V-type proton ATPase subunit

Overview
NameV-type proton ATPase subunit
Smed IDSMED30022961
Length (bp)1574
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of V-type proton ATPase subunit (SMED30022961) t-SNE clustered cells

Violin plots show distribution of expression levels for V-type proton ATPase subunit (SMED30022961) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of V-type proton ATPase subunit (SMED30022961) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for V-type proton ATPase subunit (SMED30022961) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022961

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30022961SMESG000049488.1 Contig5406GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30022961SMESG000057004.1 Contig5406GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30022961SMESG000057004.1 dd_Smed_v4_1976_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30022961SMESG000057004.1 dd_Smed_v4_1976_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022961SMESG000057004.1 dd_Smed_v4_1976_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of V-type proton ATPase subunit vs. Ensembl Human
Match: ATP6V0D1 (ATPase H+ transporting V0 subunit d1 [Source:HGNC Symbol;Acc:HGNC:13724])

HSP 1 Score: 556.599 bits (1433), Expect = 0.000e+0
Identity = 256/346 (73.99%), Postives = 303/346 (87.57%), Query Frame = 2
Query:   71 EYLFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTG-NDKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINIL 1105
            E  FN+D+GYLEGLVRG K G++ Q DY NLVQC+TLEDLKLHLQSTDYGNFLANE  PL+VS+I+++++EK+V+EF+H+RN + EPLA+FLD+ITYSYMIDN++LLITGTLH R I EL+ KCHPLGSFEQMEA++I+ TPAELYNA+LVDTPLA +F DCISEQDLDE+NIEIIRNTLY+AY+E FY FC LLGGTTA+ MC IL FEADRR+FIITINSF TEL+KEDRA L+P CG+LYPEGLA LARADDYEQVK VADYY EYK +FEG G+   DK+LED+FFEHEVK+N  +F+ QFHFGVFY+ +KLKEQE RNIVWIAEC++QRHR KID+YI I 
Sbjct:    6 ELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF 351          
BLAST of V-type proton ATPase subunit vs. Ensembl Human
Match: ATP6V0D1 (ATPase H+ transporting V0 subunit d1 [Source:HGNC Symbol;Acc:HGNC:13724])

HSP 1 Score: 536.954 bits (1382), Expect = 0.000e+0
Identity = 256/387 (66.15%), Postives = 303/387 (78.29%), Query Frame = 2
Query:   71 EYLFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYIT-----------------------------------------YSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTG-NDKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINIL 1105
            E  FN+D+GYLEGLVRG K G++ Q DY NLVQC+TLEDLKLHLQSTDYGNFLANE  PL+VS+I+++++EK+V+EF+H+RN + EPLA+FLD+IT                                         YSYMIDN++LLITGTLH R I EL+ KCHPLGSFEQMEA++I+ TPAELYNA+LVDTPLA +F DCISEQDLDE+NIEIIRNTLY+AY+E FY FC LLGGTTA+ MC IL FEADRR+FIITINSF TEL+KEDRA L+P CG+LYPEGLA LARADDYEQVK VADYY EYK +FEG G+   DK+LED+FFEHEVK+N  +F+ QFHFGVFY+ +KLKEQE RNIVWIAEC++QRHR KID+YI I 
Sbjct:    6 ELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITQESEAGTPEGPGNMPKLGSRPSPGHRPPFLRVSLLPWPPSSYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF 392          
BLAST of V-type proton ATPase subunit vs. Ensembl Human
Match: ATP6V0D2 (ATPase H+ transporting V0 subunit d2 [Source:HGNC Symbol;Acc:HGNC:18266])

HSP 1 Score: 477.633 bits (1228), Expect = 8.138e-167
Identity = 218/345 (63.19%), Postives = 282/345 (81.74%), Query Frame = 2
Query:   71 EYLFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTGNDKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINIL 1105
            E  FN+D GYLEGLVRG K  ++ Q DY NLVQC+TLEDLK+HLQ+TDYGNFLAN   PL+VS I+ ++R++L  EF++ RN S+EPL+TFL Y+T SYMIDN++LL+ G L  + + E++ KCHPLG F +MEA++I+ TP++L+NA+L++TPLAP+F DC+SE  LDELNIE++RN LY++Y+E FY FCK  G  TAE+MC IL FEADRR+FIIT+NSF TEL+KEDR  LYP  GKLYPEGL +LA+A+D++Q+K VAD+Y  YK +FE VG    K+LED F+E EV+MNV +F +QFH+GVFY+ +KLKEQE+RNIVWIAEC+SQRHRTKI+SYI IL
Sbjct:    6 ELYFNVDHGYLEGLVRGCKASLLTQQDYINLVQCETLEDLKIHLQTTDYGNFLANHTNPLTVSKIDTEMRKRLCGEFEYFRNHSLEPLSTFLTYMTCSYMIDNVILLMNGALQKKSVKEILGKCHPLGRFTEMEAVNIAETPSDLFNAILIETPLAPFFQDCMSENALDELNIELLRNKLYKSYLEAFYKFCKNHGDVTAEVMCPILEFEADRRAFIITLNSFGTELSKEDRETLYPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQMNVLAFNRQFHYGVFYAYVKLKEQEIRNIVWIAECISQRHRTKINSYIPIL 350          
BLAST of V-type proton ATPase subunit vs. Ensembl Human
Match: ATP6V0D1 (ATPase H+ transporting V0 subunit d1 [Source:HGNC Symbol;Acc:HGNC:13724])

HSP 1 Score: 444.121 bits (1141), Expect = 6.618e-155
Identity = 205/274 (74.82%), Postives = 240/274 (87.59%), Query Frame = 2
Query:  287 LVLEFQHIRNQSVEPLATFLDYITYSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTG-NDKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINIL 1105
            +V+EF+H+RN + EPLA+FLD+ITYSYMIDN++LLITGTLH R I EL+ KCHPLGSFEQMEA++I+ TPAELYNA+LVDTPLA +F DCISEQDLDE+NIEIIRNTLY+AY+E FY FC LLGGTTA+ MC IL FEADRR+FIITINSF TEL+KEDRA L+P CG+LYPEGLA LARADDYEQVK VADYY EYK +FEG G+   DK+LED+FFEHEVK+N  +F+ QFHFGVFY+ +KLKEQE RNIVWIAEC++QRHR KID+YI I 
Sbjct:    1 MVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF 274          
BLAST of V-type proton ATPase subunit vs. Ensembl Human
Match: ATP6V0D1 (ATPase H+ transporting V0 subunit d1 [Source:HGNC Symbol;Acc:HGNC:13724])

HSP 1 Score: 309.686 bits (792), Expect = 9.541e-103
Identity = 147/206 (71.36%), Postives = 171/206 (83.01%), Query Frame = 2
Query:  491 TPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTG-NDKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINIL 1105
            + A+  N V  +T  A +F DCISEQDLDE+NIEIIRNTLY+AY+E FY FC LLGGTTA+ MC IL FEADRR+FIITINSF TEL+KEDRA L+P CG+LYPEGLA LARADDYEQVK VADYY EYK +FEG G+   DK+LED+FFEHEVK+N  +F+ QFHFGVFY+ +KLKEQE RNIVWIAEC++QRHR KID+YI I 
Sbjct:   27 SQADYLNLVQCETLEAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF 232          

HSP 2 Score: 60.4622 bits (145), Expect = 9.331e-10
Identity = 26/38 (68.42%), Postives = 31/38 (81.58%), Query Frame = 2
Query:   71 EYLFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLE 184
            E  FN+D+GYLEGLVRG K G++ Q DY NLVQC+TLE
Sbjct:    4 ELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLE 41          
BLAST of V-type proton ATPase subunit vs. Ensembl Celegans
Match: vha-16 (V-type proton ATPase subunit [Source:UniProtKB/TrEMBL;Acc:Q95YD5])

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 264/346 (76.30%), Postives = 312/346 (90.17%), Query Frame = 2
Query:   71 EYLFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTG-NDKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINIL 1105
            E+LFNID GYLE L RG KGG++ Q DY NLVQC+TLEDLKLH+QSTDYGNFLANEPG ++V +I+EK++EKLV EF H+RN ++EPLATFLDYITYSYMIDNI+LLITGTLH RPI+ELI KCHPLGSFEQMEA+HI+STPAELYNAVLVDTPLA YF+DCI+EQDLDE+N+E+IRNTLY+AYIEDFY FC  LGG TAE+MC+ILAFEADRRS IITINSFDTEL+K+DR  LYP+CGKL+P+GL  L+RADDY+QVK V ++YS+YK +FEG G G  +K+LEDKFFEHEVK+NV+S++ QFHFGVFY+ IKLKEQEMRNI+WIAEC+SQRHRTKID+YI I+
Sbjct:    3 EFLFNIDHGYLEALTRGLKGGLLAQADYANLVQCETLEDLKLHIQSTDYGNFLANEPGAITVQVIDEKLKEKLVTEFTHLRNNALEPLATFLDYITYSYMIDNIILLITGTLHQRPISELINKCHPLGSFEQMEAIHIASTPAELYNAVLVDTPLANYFVDCINEQDLDEMNVEVIRNTLYKAYIEDFYKFCAGLGGKTAEVMCDILAFEADRRSIIITINSFDTELSKDDRQKLYPRCGKLFPDGLTGLSRADDYDQVKQVCEFYSDYKPLFEGSGNGPGEKTLEDKFFEHEVKLNVHSYLHQFHFGVFYAFIKLKEQEMRNIIWIAECISQRHRTKIDNYIPIM 348          
BLAST of V-type proton ATPase subunit vs. Ensembl Celegans
Match: vha-16 (V-type proton ATPase subunit [Source:UniProtKB/TrEMBL;Acc:Q95YD5])

