDFNQFFAFNQWCHENGFMKIWMVFSFIYRSSICAVRAVQSGDFNQLPDDYKYFIENIS 5650
            MNIKMIGPRSIYQQKPLGKNILQEKRELKNSGFQTKYLKSNIKNEFTIVRNVSNQQMELYVNGCDAVLHNFAAQDSNHMFTGFTETPIKCASFVRLSSKVSTNATYESIFQELNDFDPKGVILFTDRIAKYYGFDADIHSCTLPCKVSSAWKFRECLFVEREEMNNFHDYSPNSLFVMLHTLAEFTPVVFKDEFGNCGFINDTRFRIVSVCESSFLLLAYDKTDDSFSLWRIRDATQNDFSDLYDMHWDGSIAVKKQKLKSNFISGRSRMESSINHTNFNDNSHISSEYFEISTDVINNSVRTVEDLDIRSPIARSLKNTKDCQIPDKMTLLNETNNCLKIHPSYRQMIEPLYPKVCLDFLFSCKAGNVEPTLDGSYADYHSTPN YNSQK TANQSKNGKVFGFFSEDFYRRKYLCCLKETNA NHSILKIVKFNYENDTFCNLEEKSWPVLDAVYLERLQFTIVLELGSTLSIYSGMTFVCKISLLNALVYQPDDPFDDVGMEMSISDINSM RLSDPTDYGFTIHTQSELALRLYLPEMVRLHVVKKCLSVLKKLLPIDTGMTMLCRWYSLNRAVDNNESASAEWRRFVEFLLENMGFARNRQNKAGQQQTQQETHSIVQDVKELCLDNNNGHGIASSSADTDVSMDEICSKKLRTNSGLYSIERRCLNERDGLE+YSALCYNVTDRLLSQHAPTVLFCLHLVYECEKLNYSFCRHFKNLAALNCSIACSIGARQYLDYYLQDNPDL+ADIAQLPSLAQYILIPSDITATWNPQPPNWSEILFNLMGTQSPIPNNYRYPIIEDLSEMLIQLVKIWLVMFRPDTLLDNPTSELNRYFYRINFNMSGIPCRFPVHFCHDLNRANRNETLKIDDIYRRTATYLSEIKFHVNDLDFMNDGLASIFRIVFFHCNKFPELYSILHRADLDMQRQLILPIVQESAVPKVLTTPLKKFRSVSEPRRNCHAYWTNNVKPPMAMPKCLDFINRTDNNYLMHVLDSDPIVQLSYPDIRIHEAYKMIQSCCPIKLDAGICSNFTIEDGDTLSTPLKEELEGYLKIINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGKF+LSESGKPQTIESNASTKVWPNFHNGVAAGLMIAPMNESVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPPMDVELTSVTAGFSVGLIMFQQGHIF+REHNPEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYM+SMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKAFLIKPTGIQEKYLDTVNDSYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINIKSNIELMPNVNRNHYDWALSTLLLSACMISAGSGNLTLLRISRYLQSIHHPKDCGNYGVFMTYSLSIGLLFLGGGKLTLSNSHRSAAILVIAFFPRFPPTYNGRRYHLQSLRHLYVIATRPRVMCAVDLDTMIAVPVESRVVFKDHSIRHHSRCFVFPAENPNTIEQVELFDKNNEYYPQIYKSNTEPWNILYQSYQSGGYILVKKQKPEINIQEIFDKLEIDCNHRFHGYQLVDHDLLDTFINKTNDFQFYPSGMILNGKIIHFLEA+S+DLKRIFLRLRSGLDVEDFNQFFAFNQWCHENGFMKIWMVFSFIYRSSICAVRAVQSGDFNQLPDDYKYFI+NIS
Sbjct:    1 MNIKMIGPRSIYQQKPLGKNILQEKRELKNSGFQTKYLKSNIKNEFTIVRNVSNQQMELYVNGCDAVLHNFAAQDSNHMFTGFTETPIKCASFVRLSSKVSTNATYESIFQELNDFDPKGVILFTDRIAKYYGFDADIHSCTLPCKVSSAWKFRECLFVEREEMNNFHDYSPNSLFVMLHTLAEFTPVVFKDEFGNCGFINDTRFRIVSVCESSFLLLAYDKTDDSFSLWRIRDATQNDFSDLYDMHWDGSIAVKKQKLKSNFISGRSRMESSINHTNFNDNSHISSEYFEISTDVINNSVRTVEDLDIRSPIARSLKNTKDCQIPDKMTLLNETNNCLKIHPSYRQMIEPLYPKVCLDFLFSCKAGNVEPTLDGSYADYHSTPNEYNSQKATANQSKNGKVFGFFSEDFYRRKYLCCLKETNAANHSILKIVKFNYENDTFCNLEEKSWPVLDAVYLERLQFTIVLELGSTLSIYSGMTFVCKISLLNALVYQPDDPFDDVGMEMSISDINSMIRLSDPTDYGFTIHTQSELALRLYLPEMVRLHVVKKCLSVLKKLLPIDTGMTMLCRWYSLNRAVDNNESASAEWRRFVEFLLENMGFARNRQNKAGQQQTQQETHSIVQDVKELCLDNNNGHGIASSSADTDVSMDEICSKKLRTNSGLYSIERRCLNERDGLEDYSALCYNVTDRLLSQHAPTVLFCLHLVYECEKLNYSFCRHFKNLAALNCSIACSIGARQYLDYYLQDNPDLVADIAQLPSLAQYILIPSDITATWNPQPPNWSEILFNLMGTQSPIPNNYRYPIIEDLSEMLIQLVKIWLVMFRPDTLLDNPTSELNRYFYRINFNMSGIPCRFPVHFCHDLNRANRNETLKIDDIYRRTATYLSEIKFHVNDLDFMNDGLASIFRIVFFHCNKFPELYSILHRADLDMQRQLILPIVQESAVPKVLTTPLKKFRSVSEPRRNCHAYWTNNVKPPMAMPKCLDFINRTDNNYLMHVLDSDPIVQLSYPDIRIHEAYKMIQSCCPIKLDAGICSNFTIEDGDTLSTPLKEELEGYLKIINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGKFNLSESGKPQTIESNASTKVWPNFHNGVAAGLMIAPMNESVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPPMDVELTSVTAGFSVGLIMFQQGHIFNREHNPEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYMDSMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKAFLIKPTGIQEKYLDTVNDSYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINIKSNIELMPNVNRNHYDWALSTLLLSACMISAGSGNLTLLRISRYLQSIHHPKDCGNYGVFMTYSLSIGLLFLGGGKLTLSNSHRSAAILVIAFFPRFPPTYNGRRYHLQSLRHLYVIATRPRVMCAVDLDTMIAVPVESRVVFKDHSIRHHSRCFVFPAENPNTIEQVELFDKNNEYYPQIYKSNTEPWNILYQSYQSGGYILVKKQKPEINIQEIFDKLEIDCNHRFHGYQLVDHDLLDTFINKTNDFQFYPSGMILNGKIIHFLEAHSNDLKRIFLRLRSGLDVEDFNQFFAFNQWCHENGFMKIWMVFSFIYRSSICAVRAVQSGDFNQLPDDYKYFIQNIS 1865          
BLAST of anaphase-promoting complex subunit 1 vs. Planmine SMEST
Match: SMESG000012375.1 (SMESG000012375.1)

HSP 1 Score: 3791.89 bits (9832), Expect = 0.000e+0
Identity = 1849/1861 (99.36%), Postives = 1857/1861 (99.79%), Query Frame = 2
Query:   68 MIGPRSIYQQKPLGKNILQEKRELKNSGFQTKYLKSNIKNEFTIVRNVSNQQMELYVNGCDAVLHNFAAQDSNHMFTGFTETPIKCASFVRLSSKVSTNATYESIFQELNDFDPKGVILFTDRIAKYYGFDADIHSCTLPCKVSSAWKFRECLFVEREEMNNFHDYSPNSLFVMLHTLAEFTPVVFKDEFGNCGFINDTRFRIVSVCESSFLLLAYDKTDDSFSLWRIRDATQNDFSDLYDMHWDGSIAVKKQKLKSNFISGRSRMESSINHTNFNDNSHISSEYFEISTDVINNSVRTVEDLDIRSPIARSLKNTKDCQIPDKMTLLNETNNCLKIHPSYRQMIEPLYPKVCLDFLFSCKAGNVEPTLDGSYADYHSTPNAYNSQKDTANQSKNGKVFGFFSEDFYRRKYLCCLKETNAGNHSILKIVKFNYENDTFCNLEEKSWPVLDAVYLERLQFTIVLELGSTLSIYSGMTFVCKISLLNALVYQPDDPFDDVGMEMSISDINSMNRLSDPTDYGFTIHTQSELALRLYLPEMVRLHXXXXXXXXXXXXXPIDTGMTMLCRWYSLNRAVDNNESASAEWRRFVEFLLENMGFARNRQNKAGQQQTQQETHSIVQDVKELCLDNNNGHGIASSSADTDVSMDEICSKKLRTNSGLYSIERRCLNERDGLEEYSALCYNVTDRLLSQHAPTVLFCLHLVYECEKLNYSFCRHFKNLAALNCSIACSIGARQYLDYYLQDNPDLMADIAQLPSLAQYILIPSDITATWNPQPPNWSEILFNLMGTQSPIPNNYRYPIIEDLSEMLIQLVKIWLVMFRPDTLLDNPTSELNRYFYRINFNMSGIPCRFPVHFCHDLNRANRNETLKIDDIYRRTATYLSEIKFHVNDLDFMNDGLASIFRIVFFHCNKFPELYSILHRADLDMQRQLILPIVQESAVPKVLTTPLKKFRSVSEPRRNCHAYWTNNVKPPMAMPKCLDFINRTDNNYLMHVLDSDPIVQLSYPDIRIHEAYKMIQSCCPIKLDAGICSNFTIEDGDTLSTPLKEELEGYLKIINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGKFSLSESGKPQTIESNASTKVWPNFHNGVAAGLMIAPMNESVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPPMDVELTSVTAGFSVGLIMFQQGHIFDREHNPEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYMNSMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKAFLIKPTGIQEKYLDTVNDSYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINIKSNIELMPNVNRNHYDWALSTLLLSACMISAGSGNLTLLRISRYLQSIHHPKDCGNYGVFMTYXXXXXXXXXXXXXXXXXNSHRSAAILVIAFFPRFPPTYNGRRYHLQSLRHLYVIATRPRVMCAVDLDTMIAVPVESRVVFKDHSIRHHSRCFVFPAENPNTIEQVELFDKNNEYYPQIYKSNTEPWNILYQSYQSGGYILVKKQKPEINIQEIFDKLEIDCNHRFHGYQLVDHDLLDTFINKTNDFQFYPSGMILNGKIIHFLEAYSHDLKRIFLRLRSGLDVEDFNQFFAFNQWCHENGFMKIWMVFSFIYRSSICAVRAVQSGDFNQLPDDYKYFIENIS 5650
