Regulator of microtubule dynamics protein 1

Overview
NameRegulator of microtubule dynamics protein 1
Smed IDSMED30022956
Length (bp)879
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Regulator of microtubule dynamics protein 1 (SMED30022956) t-SNE clustered cells

Violin plots show distribution of expression levels for Regulator of microtubule dynamics protein 1 (SMED30022956) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Regulator of microtubule dynamics protein 1 (SMED30022956) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Regulator of microtubule dynamics protein 1 (SMED30022956) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022956

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30022956SMESG000038855.1 Contig2191GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30022956SMESG000038855.1 Contig2191GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30022956SMESG000038855.1 dd_Smed_v4_502_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30022956SMESG000038855.1 dd_Smed_v4_502_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022956SMESG000038855.1 dd_Smed_v4_502_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30022956SMESG000038855.1 dd_Smed_v4_502_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30022956SMESG000038855.1 dd_Smed_v6_502_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022956SMESG000038855.1 dd_Smed_v6_502_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
glial cellSMED30022956SMESG000038855.1 dd_Smed_v6_502_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Human
Match: RMDN1 (regulator of microtubule dynamics 1 [Source:HGNC Symbol;Acc:HGNC:24285])

HSP 1 Score: 139.428 bits (350), Expect = 1.428e-38
Identity = 88/211 (41.71%), Postives = 130/211 (61.61%), Query Frame = 2
Query:   80 EIITELDDLFAKKDFKELCQLFETKYNTEEYQTAELLWRHARALRELAN-NTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDYDG 709
            EI+ + D L+   + ++L QL  T+Y  +E + AELLWR ARA R++A  + T + E K L+ +AL  AK  L  +ES+   +KWY I L   G  EGIK +I N++ +K+H + A E  N  D   +H +G+WC+  + + W  R++A   FATPP+ST+E+AL +   AE+++P FY+ NLL +GKTY KL NK  A  +L K  DY  
Sbjct:   85 EILEQADYLYESGETEKLYQLL-TQY--KESEDAELLWRLARASRDVAQLSRTSEEEKKLLVYEALEYAKRALEKNESSFASHKWYAICLSDVGDYEGIKAKIANAYIIKEHFEKAIE-LNPKDATSIHLMGIWCYTFAEMPWYQRRIAKMLFATPPSSTYEKALGYFHRAEQVDPNFYSKNLLLLGKTYLKLHNKKLAAFWLMKAKDYPA 291          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Human
Match: RMDN1 (regulator of microtubule dynamics 1 [Source:HGNC Symbol;Acc:HGNC:24285])

HSP 1 Score: 114.775 bits (286), Expect = 6.388e-30
Identity = 82/211 (38.86%), Postives = 120/211 (56.87%), Query Frame = 2
Query:   80 EIITELDDLFAKKDFKELCQLFETKYNTEEYQTAELLWRHARALRELAN-NTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDYDG 709
            EI+ + D L+   + ++L QL  T+Y  +E + AELLWR ARA R++A  + T + E K L+ +AL  AK  L  +ES+   +KWY I L   G  EGIK +I N++ +K+H + A E  N  D   +H +G+WC+  + + W  R++A   FATPP+ST+E+AL +   AE+             GKTY KL NK  A  +L K  DY  
Sbjct:   41 EILEQADYLYESGETEKLYQLL-TQY--KESEDAELLWRLARASRDVAQLSRTSEEEKKLLVYEALEYAKRALEKNESSFASHKWYAICLSDVGDYEGIKAKIANAYIIKEHFEKAIE-LNPKDATSIHLMGIWCYTFAEMPWYQRRIAKMLFATPPSSTYEKALGYFHRAEQ-------------GKTYLKLHNKKLAAFWLMKAKDYPA 234          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Human
Match: RMDN1 (regulator of microtubule dynamics 1 [Source:HGNC Symbol;Acc:HGNC:24285])

HSP 1 Score: 105.145 bits (261), Expect = 2.715e-27
Identity = 58/136 (42.65%), Postives = 85/136 (62.50%), Query Frame = 2
Query:  302 DESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDYDG 709
            +ES+   +KWY I L   G  EGIK +I N++ +K+H + A E  N  D   +H +G+WC+  + + W  R++A   FATPP+ST+E+AL +   AE+++P FY+ NLL +GKTY KL NK  A  +L K  DY  
Sbjct:    3 NESSFASHKWYAICLSDVGDYEGIKAKIANAYIIKEHFEKAIE-LNPKDATSIHLMGIWCYTFAEMPWYQRRIAKMLFATPPSSTYEKALGYFHRAEQVDPNFYSKNLLLLGKTYLKLHNKKLAAFWLMKAKDYPA 137          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Human
Match: RMDN1 (regulator of microtubule dynamics 1 [Source:HGNC Symbol;Acc:HGNC:24285])

HSP 1 Score: 101.679 bits (252), Expect = 3.061e-25
Identity = 69/173 (39.88%), Postives = 105/173 (60.69%), Query Frame = 2
Query:   80 EIITELDDLFAKKDFKELCQLFETKYNTEEYQTAELLWRHARALRELAN-NTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEK 595
            EI+ + D L+   + ++L QL  T+Y   E + AELLWR ARA R++A  + T + E K L+ +AL  AK  L  +ES+   +KWY I L   G  EGIK +I N++ +K+H + A E  N  D   +H +G+WC+  + + W  R++A   FATPP+ST+E+AL +   AE+
Sbjct:   31 EILEQADYLYESGETEKLYQLL-TQYK--ESEDAELLWRLARASRDVAQLSRTSEEEKKLLVYEALEYAKRALEKNESSFASHKWYAICLSDVGDYEGIKAKIANAYIIKEHFEKAIE-LNPKDATSIHLMGIWCYTFAEMPWYQRRIAKMLFATPPSSTYEKALGYFHRAEQ 199          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Human
Match: RMDN1 (regulator of microtubule dynamics 1 [Source:HGNC Symbol;Acc:HGNC:24285])