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 264/346 (76.30%), Postives = 312/346 (90.17%), Query Frame = 2
Query:   71 EYLFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTG-NDKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINIL 1105
            E+LFNID GYLE L RG KGG++ Q DY NLVQC+TLEDLKLH+QSTDYGNFLANEPG ++V +I+EK++EKLV EF H+RN ++EPLATFLDYITYSYMIDNI+LLITGTLH RPI+ELI KCHPLGSFEQMEA+HI+STPAELYNAVLVDTPLA YF+DCI+EQDLDE+N+E+IRNTLY+AYIEDFY FC  LGG TAE+MC+ILAFEADRRS IITINSFDTEL+K+DR  LYP+CGKL+P+GL  L+RADDY+QVK V ++YS+YK +FEG G G  +K+LEDKFFEHEVK+NV+S++ QFHFGVFY+ IKLKEQEMRNI+WIAEC+SQRHRTKID+YI I+
Sbjct:    3 EFLFNIDHGYLEALTRGLKGGLLAQADYANLVQCETLEDLKLHIQSTDYGNFLANEPGAITVQVIDEKLKEKLVTEFTHLRNNALEPLATFLDYITYSYMIDNIILLITGTLHQRPISELINKCHPLGSFEQMEAIHIASTPAELYNAVLVDTPLANYFVDCINEQDLDEMNVEVIRNTLYKAYIEDFYKFCAGLGGKTAEVMCDILAFEADRRSIIITINSFDTELSKDDRQKLYPRCGKLFPDGLTGLSRADDYDQVKQVCEFYSDYKPLFEGSGNGPGEKTLEDKFFEHEVKLNVHSYLHQFHFGVFYAFIKLKEQEMRNIIWIAECISQRHRTKIDNYIPIM 348          
BLAST of V-type proton ATPase subunit vs. Ensembl Celegans
Match: vha-16 (V-type proton ATPase subunit [Source:UniProtKB/TrEMBL;Acc:Q95YD5])

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 264/346 (76.30%), Postives = 312/346 (90.17%), Query Frame = 2
Query:   71 EYLFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTG-NDKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINIL 1105
            E+LFNID GYLE L RG KGG++ Q DY NLVQC+TLEDLKLH+QSTDYGNFLANEPG ++V +I+EK++EKLV EF H+RN ++EPLATFLDYITYSYMIDNI+LLITGTLH RPI+ELI KCHPLGSFEQMEA+HI+STPAELYNAVLVDTPLA YF+DCI+EQDLDE+N+E+IRNTLY+AYIEDFY FC  LGG TAE+MC+ILAFEADRRS IITINSFDTEL+K+DR  LYP+CGKL+P+GL  L+RADDY+QVK V ++YS+YK +FEG G G  +K+LEDKFFEHEVK+NV+S++ QFHFGVFY+ IKLKEQEMRNI+WIAEC+SQRHRTKID+YI I+
Sbjct:    3 EFLFNIDHGYLEALTRGLKGGLLAQADYANLVQCETLEDLKLHIQSTDYGNFLANEPGAITVQVIDEKLKEKLVTEFTHLRNNALEPLATFLDYITYSYMIDNIILLITGTLHQRPISELINKCHPLGSFEQMEAIHIASTPAELYNAVLVDTPLANYFVDCINEQDLDEMNVEVIRNTLYKAYIEDFYKFCAGLGGKTAEVMCDILAFEADRRSIIITINSFDTELSKDDRQKLYPRCGKLFPDGLTGLSRADDYDQVKQVCEFYSDYKPLFEGSGNGPGEKTLEDKFFEHEVKLNVHSYLHQFHFGVFYAFIKLKEQEMRNIIWIAECISQRHRTKIDNYIPIM 348          
BLAST of V-type proton ATPase subunit vs. Ensembl Fly
Match: VhaAC39-1 (gene:FBgn0285910 transcript:FBtr0070611)

HSP 1 Score: 577.785 bits (1488), Expect = 0.000e+0
Identity = 266/348 (76.44%), Postives = 313/348 (89.94%), Query Frame = 2
Query:   65 SMEYLFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTG-NDKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINIL 1105
            S  ++FNID+GYLEGL RGFK GI+KQ DY NLVQC+TLEDLKLHLQ TDYG+FLANEP PLSVS+I++K+REKLV+EFQH+RN +VEPL+ FLD+ITY YMIDNI+LLITGTLH RPI+ELI KCHPLGSFEQMEA+H++STPAELYNAVLVDTPLAP+F+DCISEQDLDE+NIEIIRNTLY+AY+E FY FCK +GG TA++MCEILAFEADRR+ IITINSF TEL+K+DRA LYP CGK+YP+GLA LARADDYEQVK VA+YY+EY A+F+G G    DK+LEDKFFEHEVK++V +F+QQFHFGVFY+ +KLKEQE RNIVWIAECV+Q+HR KID+YI I 
Sbjct:    3 SSGFMFNIDNGYLEGLCRGFKCGILKQADYLNLVQCETLEDLKLHLQGTDYGSFLANEPSPLSVSVIDDKLREKLVIEFQHMRNHAVEPLSNFLDFITYGYMIDNIILLITGTLHQRPISELIPKCHPLGSFEQMEAIHVASTPAELYNAVLVDTPLAPFFVDCISEQDLDEMNIEIIRNTLYKAYLEAFYNFCKNMGGATADVMCEILAFEADRRAIIITINSFGTELSKDDRAKLYPNCGKMYPDGLAALARADDYEQVKTVAEYYAEYAALFDGSGNNPGDKTLEDKFFEHEVKLDVYAFLQQFHFGVFYAYLKLKEQECRNIVWIAECVAQKHRAKIDNYIPIF 350          
BLAST of V-type proton ATPase subunit vs. Ensembl Fly
Match: VhaAC39-2 (gene:FBgn0039058 transcript:FBtr0084401)

HSP 1 Score: 332.028 bits (850), Expect = 4.790e-110
Identity = 149/347 (42.94%), Postives = 235/347 (67.72%), Query Frame = 2
Query:   68 MEYLFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTGNDK--SLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINI 1102
            M  +FN + GYLE L RGFK G++K +DY NL QC++LED+ + +Q TDYG     E    SV +IE  +R++L+ ++ +IR+ S EPL TF+++I Y +MIDN+ LL+ G  + R +  L+  CHPLG F+Q+ A+ ++S  AEL++AVL+DTP+A +    +  + L  L++EI+R  LYRAY+E FY +C  LGG TA +M  +L+FEADRR+  I +N+  +++  ++R  ++P CG L    LA ++  +D ++++ V + +  Y  +F+ +   +D   +LED+F   E K NV +F+QQ+HFG+FYS IKLK+ E+RNIVWI+EC++QR   +I+++I I
Sbjct:    1 MSMIFNTEYGYLEALTRGFKNGMLKHSDYLNLTQCESLEDVMISIQGTDYGLIFGGEQSAPSVEVIERCLRDRLLQQYYYIRSHSTEPLTTFMEFIRYPFMIDNVALLVAGLNNHRSMKRLLRMCHPLGEFDQLGAIEVASNSAELFDAVLIDTPIARFVPRDLPMESLRYLDVEIVRAHLYRAYLEKFYAYCSQLGGNTANVMTNLLSFEADRRTITIAVNAIGSDIIPKERLKMFPTCGYLPKIALASMSTLNDTDKIRDVCNVFDGYGKMFDNLERDSDGMITLEDRFLMMEAKKNVQTFLQQYHFGIFYSFIKLKQLEVRNIVWISECIAQRQTDRINAFIPI 347          
BLAST of V-type proton ATPase subunit vs. Ensembl Zebrafish
Match: atp6v0d1 (ATPase H+ transporting V0 subunit d1 [Source:NCBI gene;Acc:322811])

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 258/346 (74.57%), Postives = 305/346 (88.15%), Query Frame = 2
Query:   71 EYLFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTG-NDKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINIL 1105
            E  FN+D+GYLEGLVRGFK GI+ Q DY NLVQC+TLEDLKLHLQSTDYG+FLANE  PL+VS+I++K++EK+V+EF+H+RNQS EPLA+F+D+ITYSYMIDN++LLITGTLH R I+EL+ KCHPLGSFEQMEA++I+ TPAELYNA+LVDTPLA +F DCISEQDLDE+NIEIIRNTLY+AY+E FY FC  LGGTTA+ MC IL FEADRR+FIITINSF TEL+KEDRA L+P CGKLYPEGLA LARADDYEQVKAVA+YY EYK +FEG G+   DK+LED+FFEHEVK+N  +F+ QFHF VFY+ +KLKEQE RNIVWIAEC++QRHR KID+YI I 
Sbjct:    5 ELYFNVDNGYLEGLVRGFKAGILSQADYLNLVQCETLEDLKLHLQSTDYGSFLANEASPLTVSVIDDKLKEKMVVEFRHMRNQSYEPLASFMDFITYSYMIDNVILLITGTLHQRAISELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLEAFYKFCTTLGGTTADTMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGKLYPEGLAQLARADDYEQVKAVAEYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFSVFYAYVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF 350          
BLAST of V-type proton ATPase subunit vs. Ensembl Zebrafish
Match: atp6v0d1 (ATPase H+ transporting V0 subunit d1 [Source:NCBI gene;Acc:322811])