            MIGPRSIYQQKPLGKNILQEKRELKNSGFQTKYLKSNIKNEFTIVRNVSNQQMELYVNGCDAVLHNFAAQDSNHMFTGFTETPIKCASFVRLSSKVSTNATYESIFQELNDFDPKGVILFTDRIAKYYGFDADIHSCTLPCKVSSAWKFRECLFVEREEMNNFHDYSPNSLFVMLHTLAEFTPVVFKDEFGNCGFINDTRFRIVSVCESSFLLLAYDKTDDSFSLWRIRDATQNDFSDLYDMHWDGSIAVKKQKLKSNFISGRSRMESSINHTNFNDNSHISSEYFEISTDVINNSVRTVEDLDIRSPIARSLKNTKDCQIPDKMTLLNETNNCLKIHPSYRQMIEPLYPKVCLDFLFSCKAGNVEPTLDGSYADYHSTPN YNSQK TANQSKNGKVFGFFSEDFYRRKYLCCLKETNA NHSILKIVKFNYENDTFCNLEEKSWPVLDAVYLERLQFTIVLELGSTLSIYSGMTFVCKISLLNALVYQPDDPFDDVGMEMSISDINSM RLSDPTDYGFTIHTQSELALRLYLPEMVRLHVVKKCLSVLKKLLPIDTGMTMLCRWYSLNRAVDNNESASAEWRRFVEFLLENMGFARNRQNKAGQQQTQQETHSIVQDVKELCLDNNNGHGIASSSADTDVSMDEICSKKLRTNSGLYSIERRCLNERDGLE+YSALCYNVTDRLLSQHAPTVLFCLHLVYECEKLNYSFCRHFKNLAALNCSIACSIGARQYLDYYLQDNPDL+ADIAQLPSLAQYILIPSDITATWNPQPPNWSEILFNLMGTQSPIPNNYRYPIIEDLSEMLIQLVKIWLVMFRPDTLLDNPTSELNRYFYRINFNMSGIPCRFPVHFCHDLNRANRNETLKIDDIYRRTATYLSEIKFHVNDLDFMNDGLASIFRIVFFHCNKFPELYSILHRADLDMQRQLILPIVQESAVPKVLTTPLKKFRSVSEPRRNCHAYWTNNVKPPMAMPKCLDFINRTDNNYLMHVLDSDPIVQLSYPDIRIHEAYKMIQSCCPIKLDAGICSNFTIEDGDTLSTPLKEELEGYLKIINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGKF+LSESGKPQTIESNASTKVWPNFHNGVAAGLMIAPMNESVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPPMDVELTSVTAGFSVGLIMFQQGHIF+REHNPEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYM+SMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKAFLIKPTGIQEKYLDTVNDSYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINIKSNIELMPNVNRNHYDWALSTLLLSACMISAGSGNLTLLRISRYLQSIHHPKDCGNYGVFMTYSLSIGLLFLGGGKLTLSNSHRSAAILVIAFFPRFPPTYNGRRYHLQSLRHLYVIATRPRVMCAVDLDTMIAVPVESRVVFKDHSIRHHSRCFVFPAENPNTIEQVELFDKNNEYYPQIYKSNTEPWNILYQSYQSGGYILVKKQKPEINIQEIFDKLEIDCNHRFHGYQLVDHDLLDTFINKTNDFQFYPSGMILNGKIIHFLEA+S+DLKRIFLRLRSGLDVEDFNQFFAFNQWCHENGFMKIWMVFSFIYRSSICAVRAVQSGDFNQLPDDYKYFI+NIS
Sbjct:    1 MIGPRSIYQQKPLGKNILQEKRELKNSGFQTKYLKSNIKNEFTIVRNVSNQQMELYVNGCDAVLHNFAAQDSNHMFTGFTETPIKCASFVRLSSKVSTNATYESIFQELNDFDPKGVILFTDRIAKYYGFDADIHSCTLPCKVSSAWKFRECLFVEREEMNNFHDYSPNSLFVMLHTLAEFTPVVFKDEFGNCGFINDTRFRIVSVCESSFLLLAYDKTDDSFSLWRIRDATQNDFSDLYDMHWDGSIAVKKQKLKSNFISGRSRMESSINHTNFNDNSHISSEYFEISTDVINNSVRTVEDLDIRSPIARSLKNTKDCQIPDKMTLLNETNNCLKIHPSYRQMIEPLYPKVCLDFLFSCKAGNVEPTLDGSYADYHSTPNEYNSQKATANQSKNGKVFGFFSEDFYRRKYLCCLKETNAANHSILKIVKFNYENDTFCNLEEKSWPVLDAVYLERLQFTIVLELGSTLSIYSGMTFVCKISLLNALVYQPDDPFDDVGMEMSISDINSMIRLSDPTDYGFTIHTQSELALRLYLPEMVRLHVVKKCLSVLKKLLPIDTGMTMLCRWYSLNRAVDNNESASAEWRRFVEFLLENMGFARNRQNKAGQQQTQQETHSIVQDVKELCLDNNNGHGIASSSADTDVSMDEICSKKLRTNSGLYSIERRCLNERDGLEDYSALCYNVTDRLLSQHAPTVLFCLHLVYECEKLNYSFCRHFKNLAALNCSIACSIGARQYLDYYLQDNPDLVADIAQLPSLAQYILIPSDITATWNPQPPNWSEILFNLMGTQSPIPNNYRYPIIEDLSEMLIQLVKIWLVMFRPDTLLDNPTSELNRYFYRINFNMSGIPCRFPVHFCHDLNRANRNETLKIDDIYRRTATYLSEIKFHVNDLDFMNDGLASIFRIVFFHCNKFPELYSILHRADLDMQRQLILPIVQESAVPKVLTTPLKKFRSVSEPRRNCHAYWTNNVKPPMAMPKCLDFINRTDNNYLMHVLDSDPIVQLSYPDIRIHEAYKMIQSCCPIKLDAGICSNFTIEDGDTLSTPLKEELEGYLKIINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGKFNLSESGKPQTIESNASTKVWPNFHNGVAAGLMIAPMNESVDGVWILKQCPSMNLDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGLSAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLNFKSADRKMARIFLEEMGRSREHLSVEGTPPMDVELTSVTAGFSVGLIMFQQGHIFNREHNPEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAILKNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIYMDSMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDWVESTIPQFVSSKAFLIKPTGIQEKYLDTVNDSYLQMLVGSCFVMGLRYAGTDNDNARLAIVTYIERLINIKSNIELMPNVNRNHYDWALSTLLLSACMISAGSGNLTLLRISRYLQSIHHPKDCGNYGVFMTYSLSIGLLFLGGGKLTLSNSHRSAAILVIAFFPRFPPTYNGRRYHLQSLRHLYVIATRPRVMCAVDLDTMIAVPVESRVVFKDHSIRHHSRCFVFPAENPNTIEQVELFDKNNEYYPQIYKSNTEPWNILYQSYQSGGYILVKKQKPEINIQEIFDKLEIDCNHRFHGYQLVDHDLLDTFINKTNDFQFYPSGMILNGKIIHFLEAHSNDLKRIFLRLRSGLDVEDFNQFFAFNQWCHENGFMKIWMVFSFIYRSSICAVRAVQSGDFNQLPDDYKYFIQNIS 1861          
The following BLAST results are available for this feature:
BLAST of anaphase-promoting complex subunit 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ANAPC16.552e-9427.05anaphase promoting complex subunit 1 [Source:HGNC ... [more]
ANAPC13.334e-9326.92anaphase promoting complex subunit 1 [Source:HGNC ... [more]
back to top
BLAST of anaphase-promoting complex subunit 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mat-22.108e-4226.09Anaphase-promoting complex subunit 1 [Source:UniP... [more]
back to top
BLAST of anaphase-promoting complex subunit 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
shtd1.984e-8231.34gene:FBgn0004391 transcript:FBtr0074077[more]
back to top
BLAST of anaphase-promoting complex subunit 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
anapc13.989e-7529.00anaphase promoting complex subunit 1 [Source:ZFIN;... [more]
anapc15.699e-7529.26anaphase promoting complex subunit 1 [Source:ZFIN;... [more]
anapc16.759e-7529.26anaphase promoting complex subunit 1 [Source:ZFIN;... [more]
anapc11.517e-7329.26anaphase promoting complex subunit 1 [Source:ZFIN;... [more]
anapc18.300e-722.92anaphase promoting complex subunit 1 [Source:ZFIN;... [more]
back to top
BLAST of anaphase-promoting complex subunit 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crip25.460e-10224.66cysteine-rich protein 2 [Source:Xenbase;Acc:XB-GEN... [more]
crip27.380e-10224.49cysteine-rich protein 2 [Source:Xenbase;Acc:XB-GEN... [more]
crip22.332e-10124.49cysteine-rich protein 2 [Source:Xenbase;Acc:XB-GEN... [more]
crip22.938e-10124.80cysteine-rich protein 2 [Source:Xenbase;Acc:XB-GEN... [more]
crip28.388e-10124.59cysteine-rich protein 2 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of anaphase-promoting complex subunit 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Anapc11.288e-9825.92anaphase promoting complex subunit 1 [Source:MGI S... [more]
Anapc11.970e-3823.29anaphase promoting complex subunit 1 [Source:MGI S... [more]
back to top