HSP 1 Score: 98.5969 bits (244), Expect = 1.349e-23
Identity = 76/211 (36.02%), Postives = 112/211 (53.08%), Query Frame = 2
Query:   80 EIITELDDLFAKKDFKELCQLFETKYNTEEYQTAELLWRHARALRELAN-NTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDYDG 709
            EI+ + D L+   + ++L QL  T+Y  +E + AELLWR ARA R++A  + T + E K L+ +AL  AK  L  +ES+   +K                K IE                N  D   +H +G+WC+  + + W  R++A   FATPP+ST+E+AL +   AE+++P FY+ NLL +GKTY KL NK  A  +L K  DY  
Sbjct:   85 EILEQADYLYESGETEKLYQLL-TQY--KESEDAELLWRLARASRDVAQLSRTSEEEKKLLVYEALEYAKRALEKNESSFASHK----------------KAIE---------------LNPKDATSIHLMGIWCYTFAEMPWYQRRIAKMLFATPPSSTYEKALGYFHRAEQVDPNFYSKNLLLLGKTYLKLHNKKLAAFWLMKAKDYPA 261          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Celegans
Match: F33H2.6 (pep chromosome:WBcel235:I:15014851:15016595:-1 gene:WBGene00009369.1 transcript:F33H2.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F33H2.6)

HSP 1 Score: 122.865 bits (307), Expect = 6.505e-33
Identity = 75/167 (44.91%), Postives = 103/167 (61.68%), Query Frame = 2
Query:  179 AELLWRHARALRELANNTTDKAENKRLLQKALSVAKSGLVNDESN--VGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEA 673
            +ELLWR AR + E    + D+ + K L+ +A  + K  L N+  N   G +KWY ILLD  G IEG K RIE SF+V+KHL+ A     ++D    H LGVW F  + + +  R +A   FATPP ST++EAL +   AE+I+PGFY++N  YIG+ YE+L  K EA
Sbjct:   97 SELLWRLARVVCEKGKLSKDQNQRKELILEAYGIVKKALDNEPKNGCFGAHKWYAILLDYVGEIEGNKSRIEKSFQVRKHLEKA-LSIFENDPTTWHILGVWHFSFANMGYATRMVAKAIFATPPASTYQEALHYFLKAEQISPGFYSTNTYYIGEVYEQLGQKAEA 262          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Celegans
Match: rmd-6 (Regulator of Microtubule Dynamics [Source:UniProtKB/TrEMBL;Acc:Q966G0])

HSP 1 Score: 75.8702 bits (185), Expect = 3.901e-16
Identity = 62/203 (30.54%), Postives = 109/203 (53.69%), Query Frame = 2
Query:   92 ELDDLFAKKDFKELCQLFETKYNTEEYQTAELLWRHARALRELANNTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLD 700
            E+D  F  K+  +   L + + +  + ++ E+LWR A+ + E  +    KA+ K  + + L  A+  +  D ++    KW  +L          K+++E S + K+ LD A  K  K D  +LH  G + + V++L+W+ +KLAATF+  PP+ ++EEA E   +A K+NP  +  N  Y+ K Y  +K+K+ A+ YL +  D
Sbjct:    5 EIDKTFGTKNRDQGYDLLKARLDKGD-RSVEVLWRLAQVIHE-KSACVPKAQRKASVTEGLKFAEEAVQKDPNHFKALKWNAVLTGQATEYMATKEKLECSKKFKELLDKALAKEPK-DTALLHLRGRYKYSVASLTWLEKKLAATFYQQPPSHSYEEANEDFLAAYKVNPK-WMENTFYVSKCYVAIKDKNNARKYLTEVCD 203          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Celegans
Match: rmd-3 (Regulator of Microtubule Dynamics [Source:UniProtKB/TrEMBL;Acc:Q17510])

HSP 1 Score: 74.7146 bits (182), Expect = 1.124e-15
Identity = 62/203 (30.54%), Postives = 107/203 (52.71%), Query Frame = 2
Query:   92 ELDDLFAKKDFKELCQLFETKYNTEEYQTAELLWRHARALRELANNTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLD 700
            E+D  F  K+  +   L + + +  + ++ E+LWR A+ + E  +    KA+ K  + + L  A+  +  D ++    KW  +L          K+++E S + K+ LD    K  K D  VLH  G + + V++L+W+ +KLAATF+  PP+ ++EEA E   +A K+NP  +  N  Y+ K Y  +K+K  A+ YL +  D
Sbjct:    5 EIDKTFGTKNRDQGYDLLKARLDKGD-RSVEVLWRLAQVIHE-KSACVPKAQRKASVTEGLKFAEEAVQKDPNHFKALKWNAVLTGQATEYMATKEKLECSKKFKELLDKTLAKEPK-DTAVLHLRGRYKYSVASLTWLEKKLAATFYQQPPSHSYEEANEDFLAAYKVNPK-WMENTFYVSKCYVAIKDKANARKYLTEVCD 203          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Celegans
Match: rmd-2 (Regulator of Microtubule Dynamics [Source:UniProtKB/TrEMBL;Acc:B2D6P1])