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 258/346 (74.57%), Postives = 305/346 (88.15%), Query Frame = 2
Query:   71 EYLFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTG-NDKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINIL 1105
            E  FN+D+GYLEGLVRGFK GI+ Q DY NLVQC+TLEDLKLHLQSTDYG+FLANE  PL+VS+I++K++EK+V+EF+H+RNQS EPLA+F+D+ITYSYMIDN++LLITGTLH R I+EL+ KCHPLGSFEQMEA++I+ TPAELYNA+LVDTPLA +F DCISEQDLDE+NIEIIRNTLY+AY+E FY FC  LGGTTA+ MC IL FEADRR+FIITINSF TEL+KEDRA L+P CGKLYPEGLA LARADDYEQVKAVA+YY EYK +FEG G+   DK+LED+FFEHEVK+N  +F+ QFHF VFY+ +KLKEQE RNIVWIAEC++QRHR KID+YI I 
Sbjct:    5 ELYFNVDNGYLEGLVRGFKAGILSQADYLNLVQCETLEDLKLHLQSTDYGSFLANEASPLTVSVIDDKLKEKMVVEFRHMRNQSYEPLASFMDFITYSYMIDNVILLITGTLHQRAISELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLEAFYKFCTTLGGTTADTMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGKLYPEGLAQLARADDYEQVKAVAEYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFSVFYAYVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF 350          
BLAST of V-type proton ATPase subunit vs. Ensembl Zebrafish
Match: atp6v0d1 (ATPase H+ transporting V0 subunit d1 [Source:NCBI gene;Acc:322811])

HSP 1 Score: 156.762 bits (395), Expect = 2.442e-45
Identity = 70/99 (70.71%), Postives = 88/99 (88.89%), Query Frame = 2
Query:   71 EYLFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSY 367
            E  FN+D+GYLEGLVRGFK GI+ Q DY NLVQC+TLEDLKLHLQSTDYG+FLANE  PL+VS+I++K++EK+V+EF+H+RNQS EPLA+F+D+IT  Y
Sbjct:    5 ELYFNVDNGYLEGLVRGFKAGILSQADYLNLVQCETLEDLKLHLQSTDYGSFLANEASPLTVSVIDDKLKEKMVVEFRHMRNQSYEPLASFMDFITVFY 103          

HSP 2 Score: 66.6254 bits (161), Expect = 9.478e-13
Identity = 28/38 (73.68%), Postives = 33/38 (86.84%), Query Frame = 2
Query:  992 VFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINIL 1105
            VFY+ +KLKEQE RNIVWIAEC++QRHR KID+YI I 
Sbjct:  101 VFYAYVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF 138          
BLAST of V-type proton ATPase subunit vs. Ensembl Zebrafish
Match: atp6v0d1 (ATPase H+ transporting V0 subunit d1 [Source:NCBI gene;Acc:322811])

HSP 1 Score: 156.762 bits (395), Expect = 2.442e-45
Identity = 70/99 (70.71%), Postives = 88/99 (88.89%), Query Frame = 2
Query:   71 EYLFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSY 367
            E  FN+D+GYLEGLVRGFK GI+ Q DY NLVQC+TLEDLKLHLQSTDYG+FLANE  PL+VS+I++K++EK+V+EF+H+RNQS EPLA+F+D+IT  Y
Sbjct:    5 ELYFNVDNGYLEGLVRGFKAGILSQADYLNLVQCETLEDLKLHLQSTDYGSFLANEASPLTVSVIDDKLKEKMVVEFRHMRNQSYEPLASFMDFITVFY 103          

HSP 2 Score: 66.6254 bits (161), Expect = 9.478e-13
Identity = 28/38 (73.68%), Postives = 33/38 (86.84%), Query Frame = 2
Query:  992 VFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINIL 1105
            VFY+ +KLKEQE RNIVWIAEC++QRHR KID+YI I 
Sbjct:  101 VFYAYVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF 138          
BLAST of V-type proton ATPase subunit vs. Ensembl Xenopus
Match: nkiras2 (NFKB inhibitor interacting Ras like 2 [Source:Xenbase;Acc:XB-GENE-482359])

HSP 1 Score: 561.607 bits (1446), Expect = 0.000e+0
Identity = 260/346 (75.14%), Postives = 303/346 (87.57%), Query Frame = 2
Query:   71 EYLFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTG-NDKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINIL 1105
            E  FN+DSGYLEGLVRGFK GI+ Q DY NLVQC+TLEDLKLHLQSTDYG FLANE  PL+VS+I++K++EK+V+EF+H+RNQS EPLA+F+D+ITYSYMIDN++LLITGTLH R I+EL+ KCHPLGSFEQMEA++I+ TPAELYNA+LVDTPLA +F DCISEQDLDE+NIEIIRNTLY+AY+E FY FC  LGGTTA+ MC IL FEADRR+FIITINSF TEL+KEDRA L+P CGKLYPEGLA LARADDYEQVK VADYY EYK +FEG G    DK+LED+FFEHEVK+N  +F+ QFHFGVFY+ +KLKEQE RNIVWIAEC++QRHR KID+YI I 
Sbjct:    6 ELYFNVDSGYLEGLVRGFKAGILSQGDYLNLVQCETLEDLKLHLQSTDYGTFLANEASPLAVSVIDDKLKEKMVVEFRHMRNQSYEPLASFMDFITYSYMIDNVILLITGTLHQRSISELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCDSLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGKLYPEGLAQLARADDYEQVKTVADYYPEYKLLFEGAGNNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF 351          
BLAST of V-type proton ATPase subunit vs. Ensembl Xenopus
Match: nkiras2 (NFKB inhibitor interacting Ras like 2 [Source:Xenbase;Acc:XB-GENE-482359])

HSP 1 Score: 560.066 bits (1442), Expect = 0.000e+0
Identity = 259/343 (75.51%), Postives = 302/343 (88.05%), Query Frame = 2
Query:   80 FNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTG-NDKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINIL 1105
            FN+DSGYLEGLVRGFK GI+ Q DY NLVQC+TLEDLKLHLQSTDYG FLANE  PL+VS+I++K++EK+V+EF+H+RNQS EPLA+F+D+ITYSYMIDN++LLITGTLH R I+EL+ KCHPLGSFEQMEA++I+ TPAELYNA+LVDTPLA +F DCISEQDLDE+NIEIIRNTLY+AY+E FY FC  LGGTTA+ MC IL FEADRR+FIITINSF TEL+KEDRA L+P CGKLYPEGLA LARADDYEQVK VADYY EYK +FEG G    DK+LED+FFEHEVK+N  +F+ QFHFGVFY+ +KLKEQE RNIVWIAEC++QRHR KID+YI I 
Sbjct:   10 FNVDSGYLEGLVRGFKAGILSQGDYLNLVQCETLEDLKLHLQSTDYGTFLANEASPLAVSVIDDKLKEKMVVEFRHMRNQSYEPLASFMDFITYSYMIDNVILLITGTLHQRSISELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCDSLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGKLYPEGLAQLARADDYEQVKTVADYYPEYKLLFEGAGNNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF 352          
BLAST of V-type proton ATPase subunit vs. Ensembl Xenopus
Match: kcna10 (potassium channel, voltage gated shaker related subfamily A, member 10 [Source:Xenbase;Acc:XB-GENE-991589])

HSP 1 Score: 541.962 bits (1395), Expect = 0.000e+0
Identity = 250/348 (71.84%), Postives = 302/348 (86.78%), Query Frame = 2
Query:   65 SMEYLFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTGN-DKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINIL 1105
            + E+ FN+DSGYLEGLVRGFKGGI++  DY NL QC+TLEDLKLHLQSTDYG+FLANE   L+VSII++++++KL+ EF + RN + EPLATFLD+ITYSYMIDNI+LLITGTLH RPI+EL+ KCHPLGSFEQMEA++I+ TPAEL+NA++VDTPLA +F DC+SE D+DE+NIEI+RN LY++Y+E FY FCK LGGTT EIMC IL FEADRR+F+ITINSF TELNKE+R  LYP CG+L+PEGL ML  ADD +QVK  A+YY+EYKA+FEGVG G  +K+LEDKFFEHEVKMNV +F  QFHFGVFY+ +KLKEQE RNIVWIAEC+SQRHRTKI++YI IL
Sbjct:    3 NTEFYFNVDSGYLEGLVRGFKGGILRSTDYLNLAQCETLEDLKLHLQSTDYGSFLANETRQLTVSIIDQRLKDKLMAEFHYFRNHAFEPLATFLDFITYSYMIDNIILLITGTLHQRPISELVPKCHPLGSFEQMEAVNIAQTPAELFNAIIVDTPLADFFQDCLSENDMDEMNIEIMRNKLYKSYLEAFYKFCKKLGGTTEEIMCPILEFEADRRAFVITINSFGTELNKEEREKLYPTCGRLFPEGLRMLGNADDQDQVKTTAEYYAEYKALFEGVGIGTGEKTLEDKFFEHEVKMNVLAFNNQFHFGVFYAYVKLKEQECRNIVWIAECISQRHRTKINNYIPIL 350          
BLAST of V-type proton ATPase subunit vs. Ensembl Xenopus
Match: kcna10 (potassium channel, voltage gated shaker related subfamily A, member 10 [Source:Xenbase;Acc:XB-GENE-991589])