BLAST of anaphase-promoting complex subunit 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P53995|APC1_MOUSE9.011e-9825.92Anaphase-promoting complex subunit 1 OS=Mus muscul... [more]
sp|Q9H1A4|APC1_HUMAN1.601e-9226.92Anaphase-promoting complex subunit 1 OS=Homo sapie... [more]
sp|Q9FFF9|APC1_ARATH1.215e-5831.27Anaphase-promoting complex subunit 1 OS=Arabidopsi... [more]
sp|P24686|BIME_EMENI1.429e-5227.14Negative regulator of mitosis OS=Emericella nidula... [more]
sp|Q9URV2|APC1_SCHPO6.407e-4927.66Anaphase-promoting complex subunit 1 OS=Schizosacc... [more]
back to top
BLAST of anaphase-promoting complex subunit 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0JJH94.718e-10425.75anaphase-promoting complex subunit 1 OS=Diaphorina... [more]
A0A1S3ICG92.092e-10124.97anaphase-promoting complex subunit 1 OS=Lingula un... [more]
A0A2Y9RVD32.905e-10123.93anaphase-promoting complex subunit 1 isoform X1 OS... [more]
A0A3Q2TZ079.906e-10125.42Anaphase promoting complex subunit 1 OS=Gallus gal... [more]
A0A3Q2U7I11.410e-9825.30Anaphase promoting complex subunit 1 OS=Gallus gal... [more]
back to top
BLAST of anaphase-promoting complex subunit 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
anapc16.047e-7531.98anaphase promoting complex subunit 1 [Source:ZFIN;... [more]
back to top
BLAST of anaphase-promoting complex subunit 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000007291.19.368e-6830.53pep scaffold:Pmarinus_7.0:GL476479:97265:137320:-1... [more]
ENSPMAT00000007301.11.337e-6730.78pep scaffold:Pmarinus_7.0:GL476479:103938:135367:-... [more]
ENSPMAT00000007288.11.506e-6730.77pep scaffold:Pmarinus_7.0:GL476479:97265:137320:-1... [more]
back to top
BLAST of anaphase-promoting complex subunit 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
APC11.119e-1424.46Largest subunit of the Anaphase-Promoting Complex/... [more]
back to top
BLAST of anaphase-promoting complex subunit 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO402013.127e-7429.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of anaphase-promoting complex subunit 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
anapc15.011e-7631.80anaphase promoting complex subunit 1 [Source:NCBI ... [more]
back to top
BLAST of anaphase-promoting complex subunit 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000012375.10.000e+099.36SMESG000012375.1[more]
SMESG000012375.10.000e+099.36SMESG000012375.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022963 ID=SMED30022963|Name=anaphase-promoting complex subunit 1|organism=Schmidtea mediterranea sexual|type=transcript|length=5663bp
CTATATAAATCTTATATGCAATAATAGCTAATTTTTAGAAGATTTATGAT
ATCTGATGAATATTAAAATGATTGGTCCGCGTAGTATTTATCAACAAAAA
CCTTTGGGTAAAAATATTTTGCAAGAAAAGCGTGAACTGAAAAATAGCGG
TTTTCAAACAAAATATTTAAAAAGCAATATCAAAAATGAATTTACAATTG
TTCGAAATGTTTCAAATCAGCAAATGGAGTTATATGTCAATGGATGTGAC
GCTGTTTTACACAATTTCGCTGCTCAGGACAGTAATCACATGTTTACTGG
TTTCACCGAAACACCAATAAAATGTGCTTCGTTTGTTCGATTGTCAAGTA