HSP 1 Score: 73.1738 bits (178), Expect = 3.568e-15
Identity = 61/208 (29.33%), Postives = 102/208 (49.04%), Query Frame = 2
Query:   92 ELDDLFAKKDFKELCQLFETKYNTEEYQTAELLWRHARALRELANNTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDYDGTD 715
            +LD LF     +E     + +Y+  E ++ ++LWR A+   E+ N   +K + K ++ +    A      D +N    +W  ++        G K++IE     K++LD A     K D  +LH  G W   V+ LSW  RK AA  ++ PPT+T EEA+    +A +INP  +  N +Y+GK   +  +K  AK + ++ L    T+
Sbjct:    5 DLDALFGTDRVQEGYDALKKRYDAGE-KSIDVLWRLAKFCNEIGNRV-EKDKRKDIIVEGKKYATEAWNTDSNNFLAARWAALMSGKVTEYLGTKEKIEEGKHCKEYLDRAISIQPKED-ALLHLRGRWALSVANLSWFERKAAALLYSEPPTATVEEAIADFQAAHEINPD-WIENTVYLGKALHQKGDKAAAKPFFEQALKITPTN 208          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Celegans
Match: rmd-2 (Regulator of Microtubule Dynamics [Source:UniProtKB/TrEMBL;Acc:B2D6P1])

HSP 1 Score: 73.1738 bits (178), Expect = 3.568e-15
Identity = 61/208 (29.33%), Postives = 102/208 (49.04%), Query Frame = 2
Query:   92 ELDDLFAKKDFKELCQLFETKYNTEEYQTAELLWRHARALRELANNTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDYDGTD 715
            +LD LF     +E     + +Y+  E ++ ++LWR A+   E+ N   +K + K ++ +    A      D +N    +W  ++        G K++IE     K++LD A     K D  +LH  G W   V+ LSW  RK AA  ++ PPT+T EEA+    +A +INP  +  N +Y+GK   +  +K  AK + ++ L    T+
Sbjct:    5 DLDALFGTDRVQEGYDALKKRYDAGE-KSIDVLWRLAKFCNEIGNRV-EKDKRKDIIVEGKKYATEAWNTDSNNFLAARWAALMSGKVTEYLGTKEKIEEGKHCKEYLDRAISIQPKED-ALLHLRGRWALSVANLSWFERKAAALLYSEPPTATVEEAIADFQAAHEINPD-WIENTVYLGKALHQKGDKAAAKPFFEQALKITPTN 208          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Zebrafish
Match: rmdn1 (regulator of microtubule dynamics 1 [Source:ZFIN;Acc:ZDB-GENE-070928-17])

HSP 1 Score: 134.42 bits (337), Expect = 4.805e-37
Identity = 83/214 (38.79%), Postives = 126/214 (58.88%), Query Frame = 2
Query:   71 SSNEIITELDDLFAKKDFKELCQLFETKYNTEEYQTAELLWRHARALRELANNTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDYDGT 712
            S+ EI+ + D L++  + ++L QL +   ++ +   AE LWR AR  R+LA  ++ + E +RL  +A   A + L  DE     +KW+ I L   G  EGIK +I NS+ +++HL+ A +  N  D   +H LG WCF  + L W  RK+AA  F +PPT+T+EEALE    AE++ P FY+ NLL +GKTY  L++  +A ++L K  DY   
Sbjct:   67 SAEEILEQADYLYSCGETQKLHQLLDKHRDSGD---AEFLWRLARVCRDLALLSSAE-EKRRLTYEAFQYATAALQRDEQCYAAHKWFAICLSDVGDYEGIKVKIGNSYIIREHLERAIQ-LNPRDATSIHILGFWCFAFAELPWYQRKVAAVIFGSPPTATYEEALEFFLRAEEVEPSFYSKNLLMLGKTYMMLRDVQQAALWLTKARDYPAV 275          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Zebrafish
Match: rmdn3 (regulator of microtubule dynamics 3 [Source:ZFIN;Acc:ZDB-GENE-041014-256])

HSP 1 Score: 97.4413 bits (241), Expect = 1.899e-22
Identity = 63/174 (36.21%), Postives = 103/174 (59.20%), Query Frame = 2
Query:  179 AELLWRHARALRELANNTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLD 700
            AE +WR ARA  ++   T ++ E K   ++    A++ L  +  +  C+KW+ IL   + + + I  ++++   +K+HLD A    +  D    + LG WC EVS+LSW+ +K AATF+ T PTS+  EALE+   AE++NPGF  +  LYI K +++L N  EA+ ++Q  L+
Sbjct:  269 AEFMWRLARAYSDMCETTENREEKKNYAEQGNYEAEAALTRNGLSADCHKWFAILAHQSSQYDSIHGKLKSGHILKEHLDRALALCDD-DPICFYLLGRWCLEVSSLSWLEKKAAATFYETSPTSSLNEALENFLKAEELNPGFSKTVRLYIAKCHKELGNLSEARNWVQLALN 441          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Zebrafish
Match: rmdn3 (regulator of microtubule dynamics 3 [Source:ZFIN;Acc:ZDB-GENE-041014-256])

HSP 1 Score: 97.0561 bits (240), Expect = 2.441e-22
Identity = 63/174 (36.21%), Postives = 103/174 (59.20%), Query Frame = 2
Query:  179 AELLWRHARALRELANNTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLD 700
            AE +WR ARA  ++   T ++ E K   ++    A++ L  +  +  C+KW+ IL   + + + I  ++++   +K+HLD A    +  D    + LG WC EVS+LSW+ +K AATF+ T PTS+  EALE+   AE++NPGF  +  LYI K +++L N  EA+ ++Q  L+
Sbjct:  269 AEFMWRLARAYSDMCETTENREEKKNYAEQGNYEAEAALTRNGLSADCHKWFAILARQSSQYDSIHGKLKSGHILKEHLDRALALCDD-DPICFYLLGRWCLEVSSLSWLEKKAAATFYETSPTSSLNEALENFLKAEELNPGFSKTVRLYIAKCHKELGNLSEARNWVQLALN 441          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Xenopus
Match: crhr2 (corticotropin releasing hormone receptor 2 [Source:Xenbase;Acc:XB-GENE-990953])