HSP 1 Score: 540.421 bits (1391), Expect = 0.000e+0
Identity = 249/345 (72.17%), Postives = 300/345 (86.96%), Query Frame = 2
Query:   74 YLFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTGN-DKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINIL 1105
            + FN+DSGYLEGLVRGFKGGI++  DY NL QC+TLEDLKLHLQSTDYG+FLANE   L+VSII++++++KL+ EF + RN + EPLATFLD+ITYSYMIDNI+LLITGTLH RPI+EL+ KCHPLGSFEQMEA++I+ TPAEL+NA++VDTPLA +F DC+SE D+DE+NIEI+RN LY++Y+E FY FCK LGGTT EIMC IL FEADRR+F+ITINSF TELNKE+R  LYP CG+L+PEGL ML  ADD +QVK  A+YY+EYKA+FEGVG G  +K+LEDKFFEHEVKMNV +F  QFHFGVFY+ +KLKEQE RNIVWIAEC+SQRHRTKI++YI IL
Sbjct:    7 FYFNVDSGYLEGLVRGFKGGILRSTDYLNLAQCETLEDLKLHLQSTDYGSFLANETRQLTVSIIDQRLKDKLMAEFHYFRNHAFEPLATFLDFITYSYMIDNIILLITGTLHQRPISELVPKCHPLGSFEQMEAVNIAQTPAELFNAIIVDTPLADFFQDCLSENDMDEMNIEIMRNKLYKSYLEAFYKFCKKLGGTTEEIMCPILEFEADRRAFVITINSFGTELNKEEREKLYPTCGRLFPEGLRMLGNADDQDQVKTTAEYYAEYKALFEGVGIGTGEKTLEDKFFEHEVKMNVLAFNNQFHFGVFYAYVKLKEQECRNIVWIAECISQRHRTKINNYIPIL 351          
BLAST of V-type proton ATPase subunit vs. Ensembl Xenopus
Match: kcna10 (potassium channel, voltage gated shaker related subfamily A, member 10 [Source:Xenbase;Acc:XB-GENE-991589])

HSP 1 Score: 540.036 bits (1390), Expect = 0.000e+0
Identity = 249/345 (72.17%), Postives = 300/345 (86.96%), Query Frame = 2
Query:   74 YLFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTGN-DKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINIL 1105
            + FN+DSGYLEGLVRGFKGGI++  DY NL QC+TLEDLKLHLQSTDYG+FLANE   L+VSII++++++KL+ EF + RN + EPLATFLD+ITYSYMIDNI+LLITGTLH RPI+EL+ KCHPLGSFEQMEA++I+ TPAEL+NA++VDTPLA +F DC+SE D+DE+NIEI+RN LY++Y+E FY FCK LGGTT EIMC IL FEADRR+F+ITINSF TELNKE+R  LYP CG+L+PEGL ML  ADD +QVK  A+YY+EYKA+FEGVG G  +K+LEDKFFEHEVKMNV +F  QFHFGVFY+ +KLKEQE RNIVWIAEC+SQRHRTKI++YI IL
Sbjct:    5 FYFNVDSGYLEGLVRGFKGGILRSTDYLNLAQCETLEDLKLHLQSTDYGSFLANETRQLTVSIIDQRLKDKLMAEFHYFRNHAFEPLATFLDFITYSYMIDNIILLITGTLHQRPISELVPKCHPLGSFEQMEAVNIAQTPAELFNAIIVDTPLADFFQDCLSENDMDEMNIEIMRNKLYKSYLEAFYKFCKKLGGTTEEIMCPILEFEADRRAFVITINSFGTELNKEEREKLYPTCGRLFPEGLRMLGNADDQDQVKTTAEYYAEYKALFEGVGIGTGEKTLEDKFFEHEVKMNVLAFNNQFHFGVFYAYVKLKEQECRNIVWIAECISQRHRTKINNYIPIL 349          
BLAST of V-type proton ATPase subunit vs. Ensembl Mouse
Match: Atp6v0d1 (ATPase, H+ transporting, lysosomal V0 subunit D1 [Source:MGI Symbol;Acc:MGI:1201778])

HSP 1 Score: 557.755 bits (1436), Expect = 0.000e+0
Identity = 257/346 (74.28%), Postives = 303/346 (87.57%), Query Frame = 2
Query:   71 EYLFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTG-NDKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINIL 1105
            E  FN+D+GYLEGLVRG K G++ Q DY NLVQC+TLEDLKLHLQSTDYGNFLANE  PL+VS+I++K++EK+V+EF+H+RN + EPLA+FLD+ITYSYMIDN++LLITGTLH R I EL+ KCHPLGSFEQMEA++I+ TPAELYNA+LVDTPLA +F DCISEQDLDE+NIEIIRNTLY+AY+E FY FC LLGGTTA+ MC IL FEADRR+FIITINSF TEL+KEDRA L+P CG+LYPEGLA LARADDYEQVK VADYY EYK +FEG G+   DK+LED+FFEHEVK+N  +F+ QFHFGVFY+ +KLKEQE RNIVWIAEC++QRHR KID+YI I 
Sbjct:    6 ELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDKLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF 351          
BLAST of V-type proton ATPase subunit vs. Ensembl Mouse
Match: Atp6v0d2 (ATPase, H+ transporting, lysosomal V0 subunit D2 [Source:MGI Symbol;Acc:MGI:1924415])

HSP 1 Score: 482.256 bits (1240), Expect = 8.285e-169
Identity = 221/348 (63.51%), Postives = 283/348 (81.32%), Query Frame = 2
Query:   62 KSMEYLFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTGNDKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINIL 1105
            ++ E  FN+D GYLEGLVRG K  ++ Q DY NLVQC+TLEDLK+HLQ+TDYGNFLANE  PL+VS I+ ++R+KL  EF + RN S+EPL+TFL Y+T SYMIDNI+LL+ G L  + + E++AKCHPLG F +MEA++I+ TP++L+ AVLV+TPLAP+F DC+SE  LDELNIE++RN LY++Y+E FY FCK  G  TA++MC IL FEADRR+ IIT+NSF TEL+KEDR  L+P CG+LYPEGL +LA+A+D+EQ+K VAD Y  YK +F+ VG    K+LED F+E EV+MNV +F +QFH+GVFY+ +KLKEQEMRNIVWIAEC+SQRHRTKI+SYI IL
Sbjct:    3 ETAELYFNVDHGYLEGLVRGCKASLLTQQDYVNLVQCETLEDLKIHLQTTDYGNFLANETNPLTVSKIDTEMRKKLCREFDYFRNHSLEPLSTFLTYMTCSYMIDNIILLMNGALQKKSVKEVLAKCHPLGRFTEMEAVNIAETPSDLFKAVLVETPLAPFFQDCMSENTLDELNIELLRNKLYKSYLEAFYKFCKDHGDVTADVMCPILEFEADRRALIITLNSFGTELSKEDRETLFPTCGRLYPEGLRLLAQAEDFEQMKRVADNYGVYKPLFDAVGGSGGKTLEDVFYEREVQMNVLAFNRQFHYGVFYAYVKLKEQEMRNIVWIAECISQRHRTKINSYIPIL 350          
BLAST of V-type proton ATPase subunit vs. Ensembl Mouse
Match: Atp6v0d2 (ATPase, H+ transporting, lysosomal V0 subunit D2 [Source:MGI Symbol;Acc:MGI:1924415])

HSP 1 Score: 51.9878 bits (123), Expect = 9.344e-9
Identity = 23/36 (63.89%), Postives = 29/36 (80.56%), Query Frame = 2
Query:  275 IREKLVLEFQHIRNQSVEPLATFLDYITYSYMIDNI 382
            +R+KL  EF + RN S+EPL+TFL Y+T SYMIDNI
Sbjct:    1 MRKKLCREFDYFRNHSLEPLSTFLTYMTCSYMIDNI 36          
BLAST of V-type proton ATPase subunit vs. UniProt/SwissProt
Match: sp|Q25531|VA0D_MANSE (V-type proton ATPase subunit d OS=Manduca sexta OX=7130 PE=2 SV=1)

HSP 1 Score: 583.948 bits (1504), Expect = 0.000e+0
Identity = 270/344 (78.49%), Postives = 314/344 (91.28%), Query Frame = 2
Query:   77 LFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTG-NDKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINIL 1105
            +FNID+GYLEGL RGFK GI+KQ+DY NLVQC+TLEDLKLHLQ TDYG FLANEP PLSVS I++K+REKLV+EFQH+RN SVEPL+TFLD+ITYSYMIDNI+LLITGTLH RPI+ELI KCHPLGSFEQMEA+H+++TPAELYNAVLVDTPLAP+F+DCISEQDLDE+NIEIIRNTLY+AY+E FY FCK +GGTTA++MCEILAFEADRR+ IITINSF TEL+K+DRA LYP+CGKL P+GLA LARADDYEQVKAVA+YY+EY A+FEG G    DK+LEDKFFEHEV +NV++F+QQFHFGVFYS +KLKEQE RNIVWI+ECV+Q+HR KID+YI I 
Sbjct:    5 IFNIDAGYLEGLCRGFKCGILKQSDYLNLVQCETLEDLKLHLQGTDYGTFLANEPSPLSVSTIDDKLREKLVIEFQHLRNHSVEPLSTFLDFITYSYMIDNIILLITGTLHQRPISELIPKCHPLGSFEQMEAIHVAATPAELYNAVLVDTPLAPFFVDCISEQDLDEMNIEIIRNTLYKAYLEAFYDFCKQIGGTTADVMCEILAFEADRRAIIITINSFGTELSKDDRAKLYPRCGKLNPDGLAALARADDYEQVKAVAEYYAEYSALFEGAGNNVGDKTLEDKFFEHEVNLNVHAFLQQFHFGVFYSYLKLKEQECRNIVWISECVAQKHRAKIDNYIPIF 348          
BLAST of V-type proton ATPase subunit vs. UniProt/SwissProt
Match: sp|Q9W4P5|VA0D1_DROME (V-type proton ATPase subunit d 1 OS=Drosophila melanogaster OX=7227 GN=VhaAC39-1 PE=2 SV=1)