AAGTTTCGACAAACGCTACTTACGAGTCTATATTTCAAGAATTAAATGAT
TTCGATCCGAAAGGAGTGATTTTATTTACAGATAGAATTGCTAAATATTA
TGGATTTGATGCTGACATCCACAGTTGCACATTACCATGCAAAGTAAGCA
GTGCTTGGAAGTTCAGAGAATGTTTATTTGTGGAACGAGAAGAAATGAAT
AACTTCCATGATTATTCCCCAAATTCATTATTCGTAATGTTACACACACT
TGCTGAATTTACTCCAGTTGTATTTAAAGACGAATTTGGAAATTGTGGAT
TTATTAATGACACTCGTTTCCGAATCGTGTCTGTCTGTGAATCGTCATTT
CTCCTGTTGGCATATGACAAAACCGACGATTCATTTTCGCTATGGAGAAT
CCGAGATGCAACTCAAAATGATTTCTCGGATTTGTATGATATGCATTGGG
ACGGATCAATTGCAGTGAAGAAGCAAAAATTAAAATCAAACTTCATTAGT
GGTCGATCTCGAATGGAATCATCAATAAATCACACCAATTTTAATGACAA
CTCCCACATCTCATCCGAATATTTTGAAATTAGTACTGATGTAATCAATA
ATAGTGTGCGCACAGTTGAAGACCTTGACATCCGTAGCCCAATAGCGAGG
TCATTGAAGAATACAAAAGACTGCCAAATCCCTGATAAAATGACTCTGCT
GAACGAGACAAATAACTGCCTGAAAATACACCCATCCTACCGCCAGATGA
TCGAACCACTCTATCCGAAAGTCTGCCTGGATTTCCTGTTTTCCTGTAAA
GCGGGCAATGTCGAGCCCACATTAGATGGGAGCTATGCTGACTACCACAG
CACTCCCAATGCGTACAACAGCCAAAAAGATACCGCCAACCAATCAAAAA
ACGGAAAGGTTTTCGGATTTTTCTCCGAAGATTTCTACCGCCGGAAATAC
CTGTGCTGCCTGAAGGAAACAAACGCAGGAAATCATTCGATCCTGAAGAT
TGTTAAATTCAACTATGAAAACGACACATTCTGCAATCTCGAGGAAAAGA
GCTGGCCTGTGCTTGATGCGGTCTATCTGGAGCGGCTACAGTTCACAATT
GTGCTGGAGCTCGGCAGCACCCTCTCGATCTATTCCGGGATGACATTCGT
GTGCAAGATATCCCTCCTGAACGCACTTGTCTACCAGCCGGATGATCCGT
TCGATGATGTCGGCATGGAGATGTCGATCAGCGACATCAACTCCATGAAC
CGACTCTCAGATCCGACCGATTACGGATTCACCATTCACACTCAGTCCGA
GCTCGCACTGAGACTGTATCTGCCGGAAATGGTCCGTTTGCACGTCGTCA
AGAAATGCTTATCGGTGCTGAAGAAATTGCTGCCGATCGATACGGGGATG
ACGATGTTGTGCCGGTGGTATTCACTGAACCGGGCCGTAGACAACAATGA
GTCGGCATCTGCGGAATGGCGGCGATTCGTTGAGTTTCTGTTGGAAAATA
TGGGATTCGCAAGGAACCGACAGAACAAAGCTGGACAGCAGCAGACTCAA
CAGGAAACCCACTCAATCGTACAGGATGTGAAGGAATTATGTCTGGATAA
TAACAACGGCCATGGAATCGCCTCCTCATCGGCCGATACCGATGTGAGCA
TGGATGAGATATGCAGCAAGAAATTGCGCACGAATTCCGGATTGTATTCC
ATTGAACGGAGGTGCCTGAATGAGCGTGACGGATTGGAGGAGTATTCAGC
GCTGTGTTACAATGTCACGGACCGATTACTGTCCCAGCATGCTCCGACAG
TTCTGTTCTGTCTCCATCTCGTCTATGAATGCGAAAAGCTCAACTATTCC
TTTTGTCGGCATTTCAAAAATTTAGCTGCCCTCAATTGCTCTATTGCTTG
TTCGATTGGCGCCAGACAATATCTGGACTATTACCTGCAGGACAATCCAG
ATTTGATGGCCGATATCGCCCAGTTACCCTCGCTAGCCCAATACATCTTG
ATCCCATCCGATATCACAGCGACCTGGAATCCCCAGCCGCCTAACTGGAG
CGAAATCTTATTCAACCTCATGGGCACCCAATCACCGATACCCAATAATT
ATCGCTATCCAATAATTGAAGATCTCAGTGAAATGCTGATCCAACTCGTC
AAGATATGGCTCGTTATGTTCCGGCCCGACACTCTGCTAGACAATCCCAC
CTCGGAATTGAATCGATATTTCTATCGGATCAATTTTAACATGTCCGGTA
TTCCGTGCCGGTTTCCCGTCCATTTCTGCCATGATCTCAACCGGGCCAAT
AGAAATGAAACATTGAAAATCGATGACATCTACCGACGTACAGCCACATA
TCTGAGCGAGATCAAGTTCCATGTAAACGATCTCGATTTCATGAACGATG
GATTGGCGTCCATATTTAGGATCGTATTCTTTCATTGCAACAAGTTCCCC
GAGCTGTATTCGATCCTCCACCGTGCCGATCTCGACATGCAACGGCAATT
GATCCTACCTATCGTCCAGGAATCTGCAGTTCCAAAAGTATTGACAACTC
CGTTGAAGAAGTTCCGATCAGTTAGTGAGCCCCGCCGGAACTGCCATGCC
TATTGGACCAATAACGTGAAGCCGCCAATGGCGATGCCGAAATGTTTGGA
TTTTATCAACCGGACTGACAACAACTACCTTATGCATGTTCTGGATTCCG
ATCCGATCGTCCAGCTGAGCTATCCGGATATCAGGATCCATGAAGCATAC
AAAATGATCCAATCCTGCTGTCCGATCAAGCTCGATGCCGGTATCTGCAG