HSP 1 Score: 137.887 bits (346), Expect = 1.557e-38
Identity = 88/211 (41.71%), Postives = 128/211 (60.66%), Query Frame = 2
Query:   92 ELDDLFAKKDF----KELCQLFETKYNTEEYQTAELLWRHARALRELA-NNTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDYDG 709
            ++DD+  + D+     E  +L+E     ++   AELLWR ARA R++A  +TT + E KRL+ ++   AK  L  +E     +KWY I L   G  EGIK +I N++ VK+HL+ A E  N  D   +H +GVWC+  + L W   K+A+  F TPP++TFEEALE+   AE+++P FY+ NLL++GKTY KLKNK  A  +L K  D+  
Sbjct:   36 KVDDIIEQADYLYGSGETAKLYELLSQYKDSNDAELLWRLARAARDVALVSTTPQDEKKRLIYESFDSAKKALELNELCWAAHKWYSICLSNVGDYEGIKTKIGNAYIVKEHLERAKE-LNPKDATTIHIIGVWCYMFADLPWYQVKIASALFGTPPSATFEEALEYFLQAEEVDPNFYSKNLLFLGKTYLKLKNKSLALDWLTKAKDFPA 245          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Xenopus
Match: crhr2 (corticotropin releasing hormone receptor 2 [Source:Xenbase;Acc:XB-GENE-990953])

HSP 1 Score: 138.272 bits (347), Expect = 2.377e-38
Identity = 88/211 (41.71%), Postives = 128/211 (60.66%), Query Frame = 2
Query:   92 ELDDLFAKKDF----KELCQLFETKYNTEEYQTAELLWRHARALRELA-NNTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDYDG 709
            ++DD+  + D+     E  +L+E     ++   AELLWR ARA R++A  +TT + E KRL+ ++   AK  L  +E     +KWY I L   G  EGIK +I N++ VK+HL+ A E  N  D   +H +GVWC+  + L W   K+A+  F TPP++TFEEALE+   AE+++P FY+ NLL++GKTY KLKNK  A  +L K  D+  
Sbjct:   76 KVDDIIEQADYLYGSGETAKLYELLSQYKDSNDAELLWRLARAARDVALVSTTPQDEKKRLIYESFDSAKKALELNELCWAAHKWYSICLSNVGDYEGIKTKIGNAYIVKEHLERAKE-LNPKDATTIHIIGVWCYMFADLPWYQVKIASALFGTPPSATFEEALEYFLQAEEVDPNFYSKNLLFLGKTYLKLKNKSLALDWLTKAKDFPA 285          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Xenopus
Match: crhr2 (corticotropin releasing hormone receptor 2 [Source:Xenbase;Acc:XB-GENE-990953])

HSP 1 Score: 123.25 bits (308), Expect = 1.782e-32
Identity = 85/218 (38.99%), Postives = 125/218 (57.34%), Query Frame = 2
Query:   92 ELDDLFAKKDF----KELCQLFETKYNTEEYQTAELLWRHARALRELA-NNTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHL-------TSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDYDG 709
            ++DD+  + D+     E  +L+E     ++   AELLWR ARA R++A  +TT + E KRL+ ++   AK  L  +E     +KWY I L   G  EGIK +I N++ VK+HL+ A E  N  D   +H +GVWC+  + L W   K+A+  F TPP++TFEE +  +        S+ K +P FY+ NLL++GKTY KLKNK  A  +L K  D+  
Sbjct:   76 KVDDIIEQADYLYGSGETAKLYELLSQYKDSNDAELLWRLARAARDVALVSTTPQDEKKRLIYESFDSAKKALELNELCWAAHKWYSICLSNVGDYEGIKTKIGNAYIVKEHLERAKE-LNPKDATTIHIIGVWCYMFADLPWYQVKIASALFGTPPSATFEEVILLVRFLQNTKRSSSKFDPNFYSKNLLFLGKTYLKLKNKSLALDWLTKAKDFPA 292          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Xenopus
Match: sult5a1 (sulfotransferase family 5A, member 1 [Source:Xenbase;Acc:XB-GENE-5871003])

HSP 1 Score: 93.5893 bits (231), Expect = 5.198e-21
Identity = 60/170 (35.29%), Postives = 90/170 (52.94%), Query Frame = 2
Query:  182 ELLWRHARALRELANNTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIA-NEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQ 688
            E LWR AR+  ++     D  E K         A++ L   + N  C+KW+ IL       EGI+KRI+  +  K+H++ A + K   + C  L  LG WC+EVS L W+ RK A+  +  PPT+T  EAL++   AE + PGF  +  + I K Y+ L N+  A  +L+
Sbjct:  261 EFLWRLARSYSDMCTTVEDAQEKKSYASDGKEEAEAALQKADQNAECHKWFAILCGQLSEHEGIQKRIQTGYLFKEHIEKAISLKPGDARCYYL--LGRWCYEVSNLGWLERKTASALYENPPTATVHEALQNFLKAEDLTPGFSKAARILIAKCYKDLGNEATAAHWLK 428          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Xenopus
Match: sult5a1 (sulfotransferase family 5A, member 1 [Source:Xenbase;Acc:XB-GENE-5871003])