HSP 1 Score: 577.785 bits (1488), Expect = 0.000e+0
Identity = 266/348 (76.44%), Postives = 313/348 (89.94%), Query Frame = 2
Query:   65 SMEYLFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTG-NDKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINIL 1105
            S  ++FNID+GYLEGL RGFK GI+KQ DY NLVQC+TLEDLKLHLQ TDYG+FLANEP PLSVS+I++K+REKLV+EFQH+RN +VEPL+ FLD+ITY YMIDNI+LLITGTLH RPI+ELI KCHPLGSFEQMEA+H++STPAELYNAVLVDTPLAP+F+DCISEQDLDE+NIEIIRNTLY+AY+E FY FCK +GG TA++MCEILAFEADRR+ IITINSF TEL+K+DRA LYP CGK+YP+GLA LARADDYEQVK VA+YY+EY A+F+G G    DK+LEDKFFEHEVK++V +F+QQFHFGVFY+ +KLKEQE RNIVWIAECV+Q+HR KID+YI I 
Sbjct:    3 SSGFMFNIDNGYLEGLCRGFKCGILKQADYLNLVQCETLEDLKLHLQGTDYGSFLANEPSPLSVSVIDDKLREKLVIEFQHMRNHAVEPLSNFLDFITYGYMIDNIILLITGTLHQRPISELIPKCHPLGSFEQMEAIHVASTPAELYNAVLVDTPLAPFFVDCISEQDLDEMNIEIIRNTLYKAYLEAFYNFCKNMGGATADVMCEILAFEADRRAIIITINSFGTELSKDDRAKLYPNCGKMYPDGLAALARADDYEQVKTVAEYYAEYAALFDGSGNNPGDKTLEDKFFEHEVKLDVYAFLQQFHFGVFYAYLKLKEQECRNIVWIAECVAQKHRAKIDNYIPIF 350          
BLAST of V-type proton ATPase subunit vs. UniProt/SwissProt
Match: sp|Q6PGV1|VA0D1_DANRE (V-type proton ATPase subunit d 1 OS=Danio rerio OX=7955 GN=atp6v0d1 PE=1 SV=1)

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 258/346 (74.57%), Postives = 305/346 (88.15%), Query Frame = 2
Query:   71 EYLFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTG-NDKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINIL 1105
            E  FN+D+GYLEGLVRGFK GI+ Q DY NLVQC+TLEDLKLHLQSTDYG+FLANE  PL+VS+I++K++EK+V+EF+H+RNQS EPLA+F+D+ITYSYMIDN++LLITGTLH R I+EL+ KCHPLGSFEQMEA++I+ TPAELYNA+LVDTPLA +F DCISEQDLDE+NIEIIRNTLY+AY+E FY FC  LGGTTA+ MC IL FEADRR+FIITINSF TEL+KEDRA L+P CGKLYPEGLA LARADDYEQVKAVA+YY EYK +FEG G+   DK+LED+FFEHEVK+N  +F+ QFHF VFY+ +KLKEQE RNIVWIAEC++QRHR KID+YI I 
Sbjct:    5 ELYFNVDNGYLEGLVRGFKAGILSQADYLNLVQCETLEDLKLHLQSTDYGSFLANEASPLTVSVIDDKLKEKMVVEFRHMRNQSYEPLASFMDFITYSYMIDNVILLITGTLHQRAISELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLEAFYKFCTTLGGTTADTMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGKLYPEGLAQLARADDYEQVKAVAEYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFSVFYAYVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF 350          
BLAST of V-type proton ATPase subunit vs. UniProt/SwissProt
Match: sp|P51863|VA0D1_MOUSE (V-type proton ATPase subunit d 1 OS=Mus musculus OX=10090 GN=Atp6v0d1 PE=1 SV=2)

HSP 1 Score: 557.755 bits (1436), Expect = 0.000e+0
Identity = 257/346 (74.28%), Postives = 303/346 (87.57%), Query Frame = 2
Query:   71 EYLFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTG-NDKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINIL 1105
            E  FN+D+GYLEGLVRG K G++ Q DY NLVQC+TLEDLKLHLQSTDYGNFLANE  PL+VS+I++K++EK+V+EF+H+RN + EPLA+FLD+ITYSYMIDN++LLITGTLH R I EL+ KCHPLGSFEQMEA++I+ TPAELYNA+LVDTPLA +F DCISEQDLDE+NIEIIRNTLY+AY+E FY FC LLGGTTA+ MC IL FEADRR+FIITINSF TEL+KEDRA L+P CG+LYPEGLA LARADDYEQVK VADYY EYK +FEG G+   DK+LED+FFEHEVK+N  +F+ QFHFGVFY+ +KLKEQE RNIVWIAEC++QRHR KID+YI I 
Sbjct:    6 ELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDKLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF 351          
BLAST of V-type proton ATPase subunit vs. UniProt/SwissProt
Match: sp|Q5R6I1|VA0D1_PONAB (V-type proton ATPase subunit d 1 OS=Pongo abelii OX=9601 GN=ATP6V0D1 PE=2 SV=1)

HSP 1 Score: 556.599 bits (1433), Expect = 0.000e+0
Identity = 256/346 (73.99%), Postives = 303/346 (87.57%), Query Frame = 2
Query:   71 EYLFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTG-NDKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINIL 1105
            E  FN+D+GYLEGLVRG K G++ Q DY NLVQC+TLEDLKLHLQSTDYGNFLANE  PL+VS+I+++++EK+V+EF+H+RN + EPLA+FLD+ITYSYMIDN++LLITGTLH R I EL+ KCHPLGSFEQMEA++I+ TPAELYNA+LVDTPLA +F DCISEQDLDE+NIEIIRNTLY+AY+E FY FC LLGGTTA+ MC IL FEADRR+FIITINSF TEL+KEDRA L+P CG+LYPEGLA LARADDYEQVK VADYY EYK +FEG G+   DK+LED+FFEHEVK+N  +F+ QFHFGVFY+ +KLKEQE RNIVWIAEC++QRHR KID+YI I 
Sbjct:    6 ELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF 351          
BLAST of V-type proton ATPase subunit vs. TrEMBL
Match: A0A1S3HXH1 (V-type proton ATPase subunit OS=Lingula unguis OX=7574 GN=LOC106158375 PE=3 SV=1)

HSP 1 Score: 593.578 bits (1529), Expect = 0.000e+0
Identity = 274/343 (79.88%), Postives = 315/343 (91.84%), Query Frame = 2
Query:   80 FNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTG-NDKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINIL 1105
            FNID+GYLEGLVRGFKGGI+ Q DY NLVQCDTL+DLKLHLQSTDYGNFLANEP PLSVS+I++K+++KLV+EFQH+RN +VEPL+TFLDYITYSYMIDNI+LLITGTLH R I+ELI KCHPLGSFEQMEA+H+++TPAELYNAVLVDTPLAPYFIDCISEQDLDE+NIEIIRNTLY+AY+EDF+ FCK +GGTTAE+MCE LAFEADRR+FIITINSF TEL+KEDRA LYP+CGKLYP+GLA L+RADDYEQV+AV++YY EYK +FEG GTG  +K+LEDKFFEHEVK+ +N FM QFHFGVFY  +KLKEQE RNI+WIAECV+QRHR KIDSYI I 
Sbjct:    6 FNIDNGYLEGLVRGFKGGILTQTDYLNLVQCDTLDDLKLHLQSTDYGNFLANEPSPLSVSVIDDKLKDKLVVEFQHMRNHAVEPLSTFLDYITYSYMIDNIILLITGTLHQRSISELIPKCHPLGSFEQMEAIHVAATPAELYNAVLVDTPLAPYFIDCISEQDLDEMNIEIIRNTLYKAYLEDFHKFCKEMGGTTAEVMCEALAFEADRRAFIITINSFGTELSKEDRAKLYPRCGKLYPDGLAALSRADDYEQVRAVSEYYGEYKLLFEGSGTGPGEKTLEDKFFEHEVKLMINGFMNQFHFGVFYGYVKLKEQECRNIIWIAECVAQRHRAKIDSYIPIF 348          
BLAST of V-type proton ATPase subunit vs. TrEMBL
Match: A0A3P8F307 (V-type proton ATPase subunit OS=Heligmosomoides polygyrus OX=6339 GN=HPBE_LOCUS19118 PE=3 SV=1)