CAATTTCACCATCGAGGATGGCGACACCCTCTCGACACCTCTGAAAGAGG
AACTGGAAGGCTACCTGAAAATTATCAACTGCCAACGAACGTTCTCACTG
CCTATTGGTCGAGGCATGCTGGGACTGCAAATCGTCCAATCGAATTGGCT
GACAGACAAATTACCGGTGCCGTTGCTTTGTCTGACCGGAAAATTCAGCC
TCTCGGAATCTGGCAAGCCGCAAACCATAGAAAGCAATGCATCGACAAAG
GTCTGGCCGAACTTCCACAATGGTGTCGCGGCGGGGCTGATGATCGCGCC
GATGAATGAGTCGGTCGACGGAGTATGGATCCTTAAGCAGTGCCCGTCAA
TGAATCTCGATCGGATCGAGCTGTCAGCAGAACAAGCCGGTGTTCTGTAT
GGGCTGGGATTGAATGGCCACCTGAATAAGCTGAGTGACGACACGATCGG
ACAAGCCATAAAATCGATGAATGAAATGGCTACAATGGCGTTGCTGATCG
GATTGAGTGCATTCAACATCGGCTCAAAGAATTCCATGCTATCAAAGCAC
ATCTCATTCCATTACCGACGGCTGATCCCCGGCGAGAAAGATCAAATCGA
TCCGATTCCGACTTTGTGCCAAGTGTCGGCTATAATCTCAGCGGGATTGC
TGAATTTCAAATCGGCCGACCGTAAAATGGCGCGGATATTCCTCGAGGAG
ATGGGCCGGTCTCGGGAGCATCTATCAGTGGAGGGCACGCCGCCAATGGA
TGTCGAGCTGACCTCGGTAACGGCCGGGTTCAGTGTCGGGCTGATCATGT
TCCAGCAAGGCCACATATTCGATCGGGAACACAATCCCGAGGAGCTGGTC
CGATTGTTGAGCTACCTCAAGGGCAGTTATCGGATCCAACCGAAGGACGG
CAGCGGGTGCTGCTCGAATGAGGTACCGAATGACCTGCAGATCAGAGCGA
TCCTGAAAAACAACGACATGAAGAAATCTCAGCCGATATCGGAAGCCGAC
AGCTGGAATGCATTCCAAACGAAAAATCCCCGAGTGCAGGAGGGTGAGTA
TTACAATACCGATATCACCGGTTCCGGGGCGGCAATAGCGATCGGGCTGA
TCTATATGAACTCCATGAGCACGATCATTGCCAACCATCTCGAGTGTCCG
GAAACCTTCTATCTGTTGGAGAAGATCCGATCACCGATCCTCTGCTTCCG
GCAGATTGCCCGCGGCCTCATCATGTGGCGTCAGGTGCAGCCCTCGATCG
ATTGGGTCGAGTCCACAATCCCGCAATTCGTTTCCTCAAAGGCATTCCTT
ATCAAGCCAACTGGAATCCAAGAGAAATATCTCGACACTGTCAATGACAG
CTATTTGCAAATGCTGGTTGGCTCGTGCTTTGTGATGGGTCTCCGGTACG
CCGGGACTGACAATGATAATGCCAGACTCGCAATTGTGACTTATATCGAG
AGATTGATAAACATCAAATCGAACATTGAACTAATGCCAAACGTCAACCG
GAATCATTACGATTGGGCGTTGTCGACATTATTGCTGTCTGCATGCATGA
TCTCTGCCGGTAGCGGCAATCTCACCCTGCTGCGAATATCTCGTTACCTG
CAATCGATACACCACCCGAAAGACTGCGGGAATTACGGTGTATTTATGAC
CTATTCATTATCGATCGGCCTTCTATTTCTCGGTGGCGGAAAACTGACGC
TGTCAAATTCCCACCGGTCTGCAGCGATACTAGTCATCGCATTCTTCCCG
AGGTTCCCACCGACATATAACGGACGCAGGTACCACCTGCAGTCGCTGCG
CCACCTCTATGTCATAGCAACGAGGCCCCGAGTCATGTGTGCCGTTGACC
TCGACACCATGATTGCTGTCCCCGTCGAGTCGAGAGTCGTATTCAAAGAT
CACAGCATCAGGCACCACAGCAGATGCTTTGTGTTTCCCGCTGAAAATCC
CAACACAATAGAACAGGTAGAATTGTTCGACAAGAACAATGAGTATTATC
CACAGATCTACAAATCCAACACTGAGCCGTGGAACATTCTCTACCAATCA
TATCAGAGCGGAGGTTACATTTTGGTGAAGAAACAAAAACCAGAAATCAA
TATTCAAGAAATATTTGACAAACTCGAGATCGACTGCAATCACCGATTCC
ATGGTTACCAGTTGGTGGATCACGACCTGTTGGACACATTCATTAACAAA
ACCAATGATTTTCAATTTTATCCTAGCGGAATGATTTTAAATGGCAAAAT
TATCCACTTCCTGGAGGCTTATTCTCACGATTTGAAGCGGATTTTCCTCA
GGCTCCGTTCCGGGTTGGATGTGGAGGATTTCAATCAGTTCTTTGCATTT
AATCAATGGTGCCACGAGAACGGCTTCATGAAGATCTGGATGGTGTTCTC
GTTCATTTATCGATCATCGATCTGTGCGGTTAGGGCGGTCCAGTCAGGTG
ATTTCAATCAGTTGCCTGATGATTATAAATATTTTATTGAAAATATTTCA
TAATAAATTTCGC
back to top

protein sequence of SMED30022963-orf-1

>SMED30022963-orf-1 ID=SMED30022963-orf-1|Name=SMED30022963-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1866bp
MNIKMIGPRSIYQQKPLGKNILQEKRELKNSGFQTKYLKSNIKNEFTIVR
NVSNQQMELYVNGCDAVLHNFAAQDSNHMFTGFTETPIKCASFVRLSSKV
STNATYESIFQELNDFDPKGVILFTDRIAKYYGFDADIHSCTLPCKVSSA