HSP 1 Score: 93.5893 bits (231), Expect = 6.085e-21
Identity = 60/170 (35.29%), Postives = 90/170 (52.94%), Query Frame = 2
Query:  182 ELLWRHARALRELANNTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIA-NEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQ 688
            E LWR AR+  ++     D  E K         A++ L   + N  C+KW+ IL       EGI+KRI+  +  K+H++ A + K   + C  L  LG WC+EVS L W+ RK A+  +  PPT+T  EAL++   AE + PGF  +  + I K Y+ L N+  A  +L+
Sbjct:  261 EFLWRLARSYSDMCTTVEDAQEKKSYASDGKEEAEAALQKADQNAECHKWFAILCGQLSEHEGIQKRIQTGYLFKEHIEKAISLKPGDARCYYL--LGRWCYEVSNLGWLERKTASALYENPPTATVHEALQNFLKAEDLTPGFSKAARILIAKCYKDLGNEATAAHWLK 428          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Mouse
Match: Rmdn1 (regulator of microtubule dynamics 1 [Source:MGI Symbol;Acc:MGI:1913552])

HSP 1 Score: 132.494 bits (332), Expect = 3.477e-36
Identity = 83/211 (39.34%), Postives = 123/211 (58.29%), Query Frame = 2
Query:   80 EIITELDDLFAKKDFKELCQLFETKYNTEEYQTAELLWRHARALRELAN-NTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDYDG 709
            EI+ + D L+   + ++L QL       +E +  ELLWR ARA R++A  + T + E K L+ +AL  AK  L   ES+   +KWY I +   G  EGIK +I N++ +K+H + A E  N  D   +H +G+WC+  + + W  R++A   FA PP+ST+EEAL +   AE+++P FY+ NLL +GKTY KL NK  A  +L K   Y  
Sbjct:   80 EILAQADYLYESGETEKLYQLL---IQYKESEDGELLWRLARASRDIAQLSKTSEEEKKVLVYEALDYAKRALEKKESSSAAHKWYAICISDVGDYEGIKVKIANAYVIKEHFEKAIE-LNPKDATSIHLMGIWCYTFAEMPWYQRRIAKVLFANPPSSTYEEALRYFHKAEEVDPNFYSKNLLLLGKTYLKLNNKKLAAFWLVKAKGYPA 286          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Mouse
Match: Rmdn3 (regulator of microtubule dynamics 3 [Source:MGI Symbol;Acc:MGI:1915059])

HSP 1 Score: 93.2041 bits (230), Expect = 5.633e-21
Identity = 62/207 (29.95%), Postives = 111/207 (53.62%), Query Frame = 2
Query:   83 IITELDDLF--AKKDFKELCQLF---ETKYNTEEYQTAELLWRHARALRELANNTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQ 688
            ++ + D+L   +K+D +E  QL    +  Y + +    + LWR ARA  ++++ T +++  K         A++ L   + +  C+ WY +L       EGI KRI++ F  K+H+D A E   +   G    LG WC++VS L+W+ +K A   F +P ++T ++AL+    AE++ PGF  +  +YI K Y +L    EA+ +++
Sbjct:  242 VLLQADELHQGSKQDKREGFQLLLNNKLAYGSRQ----DFLWRLARAYSDMSDLTEEESGKKSYALNGKEEAEAALKKGDESAACHLWYAVLCGQLAEHEGISKRIQSGFSFKEHVDKAIELQPEDPRGHFL-LGRWCYQVSHLNWLEKKTATALFESPLSATVQDALQSFLKAEELQPGFSKAGRVYISKCYRELGKNSEARKWMK 443          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Mouse
Match: Rmdn2 (regulator of microtubule dynamics 2 [Source:MGI Symbol;Acc:MGI:2147043])

HSP 1 Score: 83.1889 bits (204), Expect = 1.208e-17
Identity = 56/166 (33.73%), Postives = 84/166 (50.60%), Query Frame = 2
Query:  179 AELLWRHARALRELANNTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSL-GVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEA 673
             E LWR ARA  ++ + +T   E K       ++ +  +     N  C+ WY +L       EG++ +I      KKHL+IA +   +    +L+ L G +C+ VS LSWI +K+AAT F   P ST  EAL +    E++ PG+  SN +Y  K Y +L    EA
Sbjct:  214 TEFLWRLARAYGDMYDLSTSTQEKKHYANIGKTLGERAITRAPMNGHCHLWYAVLCGYVSEFEGLQNKINCGHLFKKHLEIAIQLLPEEP--LLYYLKGRYCYTVSRLSWIEKKMAATLFGEIPYSTVHEALHNFLKTEELQPGYSMSNYMYTAKCYVELGEPQEA 377          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Mouse
Match: Rmdn2 (regulator of microtubule dynamics 2 [Source:MGI Symbol;Acc:MGI:2147043])

HSP 1 Score: 83.1889 bits (204), Expect = 1.208e-17
Identity = 56/166 (33.73%), Postives = 84/166 (50.60%), Query Frame = 2
Query:  179 AELLWRHARALRELANNTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSL-GVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEA 673
             E LWR ARA  ++ + +T   E K       ++ +  +     N  C+ WY +L       EG++ +I      KKHL+IA +   +    +L+ L G +C+ VS LSWI +K+AAT F   P ST  EAL +    E++ PG+  SN +Y  K Y +L    EA
Sbjct:  214 TEFLWRLARAYGDMYDLSTSTQEKKHYANIGKTLGERAITRAPMNGHCHLWYAVLCGYVSEFEGLQNKINCGHLFKKHLEIAIQLLPEEP--LLYYLKGRYCYTVSRLSWIEKKMAATLFGEIPYSTVHEALHNFLKTEELQPGYSMSNYMYTAKCYVELGEPQEA 377          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Mouse
Match: Rmdn1 (regulator of microtubule dynamics 1 [Source:MGI Symbol;Acc:MGI:1913552])