HSP 1 Score: 590.112 bits (1520), Expect = 0.000e+0
Identity = 270/346 (78.03%), Postives = 316/346 (91.33%), Query Frame = 2
Query:   71 EYLFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTGN-DKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINIL 1105
            E+LFNID GYLE L+RGFKGG++ Q DY NLVQC+TLEDLKLH+QSTDYGNFLANEPG ++V +I+E+++EKLV EF H+RN S+EPLATFLDYITYSYMIDNI+LLITGTLH RPI+ELI+KCHPLGSFEQMEA+HI+STPAELYNAVLVDTPLA YF+DCI+EQDLDE+N+E+IRNTLY+AYIEDFY FCK LGGTTAE+MCEILAFEADRRS IITINSFDTEL+K+DR  LYP+CGKLYPEGL+ LARADDYEQVK V ++YS+YK +FEG G  + +K+LEDKFFEHEVK+NV S++ QFHFG FY+ IKLKEQEMRNI+WIAEC+SQRHRTKID+YI I+
Sbjct:    3 EFLFNIDHGYLEALIRGFKGGLLSQTDYANLVQCETLEDLKLHIQSTDYGNFLANEPGAITVQVIDERLKEKLVTEFTHLRNNSLEPLATFLDYITYSYMIDNIILLITGTLHQRPISELISKCHPLGSFEQMEAIHIASTPAELYNAVLVDTPLANYFVDCINEQDLDEMNVELIRNTLYKAYIEDFYKFCKQLGGTTAEVMCEILAFEADRRSIIITINSFDTELSKDDREKLYPRCGKLYPEGLSGLARADDYEQVKQVCEFYSDYKPLFEGAGNASGEKTLEDKFFEHEVKLNVQSYLHQFHFGAFYAFIKLKEQEMRNIIWIAECISQRHRTKIDNYIPIM 348          
BLAST of V-type proton ATPase subunit vs. TrEMBL
Match: A0A481SZ57 (V-type proton ATPase subunit OS=Thermobia domestica OX=89055 PE=2 SV=1)

HSP 1 Score: 589.726 bits (1519), Expect = 0.000e+0
Identity = 272/347 (78.39%), Postives = 316/347 (91.07%), Query Frame = 2
Query:   68 MEYLFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTG-NDKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINIL 1105
            M  +FNID+GYLEGL RGFK GI+ Q DY NLVQC+TLEDLKLHLQ TDYGNFLANEP PLSVS+I++K+REKLV+EFQH+RN +VEPL+TFLDYITYSYMIDNI+LLITGTLH RPI+ELI KCHPLGSFEQMEA+H+++TPAELYNAVLVDTPLAP+F+DCISEQDLDE+NIEIIRNTLY+AY+E FY FCK LGGTTA+ MCEILAFEADRR+ IITINSF TEL K+DRA LYP+CGKL+P+GLA LARADDYEQVKAVA+YY+EY+A+FEG G    +K+LEDKFFEHEV++NVN+F+QQFHFGVFYS +KLKEQE RNIVWI+ECV+Q+HR KID+YI I 
Sbjct:    2 MGCMFNIDAGYLEGLCRGFKCGILSQTDYLNLVQCETLEDLKLHLQGTDYGNFLANEPSPLSVSVIDDKLREKLVIEFQHLRNHAVEPLSTFLDYITYSYMIDNIILLITGTLHQRPISELIPKCHPLGSFEQMEAIHVAATPAELYNAVLVDTPLAPFFVDCISEQDLDEMNIEIIRNTLYKAYLEAFYDFCKKLGGTTADTMCEILAFEADRRAIIITINSFGTELTKDDRAKLYPRCGKLHPDGLAALARADDYEQVKAVAEYYAEYRALFEGAGNNPGEKTLEDKFFEHEVRLNVNAFLQQFHFGVFYSYLKLKEQECRNIVWISECVAQKHRAKIDNYIPIF 348          
BLAST of V-type proton ATPase subunit vs. TrEMBL
Match: A0A1I7ZYI6 (V-type proton ATPase subunit OS=Steinernema glaseri OX=37863 PE=3 SV=1)

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 273/346 (78.90%), Postives = 314/346 (90.75%), Query Frame = 2
Query:   71 EYLFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTG-NDKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINIL 1105
            E++FNID GYLE LVRGFK GI+  NDY NLVQC+TLEDLKLH+QSTDYGNFLANEPG ++V +I+E+++EKLV EF HIRN  +EPL+TFLDYITYSYMIDNI+LLITGTLH RPITELI+KCHPLGSFEQMEA+HI+STPAELYNAVLVDTPLAPYF+DCISEQDLDE+N+EIIRNTLY+AYIEDFY FCK LGG TA +MCEILAFEADRR+ IITINSFDTEL+K+DR+ LYP CGKLYPEGL  LARADDYEQVK V +YYS+YKA+FEG G    +K+LEDKFFEHEVK+NV++++ QFHFGVFY+ IKLKEQEMRNI+WIAEC+SQRHRTKID+YI IL
Sbjct:    3 EFMFNIDHGYLEALVRGFKTGILNSNDYANLVQCETLEDLKLHIQSTDYGNFLANEPGAITVQVIDERLKEKLVTEFTHIRNNCLEPLSTFLDYITYSYMIDNIILLITGTLHQRPITELISKCHPLGSFEQMEAIHIASTPAELYNAVLVDTPLAPYFVDCISEQDLDEMNVEIIRNTLYKAYIEDFYKFCKSLGGETAAVMCEILAFEADRRAIIITINSFDTELSKDDRSKLYPTCGKLYPEGLTGLARADDYEQVKQVCEYYSDYKALFEGSGINPGEKTLEDKFFEHEVKLNVHAYLHQFHFGVFYAFIKLKEQEMRNIIWIAECISQRHRTKIDNYIPIL 348          
BLAST of V-type proton ATPase subunit vs. TrEMBL
Match: A0A1J1HQJ3 (V-type proton ATPase subunit OS=Clunio marinus OX=568069 GN=CLUMA_CG003442 PE=3 SV=1)

HSP 1 Score: 588.571 bits (1516), Expect = 0.000e+0
Identity = 270/347 (77.81%), Postives = 318/347 (91.64%), Query Frame = 2
Query:   68 MEYLFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTG-NDKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINIL 1105
            M ++FNID GYLEGL RGFK GI+KQ+DY NLVQC+TLEDLKLHLQ TDYG FLANEP PL+VS+I++K+REKLV+EFQH+RN +VEPL+TFLD+ITYSYMIDNI+LLITGTLH RPI+ELI KCHPLGSFEQMEA+H+++TPAELYNAVLVDTPLAP+F+DCISEQDLDE+NIEIIRNTLY+AY+E FYGFCK LGGTTA++MCEILAFEADRR+ IITINSF TEL+K+DR  LYP+CG+++P+GLA LARADDYEQVKAV++YY+EY A+F+G G    DK+LEDKFFEHEVK+NV +FMQQFHFGVFYS +KLKEQE RNIVWIAECV+Q+HR KID+YI IL
Sbjct:    1 MGFMFNIDGGYLEGLCRGFKCGILKQSDYLNLVQCETLEDLKLHLQGTDYGQFLANEPSPLAVSVIDDKLREKLVIEFQHMRNHAVEPLSTFLDFITYSYMIDNIILLITGTLHQRPISELIPKCHPLGSFEQMEAIHVAATPAELYNAVLVDTPLAPFFVDCISEQDLDEMNIEIIRNTLYKAYLEAFYGFCKSLGGTTADVMCEILAFEADRRAIIITINSFGTELSKDDRQKLYPRCGRMFPDGLAALARADDYEQVKAVSEYYAEYAALFDGSGNNPGDKTLEDKFFEHEVKLNVYAFMQQFHFGVFYSYLKLKEQECRNIVWIAECVAQKHRAKIDNYIPIL 347          
BLAST of V-type proton ATPase subunit vs. Ensembl Cavefish
Match: atp6v0d1 (V-type proton ATPase subunit d 1 [Source:NCBI gene;Acc:103027194])

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 259/346 (74.86%), Postives = 305/346 (88.15%), Query Frame = 2
Query:   71 EYLFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTG-NDKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINIL 1105
            E  FN+D+GYLEGLVRGFK GI+ Q DY NLVQC+TLEDLKLHLQSTDYG+FLANE  PL+VS+I++K++EK+V+EF+H+RNQS EPLA+F+D+ITYSYMIDN++LLITGTLH R I+EL+ KCHPLGSFEQMEA++I+ TPAELYNA+LVDTPLA +F DCISEQDLDE+NIEIIRNTLY+AY+E FY FC  LGGTTA+ MC IL FEADRR+FIITINSF TEL+KEDRA L+P CGKLYPEGLA LARADDYEQVKAVADYY EYK +FEG G+   DK+LED+FFEHEVK+N  +F+ QFHF VFY+ +KLKEQE RNIVWIAEC++QRHR KID+YI I 
Sbjct:    5 ELYFNVDNGYLEGLVRGFKAGILSQGDYLNLVQCETLEDLKLHLQSTDYGSFLANEASPLTVSVIDDKLKEKMVVEFRHMRNQSYEPLASFMDFITYSYMIDNVILLITGTLHQRAISELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLEAFYKFCTNLGGTTADTMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGKLYPEGLAQLARADDYEQVKAVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFSVFYAYVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF 350          
BLAST of V-type proton ATPase subunit vs. Ensembl Sea Lamprey
Match: atp6v0d1 (ATPase H+ transporting V0 subunit d1 [Source:NCBI gene;Acc:322811])