WKFRECLFVEREEMNNFHDYSPNSLFVMLHTLAEFTPVVFKDEFGNCGFI
NDTRFRIVSVCESSFLLLAYDKTDDSFSLWRIRDATQNDFSDLYDMHWDG
SIAVKKQKLKSNFISGRSRMESSINHTNFNDNSHISSEYFEISTDVINNS
VRTVEDLDIRSPIARSLKNTKDCQIPDKMTLLNETNNCLKIHPSYRQMIE
PLYPKVCLDFLFSCKAGNVEPTLDGSYADYHSTPNAYNSQKDTANQSKNG
KVFGFFSEDFYRRKYLCCLKETNAGNHSILKIVKFNYENDTFCNLEEKSW
PVLDAVYLERLQFTIVLELGSTLSIYSGMTFVCKISLLNALVYQPDDPFD
DVGMEMSISDINSMNRLSDPTDYGFTIHTQSELALRLYLPEMVRLHVVKK
CLSVLKKLLPIDTGMTMLCRWYSLNRAVDNNESASAEWRRFVEFLLENMG
FARNRQNKAGQQQTQQETHSIVQDVKELCLDNNNGHGIASSSADTDVSMD
EICSKKLRTNSGLYSIERRCLNERDGLEEYSALCYNVTDRLLSQHAPTVL
FCLHLVYECEKLNYSFCRHFKNLAALNCSIACSIGARQYLDYYLQDNPDL
MADIAQLPSLAQYILIPSDITATWNPQPPNWSEILFNLMGTQSPIPNNYR
YPIIEDLSEMLIQLVKIWLVMFRPDTLLDNPTSELNRYFYRINFNMSGIP
CRFPVHFCHDLNRANRNETLKIDDIYRRTATYLSEIKFHVNDLDFMNDGL
ASIFRIVFFHCNKFPELYSILHRADLDMQRQLILPIVQESAVPKVLTTPL
KKFRSVSEPRRNCHAYWTNNVKPPMAMPKCLDFINRTDNNYLMHVLDSDP
IVQLSYPDIRIHEAYKMIQSCCPIKLDAGICSNFTIEDGDTLSTPLKEEL
EGYLKIINCQRTFSLPIGRGMLGLQIVQSNWLTDKLPVPLLCLTGKFSLS
ESGKPQTIESNASTKVWPNFHNGVAAGLMIAPMNESVDGVWILKQCPSMN
LDRIELSAEQAGVLYGLGLNGHLNKLSDDTIGQAIKSMNEMATMALLIGL
SAFNIGSKNSMLSKHISFHYRRLIPGEKDQIDPIPTLCQVSAIISAGLLN
FKSADRKMARIFLEEMGRSREHLSVEGTPPMDVELTSVTAGFSVGLIMFQ
QGHIFDREHNPEELVRLLSYLKGSYRIQPKDGSGCCSNEVPNDLQIRAIL
KNNDMKKSQPISEADSWNAFQTKNPRVQEGEYYNTDITGSGAAIAIGLIY
MNSMSTIIANHLECPETFYLLEKIRSPILCFRQIARGLIMWRQVQPSIDW
VESTIPQFVSSKAFLIKPTGIQEKYLDTVNDSYLQMLVGSCFVMGLRYAG
TDNDNARLAIVTYIERLINIKSNIELMPNVNRNHYDWALSTLLLSACMIS
AGSGNLTLLRISRYLQSIHHPKDCGNYGVFMTYSLSIGLLFLGGGKLTLS
NSHRSAAILVIAFFPRFPPTYNGRRYHLQSLRHLYVIATRPRVMCAVDLD
TMIAVPVESRVVFKDHSIRHHSRCFVFPAENPNTIEQVELFDKNNEYYPQ
IYKSNTEPWNILYQSYQSGGYILVKKQKPEINIQEIFDKLEIDCNHRFHG
YQLVDHDLLDTFINKTNDFQFYPSGMILNGKIIHFLEAYSHDLKRIFLRL
RSGLDVEDFNQFFAFNQWCHENGFMKIWMVFSFIYRSSICAVRAVQSGDF
NQLPDDYKYFIENIS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000062esophagus
PLANA:0000081pharynx pouch
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR024990Apc1
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005680anaphase-promoting complex
GO:0005829cytosol
Vocabulary: biological process
TermDefinition
GO:0007049cell cycle
GO:0007067mitotic nuclear division
GO:0016567protein ubiquitination
GO:0031145anaphase-promoting complex-dependent catabolic process
GO:0042787protein ubiquitination involved in ubiquitin-dependent protein catabolic process
GO:0043161proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0051301cell division
GO:0051436negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle
GO:0051437positive regulation of ubiquitin-protein ligase activity involved in regulation of mitotic cell cycle transition
GO:0051439regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle
GO:0070979protein K11-linked ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR024990Anaphase-promoting complex subunit 1PANTHERPTHR12827MEIOTIC CHECKPOINT REGULATOR TSG24 FAMILY MEMBERcoord: 36..1727