HSP 1 Score: 70.0922 bits (170), Expect = 5.905e-14
Identity = 42/115 (36.52%), Postives = 66/115 (57.39%), Query Frame = 2
Query:   80 EIITELDDLFAKKDFKELCQLFETKYNTEEYQTAELLWRHARALRELAN-NTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDI 421
            EI+ + D L+   + ++L QL       +E +  ELLWR ARA R++A  + T + E K L+ +AL  AK  L   ES+   +KWY I +   G  EGIK +I N++ +K+H ++
Sbjct:   80 EILAQADYLYESGETEKLYQLL---IQYKESEDGELLWRLARASRDIAQLSKTSEEEKKVLVYEALDYAKRALEKKESSSAAHKWYAICISDVGDYEGIKVKIANAYVIKEHFEV 191          
BLAST of Regulator of microtubule dynamics protein 1 vs. UniProt/SwissProt
Match: sp|Q32KL4|RMD1_BOVIN (Regulator of microtubule dynamics protein 1 OS=Bos taurus OX=9913 GN=RMDN1 PE=2 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 3.187e-38
Identity = 88/216 (40.74%), Postives = 131/216 (60.65%), Query Frame = 2
Query:   65 IMSSNEIITELDDLFAKKDFKELCQLFETKYNTEEYQTAELLWRHARALRELAN-NTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDYDG 709
            +    E++ + D L+   + ++L QL  T+Y  +E + AELLWR ARA R++A  + T + E K L+ +AL  AK  L  +ES+   +KWY I +   G  EGIK +I N++ +K+H + A E  N  D   +H +G+WC+ V+ + W  R++A   FATPP ST+EEAL +   AE+++P FY+ NLL +GKTY KL NK  A  +L K  DY  
Sbjct:   83 VFEIEEVLEQADYLYESGETEKLYQLL-TQY--KESEDAELLWRLARASRDVAQLSGTSEEEKKFLVYEALEYAKRALEKNESSCAAHKWYAICIGDVGDYEGIKAKIANAYIIKEHFEKAIE-LNPKDATSIHLMGIWCYTVAEMPWYQRRIAKVLFATPPGSTYEEALGYFHRAEQVDPNFYSKNLLLLGKTYLKLHNKKLAAFWLTKAKDYPA 294          
BLAST of Regulator of microtubule dynamics protein 1 vs. UniProt/SwissProt
Match: sp|Q96DB5|RMD1_HUMAN (Regulator of microtubule dynamics protein 1 OS=Homo sapiens OX=9606 GN=RMDN1 PE=1 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 6.857e-38
Identity = 88/211 (41.71%), Postives = 130/211 (61.61%), Query Frame = 2
Query:   80 EIITELDDLFAKKDFKELCQLFETKYNTEEYQTAELLWRHARALRELAN-NTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDYDG 709
            EI+ + D L+   + ++L QL  T+Y  +E + AELLWR ARA R++A  + T + E K L+ +AL  AK  L  +ES+   +KWY I L   G  EGIK +I N++ +K+H + A E  N  D   +H +G+WC+  + + W  R++A   FATPP+ST+E+AL +   AE+++P FY+ NLL +GKTY KL NK  A  +L K  DY  
Sbjct:   85 EILEQADYLYESGETEKLYQLL-TQY--KESEDAELLWRLARASRDVAQLSRTSEEEKKLLVYEALEYAKRALEKNESSFASHKWYAICLSDVGDYEGIKAKIANAYIIKEHFEKAIE-LNPKDATSIHLMGIWCYTFAEMPWYQRRIAKMLFATPPSSTYEKALGYFHRAEQVDPNFYSKNLLLLGKTYLKLHNKKLAAFWLMKAKDYPA 291          
BLAST of Regulator of microtubule dynamics protein 1 vs. UniProt/SwissProt
Match: sp|Q5R8E4|RMD1_PONAB (Regulator of microtubule dynamics protein 1 OS=Pongo abelii OX=9601 GN=RMDN1 PE=2 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 2.973e-37
Identity = 88/211 (41.71%), Postives = 129/211 (61.14%), Query Frame = 2
Query:   80 EIITELDDLFAKKDFKELCQLFETKYNTEEYQTAELLWRHARALRELAN-NTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDYDG 709
            EI+ + D L    + ++L QL  T+Y  +E + AELLWR ARA R++A  + T + E K L+ +AL  AK  L  +ES+   +KWY I L   G  EGIK +I N++ +K+H + A E  N  D   +H +G+WC+  + + W  R++A   FATPP+ST+E+AL +   AE+++P FY+ NLL +GKTY KL NK  A  +L K  DY  
Sbjct:   85 EILEQADYLCESGETEKLYQLL-TQY--KESEDAELLWRLARASRDVAQLSRTSEEEKKLLVYEALEYAKRALEKNESSFAAHKWYAICLSDVGDYEGIKAKIANAYIIKEHFEKAIE-LNPKDATSIHLMGIWCYTFAEMPWYQRRIAKMLFATPPSSTYEKALSYFHRAEQVDPNFYSKNLLLLGKTYLKLHNKKLAAFWLMKAKDYPA 291          
BLAST of Regulator of microtubule dynamics protein 1 vs. UniProt/SwissProt
Match: sp|Q9DCV4|RMD1_MOUSE (Regulator of microtubule dynamics protein 1 OS=Mus musculus OX=10090 GN=Rmdn1 PE=1 SV=2)