HSP 1 Score: 564.688 bits (1454), Expect = 0.000e+0
Identity = 255/350 (72.86%), Postives = 311/350 (88.86%), Query Frame = 2
Query:   59 SKSMEYLFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTG-NDKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINIL 1105
            S+  E  FN+D GYLEGLVRGFK GI++Q DY NL+QC+TLEDLKLHLQSTDYG+FLANE  PL+VS+I++K++EK+V+EF+H+RN + EPLATFLDYITYSYMIDN++LLITGTLH RPI EL++KCHPLGSFEQMEA++I+ TPAELYNA+LVDTPLAP+F DCISEQDLDE+NIEIIRNTLY+AY+E FY FCK LGGTT ++MC IL FEADRR+F+ITINSF TEL+KEDRA L+P+CG+L+PEGL +L+RA+D EQVKAVADYY EYK +FEG G+G  DK+LED+FFEHEVK+N  +F+ QFHFGVFY+ +KLKEQE RN+VWI+EC++QRHR KID+YI I 
Sbjct:    2 SRFSELSFNVDHGYLEGLVRGFKSGILRQADYLNLIQCETLEDLKLHLQSTDYGHFLANEASPLAVSVIDDKLKEKMVIEFRHMRNHAFEPLATFLDYITYSYMIDNVILLITGTLHQRPIAELVSKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAPFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCKKLGGTTEDVMCPILEFEADRRAFVITINSFGTELSKEDRARLFPRCGRLFPEGLTLLSRAEDLEQVKAVADYYPEYKQLFEGAGSGPGDKTLEDRFFEHEVKLNSLAFINQFHFGVFYAYVKLKEQECRNVVWISECIAQRHRAKIDNYIAIF 351          
BLAST of V-type proton ATPase subunit vs. Ensembl Yeast
Match: VMA6 (Subunit d of the V0 integral membrane domain of V-ATPase; part of the electrogenic proton pump found in the endomembrane system; required for V1 domain assembly on the vacuolar membrane; the V0 integral membrane domain of vacuolar H+-ATPase (V-ATPase) has five subunits [Source:SGD;Acc:S000004439])

HSP 1 Score: 328.561 bits (841), Expect = 1.225e-109
Identity = 165/345 (47.83%), Postives = 234/345 (67.83%), Query Frame = 2
Query:   80 FNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLAN-EPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCI-SEQDLDELNIEIIRNTLYRAYIEDFYGF-CKLLGGTTAEIMCEILAFEADRRSFIITINSF-DTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTGNDKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINI 1102
            FNID+G++EG+VRG++ G++  N Y NL QCDTLEDLKL L STDYGNFL++     L+ S+I+E    KL  EF +IR+QS      F+DYITY YMIDN+ L+ITGT+HDR   E++ +CHPLG F+ +  L +++    LY  VLVDTPLAPYF +C  + ++LD++NIEIIRN LY+AY+EDFY F  + +     E M  +L FEADRRS  I +NS   ++++ + +++L P  GKLYP     LA+A D+E V+A      EY+   E   TGN   LED F++ E+++  ++F QQF     ++ +K KEQE+RNI WIAEC++Q  R +I++YI++
Sbjct:    6 FNIDNGFIEGVVRGYRNGLLSNNQYINLTQCDTLEDLKLQLSSTDYGNFLSSVSSESLTTSLIQEYASSKLYHEFNYIRDQSSGSTRKFMDYITYGYMIDNVALMITGTIHDRDKGEILQRCHPLGWFDTLPTLSVATDLESLYETVLVDTPLAPYFKNCFDTAEELDDMNIEIIRNKLYKAYLEDFYNFVTEEIPEPAKECMQTLLGFEADRRSINIALNSLQSSDIDPDLKSDLLPNIGKLYPLATFHLAQAQDFEGVRAALANVYEYRGFLE---TGN---LEDHFYQLEMELCRDAFTQQFAISTVWAWMKSKEQEVRNITWIAECIAQNQRERINNYISV 344          
BLAST of V-type proton ATPase subunit vs. Ensembl Nematostella
Match: EDO33897 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQT8])

HSP 1 Score: 561.607 bits (1446), Expect = 0.000e+0
Identity = 253/346 (73.12%), Postives = 315/346 (91.04%), Query Frame = 2
Query:   71 EYLFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTG-NDKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINIL 1105
            E  FN+DSGYLEGLVRGFK G++ Q+DY NLVQC+TLEDLKLHLQSTDYGNFLANE GPLSVS+I++++REKLV EF+H+RNQ++EPLATF+D+ITYSYMIDNI+LLITGTLH RPI ELI KCHPLGSFE+M +++I+STPA+LYNAV++DTPLAP+F++CISEQDLDE+NIEIIRNTLY+AY+E FY FC  LGG TA++MC IL FEADRR+FIITINSF TEL+K+DR  L+P+CGKLYP+GL+ L++ADDY+QV+A+ADYYS+YK +FEG GTG  +K+LEDKFFEHEVK+N+ +F+QQFHFGVFY+ +KLKEQE RNIVWIAEC++Q++++KID+YI I 
Sbjct:    6 ELFFNVDSGYLEGLVRGFKSGVLTQSDYLNLVQCETLEDLKLHLQSTDYGNFLANEAGPLSVSVIDDRLREKLVEEFRHLRNQALEPLATFMDFITYSYMIDNIILLITGTLHQRPIQELIPKCHPLGSFEEMASINIASTPADLYNAVMIDTPLAPFFVECISEQDLDEMNIEIIRNTLYKAYLEGFYKFCSELGGATADVMCPILQFEADRRAFIITINSFGTELSKDDRQKLFPQCGKLYPDGLSRLSKADDYDQVRAIADYYSDYKVLFEGSGTGPGEKTLEDKFFEHEVKLNMLAFLQQFHFGVFYAYVKLKEQECRNIVWIAECIAQKNKSKIDNYIPIF 351          
BLAST of V-type proton ATPase subunit vs. Ensembl Nematostella
Match: EDO35904 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK71])

HSP 1 Score: 91.2781 bits (225), Expect = 1.134e-19
Identity = 38/52 (73.08%), Postives = 46/52 (88.46%), Query Frame = 2
Query:  536 APYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEIL 691
            AP+F++CISEQDLDE+NIEIIRNTLY+AY+E FY FC  LGG TA++MC IL
Sbjct:  129 APFFVECISEQDLDEMNIEIIRNTLYKAYLEGFYKFCSELGGATADVMCPIL 180          
BLAST of V-type proton ATPase subunit vs. Ensembl Medaka
Match: atp6v0d1 (V-type proton ATPase subunit d 1 [Source:NCBI gene;Acc:101158573])

HSP 1 Score: 557.755 bits (1436), Expect = 0.000e+0
Identity = 258/346 (74.57%), Postives = 305/346 (88.15%), Query Frame = 2
Query:   71 EYLFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTG-NDKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINIL 1105
            E  FN+D+GYLEGLVRGFK GI+ Q DY NLVQC+TLEDLKLHLQSTDYG+FLANE  PL+VS+I++K++EK+V+EF+H+RNQS EPLA+F+D+ITYSYMIDN++LLITGTLH R I+EL+ KCHPLGSFEQMEA++I+ TPAELYNA+LVDTPLA +F DCISEQDLDE+NIEIIRNTLY+AY+E FY FC  LGGTTA+ MC IL FEADRR+FIITINSF TEL+KEDRA L+P CGKLYPEGLA LARADDYEQVKAVAD+Y EYK +FEG G+   DK+LED+FFEHEVK+N  +F+ QFHF VFY+ +KLKEQE RNIVWIAEC++QRHR KID+YI I 
Sbjct:    5 ELYFNVDNGYLEGLVRGFKAGILSQADYLNLVQCETLEDLKLHLQSTDYGSFLANEASPLTVSVIDDKLKEKMVVEFRHMRNQSYEPLASFMDFITYSYMIDNVILLITGTLHQRAISELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLEAFYKFCSNLGGTTADTMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGKLYPEGLAQLARADDYEQVKAVADFYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFSVFYAYVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF 350          
BLAST of V-type proton ATPase subunit vs. Planmine SMEST
Match: SMESG000057004.1 (SMESG000057004.1)

HSP 1 Score: 716.842 bits (1849), Expect = 0.000e+0
Identity = 347/347 (100.00%), Postives = 347/347 (100.00%), Query Frame = 2
Query:   68 MEYLFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTGNDKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINILN 1108
            MEYLFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTGNDKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINILN
Sbjct:    1 MEYLFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDYGNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSYMIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAVLVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTTAEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAMLARADDYEQVKAVADYYSEYKAIFEGVGTGNDKSLEDKFFEHEVKMNVNSFMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINILN 347          
The following BLAST results are available for this feature:
BLAST of V-type proton ATPase subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP6V0D10.000e+073.99ATPase H+ transporting V0 subunit d1 [Source:HGNC ... [more]
ATP6V0D10.000e+066.15ATPase H+ transporting V0 subunit d1 [Source:HGNC ... [more]
ATP6V0D28.138e-16763.19ATPase H+ transporting V0 subunit d2 [Source:HGNC ... [more]
ATP6V0D16.618e-15574.82ATPase H+ transporting V0 subunit d1 [Source:HGNC ... [more]
ATP6V0D19.541e-10371.36ATPase H+ transporting V0 subunit d1 [Source:HGNC ... [more]
back to top
BLAST of V-type proton ATPase subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
vha-160.000e+076.30V-type proton ATPase subunit [Source:UniProtKB/Tr... [more]
vha-160.000e+076.30V-type proton ATPase subunit [Source:UniProtKB/Tr... [more]
vha-160.000e+076.30V-type proton ATPase subunit [Source:UniProtKB/Tr... [more]
back to top
BLAST of V-type proton ATPase subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
VhaAC39-10.000e+076.44gene:FBgn0285910 transcript:FBtr0070611[more]
VhaAC39-24.790e-11042.94gene:FBgn0039058 transcript:FBtr0084401[more]
back to top
BLAST of V-type proton ATPase subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
atp6v0d10.000e+074.57ATPase H+ transporting V0 subunit d1 [Source:NCBI ... [more]
atp6v0d10.000e+074.57ATPase H+ transporting V0 subunit d1 [Source:NCBI ... [more]
atp6v0d12.442e-4570.71ATPase H+ transporting V0 subunit d1 [Source:NCBI ... [more]
atp6v0d12.442e-4570.71ATPase H+ transporting V0 subunit d1 [Source:NCBI ... [more]
back to top
BLAST of V-type proton ATPase subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nkiras20.000e+075.14NFKB inhibitor interacting Ras like 2 [Source:Xenb... [more]
nkiras20.000e+075.51NFKB inhibitor interacting Ras like 2 [Source:Xenb... [more]
kcna100.000e+071.84potassium channel, voltage gated shaker related su... [more]
kcna100.000e+072.17potassium channel, voltage gated shaker related su... [more]
kcna100.000e+072.17potassium channel, voltage gated shaker related su... [more]
back to top
BLAST of V-type proton ATPase subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Atp6v0d10.000e+074.28ATPase, H+ transporting, lysosomal V0 subunit D1 [... [more]
Atp6v0d28.285e-16963.51ATPase, H+ transporting, lysosomal V0 subunit D2 [... [more]
Atp6v0d29.344e-963.89ATPase, H+ transporting, lysosomal V0 subunit D2 [... [more]
back to top
BLAST of V-type proton ATPase subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q25531|VA0D_MANSE0.000e+078.49V-type proton ATPase subunit d OS=Manduca sexta OX... [more]
sp|Q9W4P5|VA0D1_DROME0.000e+076.44V-type proton ATPase subunit d 1 OS=Drosophila mel... [more]
sp|Q6PGV1|VA0D1_DANRE0.000e+074.57V-type proton ATPase subunit d 1 OS=Danio rerio OX... [more]
sp|P51863|VA0D1_MOUSE0.000e+074.28V-type proton ATPase subunit d 1 OS=Mus musculus O... [more]
sp|Q5R6I1|VA0D1_PONAB0.000e+073.99V-type proton ATPase subunit d 1 OS=Pongo abelii O... [more]
back to top
BLAST of V-type proton ATPase subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HXH10.000e+079.88V-type proton ATPase subunit OS=Lingula unguis OX=... [more]
A0A3P8F3070.000e+078.03V-type proton ATPase subunit OS=Heligmosomoides po... [more]
A0A481SZ570.000e+078.39V-type proton ATPase subunit OS=Thermobia domestic... [more]
A0A1I7ZYI60.000e+078.90V-type proton ATPase subunit OS=Steinernema glaser... [more]
A0A1J1HQJ30.000e+077.81V-type proton ATPase subunit OS=Clunio marinus OX=... [more]
back to top
BLAST of V-type proton ATPase subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
atp6v0d10.000e+074.86V-type proton ATPase subunit d 1 [Source:NCBI gene... [more]
back to top
BLAST of V-type proton ATPase subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
atp6v0d10.000e+072.86ATPase H+ transporting V0 subunit d1 [Source:NCBI ... [more]
back to top
BLAST of V-type proton ATPase subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
VMA61.225e-10947.83Subunit d of the V0 integral membrane domain of V-... [more]
back to top
BLAST of V-type proton ATPase subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO338970.000e+073.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359041.134e-1973.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of V-type proton ATPase subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
atp6v0d10.000e+074.57V-type proton ATPase subunit d 1 [Source:NCBI gene... [more]
back to top
BLAST of V-type proton ATPase subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000057004.10.000e+0100.00SMESG000057004.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022961 ID=SMED30022961|Name=V-type proton ATPase subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=1574bp
TTTGTTTGTTTAGGTTAAAATTATATTTCATTACTAAACATTAAACGGAA
TATATAATTCAAAAAGTATGGAATATCTTTTTAATATAGATAGTGGCTAT
TTGGAAGGTTTAGTAAGAGGTTTTAAAGGTGGGATTATTAAACAAAACGA
TTACTATAATTTAGTCCAATGTGATACTCTTGAAGATTTAAAATTACATT
TGCAAAGTACGGATTATGGTAACTTTTTGGCAAATGAACCTGGACCGCTG
TCTGTCAGTATTATTGAAGAAAAAATTCGAGAAAAACTTGTATTAGAATT
TCAGCACATTCGAAACCAATCTGTCGAACCATTAGCTACATTTTTGGATT
ACATCACTTATAGTTATATGATTGATAACATTGTTCTTTTAATTACTGGA
ACACTTCATGACAGACCAATTACTGAATTGATTGCCAAATGTCACCCGTT
AGGTAGTTTTGAACAAATGGAAGCACTTCATATATCTTCAACACCAGCTG
AATTGTATAATGCTGTATTAGTTGATACTCCACTGGCACCTTATTTCATC
GACTGTATTTCTGAACAAGATTTAGATGAGTTAAACATTGAAATAATCAG
AAATACTCTATACCGAGCATATATTGAAGATTTTTATGGATTTTGTAAAT
TACTAGGCGGAACTACTGCTGAAATTATGTGTGAAATTCTTGCTTTTGAA
GCCGATAGGCGCTCTTTTATAATTACAATTAATTCATTTGATACAGAATT
AAATAAAGAAGATCGAGCTAATCTTTATCCAAAATGTGGGAAACTTTATC
CCGAGGGTTTAGCAATGCTAGCCAGAGCCGACGATTATGAGCAAGTGAAA
GCGGTTGCAGATTATTATAGTGAATATAAAGCTATTTTCGAGGGAGTTGG
AACTGGAAATGATAAAAGTTTAGAGGATAAATTCTTTGAGCATGAAGTTA
AAATGAATGTCAATTCATTTATGCAGCAATTTCATTTCGGTGTATTTTAT
TCTTTGATAAAATTAAAGGAACAAGAAATGCGTAATATTGTCTGGATAGC
CGAATGTGTTTCACAGAGGCATCGCACTAAAATTGATTCCTACATTAATA
TCTTGAATTAATTTGAATAATTTTTCTTCGTTACTTGCATAATAAAACAA
TGATTTGAACTGTGATCAATTTATGTTGTGTGTTCGTGAATTTACATATT
AAAATTGATACTGTGCGTGCATGTATTTGTGTGTGTATTCGATACTTGTC
GATCATTTTTAAAGTAGTCTGATCTGATATAAAATCGAGTAGTAGATTTA
TGCAAAACATTTCATGCGTTTTTATTATTGGGCATTGCGATATAAAATGG
ATTAATTTAAAAAGTTATTTCATAACTATTTTTGATTTAATGATTGATTA
TAAAGCTACAAAGGAGGAATGTTTAAATTTTATACCAAGTAAATATTTTG
AAATCATGGTGAAAGAATGTATTTATTGCGTGAGGTTATATTCCATAAAT
CAGGGATTTAAATACAGCTATTGTGTGGGGTACAACACGTTTGTAGGACT
TTTGTTTTAAATCTGATAGCCAGA
back to top

protein sequence of SMED30022961-orf-1

>SMED30022961-orf-1 ID=SMED30022961-orf-1|Name=SMED30022961-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=348bp
MEYLFNIDSGYLEGLVRGFKGGIIKQNDYYNLVQCDTLEDLKLHLQSTDY
GNFLANEPGPLSVSIIEEKIREKLVLEFQHIRNQSVEPLATFLDYITYSY
MIDNIVLLITGTLHDRPITELIAKCHPLGSFEQMEALHISSTPAELYNAV
LVDTPLAPYFIDCISEQDLDELNIEIIRNTLYRAYIEDFYGFCKLLGGTT
AEIMCEILAFEADRRSFIITINSFDTELNKEDRANLYPKCGKLYPEGLAM
LARADDYEQVKAVADYYSEYKAIFEGVGTGNDKSLEDKFFEHEVKMNVNS
FMQQFHFGVFYSLIKLKEQEMRNIVWIAECVSQRHRTKIDSYINILN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:1902600hydrogen ion transmembrane transport
GO:0015991ATP hydrolysis coupled proton transport
GO:0006810transport
GO:0006811ion transport
GO:0015992proton transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035067V-type_ATPase_suC
IPR036079ATPase_su_C-like
IPR016727ATPase_V0-cplx_dsu
IPR002843ATPase_V0-cplx_csu/dsu
Vocabulary: molecular function
TermDefinition
GO:0015078hydrogen ion transmembrane transporter activity
Vocabulary: cellular component
TermDefinition
GO:0033179proton-transporting V-type ATPase, V0 domain
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002843ATPase, V0 complex, c/d subunitPFAMPF01992vATP-synt_AC39coord: 12..342
e-value: 3.9E-115
score: 384.9
IPR035067V-type ATPase subunit cGENE3DG3DSA:1.20.1690.10coord: 87..191
e-value: 5.5E-13
score: 51.1
IPR035067V-type ATPase subunit cGENE3DG3DSA:1.20.1690.10coord: 202..305
e-value: 5.5E-13
score: 51.1
NoneNo IPR availableGENE3DG3DSA:1.10.132.50coord: 11..332
e-value: 5.5E-13
score: 51.1
NoneNo IPR availablePANTHERPTHR11028:SF3V-TYPE PROTON ATPASE SUBUNIT D 1coord: 2..345
IPR016727ATPase, V0 complex, subunit dPIRSFPIRSF018497V-ATP_synth_Dcoord: 1..346
e-value: 8.4E-151
score: 500.0
IPR016727ATPase, V0 complex, subunit dPANTHERPTHR11028VACUOLAR ATP SYNTHASE SUBUNIT AC39coord: 2..345
IPR036079V-type ATP synthase subunit C-likeSUPERFAMILYSSF103486V-type ATP synthase subunit Ccoord: 10..345