HSP 1 Score: 132.494 bits (332), Expect = 2.432e-35
Identity = 83/211 (39.34%), Postives = 123/211 (58.29%), Query Frame = 2
Query:   80 EIITELDDLFAKKDFKELCQLFETKYNTEEYQTAELLWRHARALRELAN-NTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDYDG 709
            EI+ + D L+   + ++L QL       +E +  ELLWR ARA R++A  + T + E K L+ +AL  AK  L   ES+   +KWY I +   G  EGIK +I N++ +K+H + A E  N  D   +H +G+WC+  + + W  R++A   FA PP+ST+EEAL +   AE+++P FY+ NLL +GKTY KL NK  A  +L K   Y  
Sbjct:   80 EILAQADYLYESGETEKLYQLL---IQYKESEDGELLWRLARASRDIAQLSKTSEEEKKVLVYEALDYAKRALEKKESSSAAHKWYAICISDVGDYEGIKVKIANAYVIKEHFEKAIE-LNPKDATSIHLMGIWCYTFAEMPWYQRRIAKVLFANPPSSTYEEALRYFHKAEEVDPNFYSKNLLLLGKTYLKLNNKKLAAFWLVKAKGYPA 286          
BLAST of Regulator of microtubule dynamics protein 1 vs. UniProt/SwissProt
Match: sp|Q4G069|RMD1_RAT (Regulator of microtubule dynamics protein 1 OS=Rattus norvegicus OX=10116 GN=Rmdn1 PE=2 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 8.455e-35
Identity = 85/211 (40.28%), Postives = 125/211 (59.24%), Query Frame = 2
Query:   80 EIITELDDLFAKKDFKELCQLFETKYNTEEYQTAELLWRHARALRELAN-NTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDYDG 709
            EI+ + D L+   + ++L QL  T+Y  +E +  ELLWR ARA R++A    T + E K LL +AL  AK  L    S+   +KWY I +   G  EGIK +I N++ +K+H + A E  N  D   +H +G+WC+  + + W  R++A   FA PP+ST+EEAL++   AE+++P FY+ NLL +GKTY KL NK  A  +L K   Y  
Sbjct:   85 EILEQADYLYESGETEKLYQLL-TQY--KESEDVELLWRLARASRDIAQLCKTSEEEKKVLLYEALEYAKRALEKKGSSFAAHKWYAICISDVGDYEGIKVKIANAYVIKEHFEKAIE-LNPKDATSIHLMGIWCYTFAEMPWYQRRIAEVLFANPPSSTYEEALKYFHRAEEVDPNFYSKNLLLLGKTYLKLNNKKLAAFWLVKAKSYPA 291          
BLAST of Regulator of microtubule dynamics protein 1 vs. TrEMBL
Match: A0A1I8G7Y4 (TPR_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 6.175e-49
Identity = 109/218 (50.00%), Postives = 141/218 (64.68%), Query Frame = 2
Query:   71 SSNEIITELDDLFAKKDFKELCQLFETKYNTEEYQTAELLWRHARALRELANNTTDKAENKR-LLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDY--DGTD 715
            +S++I+T +D+L +    KE     + +      ++AE+ WR AR  R LAN   D  E ++ L+ +A   AK GL  +  N  C+KW GILLDLTGR EG KKRIENSF VK+H   A +K    D  VLH LGVWC+EV+ LSW+ R +AA FFA PPTST+EEALE+L  AEK +P FYASNL YIGK Y +LK   EAK + QK +++  DG D
Sbjct:    5 TSSDILTAVDELHSAGKEKEARDQLKAELAAGR-ESAEIYWRLARECRGLANRCPDSEEQRKALIYEAFESAKKGLAAEPDNWSCHKWMGILLDLTGRFEGTKKRIENSFLVKEHFTKALDK-KPDDAVVLHCLGVWCYEVANLSWLQRNMAAAFFAKPPTSTYEEALEYLLRAEKASPNFYASNLNYIGKAYYQLKKLPEAKEFFQKTINHEADGHD 220          
BLAST of Regulator of microtubule dynamics protein 1 vs. TrEMBL
Match: A0A1I8J620 (TPR_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 6.206e-49
Identity = 109/218 (50.00%), Postives = 141/218 (64.68%), Query Frame = 2
Query:   71 SSNEIITELDDLFAKKDFKELCQLFETKYNTEEYQTAELLWRHARALRELANNTTDKAENKR-LLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDY--DGTD 715
            +S++I+T +D+L +    KE     + +      ++AE+ WR AR  R LAN   D  E ++ L+ +A   AK GL  +  N  C+KW GILLDLTGR EG KKRIENSF VK+H   A +K    D  VLH LGVWC+EV+ LSW+ R +AA FFA PPTST+EEALE+L  AEK +P FYASNL YIGK Y +LK   EAK + QK +++  DG D
Sbjct:    5 TSSDILTAVDELHSAGKEKEARDQLKAELAAGR-ESAEIYWRLARECRGLANRCPDSEEQRKALIYEAFESAKKGLAAEPDNWSCHKWMGILLDLTGRFEGTKKRIENSFLVKEHFTKALDK-KPDDAVVLHCLGVWCYEVANLSWLQRNMAAAFFAKPPTSTYEEALEYLLRAEKASPNFYASNLNYIGKAYYQLKKLPEAKEFFQKTINHEADGHD 220          
BLAST of Regulator of microtubule dynamics protein 1 vs. TrEMBL
Match: A0A267EG72 (TPR_REGION domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007364g1 PE=4 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 6.296e-49
Identity = 109/218 (50.00%), Postives = 141/218 (64.68%), Query Frame = 2
Query:   71 SSNEIITELDDLFAKKDFKELCQLFETKYNTEEYQTAELLWRHARALRELANNTTDKAENKR-LLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDY--DGTD 715
            +S++I+T +D+L +    KE     + +      ++AE+ WR AR  R LAN   D  E ++ L+ +A   AK GL  +  N  C+KW GILLDLTGR EG KKRIENSF VK+H   A +K    D  VLH LGVWC+EV+ LSW+ R +AA FFA PPTST+EEALE+L  AEK +P FYASNL YIGK Y +LK   EAK + QK +++  DG D
Sbjct:   11 TSSDILTAVDELHSAGKEKEARDQLKAELAAGR-ESAEIYWRLARECRGLANRCPDSEEQRKALIYEAFESAKKGLAAEPDNWSCHKWMGILLDLTGRFEGTKKRIENSFLVKEHFTKALDK-KPDDAVVLHCLGVWCYEVANLSWLQRNMAAAFFAKPPTSTYEEALEYLLRAEKASPNFYASNLNYIGKAYYQLKKLPEAKEFFQKTINHEADGHD 226          
BLAST of Regulator of microtubule dynamics protein 1 vs. TrEMBL
Match: A0A267G635 (TPR_REGION domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023913g2 PE=4 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 6.523e-49
Identity = 109/218 (50.00%), Postives = 141/218 (64.68%), Query Frame = 2
Query:   71 SSNEIITELDDLFAKKDFKELCQLFETKYNTEEYQTAELLWRHARALRELANNTTDKAENKR-LLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDY--DGTD 715
            +S++I+T +D+L +    KE     + +      ++AE+ WR AR  R LAN   D  E ++ L+ +A   AK GL  +  N  C+KW GILLDLTGR EG KKRIENSF VK+H   A +K    D  VLH LGVWC+EV+ LSW+ R +AA FFA PPTST+EEALE+L  AEK +P FYASNL YIGK Y +LK   EAK + QK +++  DG D
Sbjct:   10 TSSDILTAVDELHSAGKEKEARDQLKAELAAGR-ESAEIYWRLARECRGLANRCPDSEEQRKALIYEAFESAKKGLAAEPDNWSCHKWMGILLDLTGRFEGTKKRIENSFLVKEHFTKALDK-KPDDAVVLHCLGVWCYEVANLSWLQRNMAAAFFAKPPTSTYEEALEYLLRAEKASPNFYASNLNYIGKAYYQLKKLPEAKEFFQKTINHEADGHD 225          
BLAST of Regulator of microtubule dynamics protein 1 vs. TrEMBL
Match: A0A267EID1 (TPR_REGION domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023913g1 PE=4 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 7.099e-49
Identity = 109/218 (50.00%), Postives = 141/218 (64.68%), Query Frame = 2
Query:   71 SSNEIITELDDLFAKKDFKELCQLFETKYNTEEYQTAELLWRHARALRELANNTTDKAENKR-LLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDY--DGTD 715
            +S++I+T +D+L +    KE     + +      ++AE+ WR AR  R LAN   D  E ++ L+ +A   AK GL  +  N  C+KW GILLDLTGR EG KKRIENSF VK+H   A +K    D  VLH LGVWC+EV+ LSW+ R +AA FFA PPTST+EEALE+L  AEK +P FYASNL YIGK Y +LK   EAK + QK +++  DG D
Sbjct:   14 TSSDILTAVDELHSAGKEKEARDQLKAELAAGR-ESAEIYWRLARECRGLANRCPDSEEQRKALIYEAFESAKKGLAAEPDNWSCHKWMGILLDLTGRFEGTKKRIENSFLVKEHFTKALDK-KPDDAVVLHCLGVWCYEVANLSWLQRNMAAAFFAKPPTSTYEEALEYLLRAEKASPNFYASNLNYIGKAYYQLKKLPEAKEFFQKTINHEADGHD 229          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Cavefish
Match: rmdn1 (regulator of microtubule dynamics 1 [Source:NCBI gene;Acc:103039863])

HSP 1 Score: 135.191 bits (339), Expect = 1.379e-37
Identity = 88/215 (40.93%), Postives = 128/215 (59.53%), Query Frame = 2
Query:   74 SNEIITELDDLFAKKDFKELCQLFETKYNTEEYQTAELLWRHARALRELA---NNTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDYDG 709
            ++E+I   D L++  + ++L QL     ++++   AE LWR ARA R+LA   N   D  + K+L  +A   AK  L  +E+    +KWY I L   G  EG+K +I NS+ +K HL+ A E  N  D   +H LG WCF  + L W  RK+AA  FA+PPT+T+EEAL +   AE ++P FY+ NLL +GKTY  LK++D+A ++L K  DY  
Sbjct:   51 ADEVIERADYLYSCGETEKLYQLLLQYKDSDD---AEFLWRLARASRDLALVPNVAAD--QKKQLTYEAFDYAKKALEKNEACFAAHKWYAICLSDVGDYEGVKVKIGNSYIIKDHLERAIE-LNPKDATSIHILGYWCFAFAELPWYQRKVAAVIFASPPTATYEEALAYFLKAEDVDPNFYSKNLLMLGKTYMMLKDQDKALLWLHKARDYPA 259          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Cavefish
Match: rmdn1 (regulator of microtubule dynamics 1 [Source:NCBI gene;Acc:103039863])

HSP 1 Score: 135.191 bits (339), Expect = 2.055e-37
Identity = 88/215 (40.93%), Postives = 128/215 (59.53%), Query Frame = 2
Query:   74 SNEIITELDDLFAKKDFKELCQLFETKYNTEEYQTAELLWRHARALRELA---NNTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDYDG 709
            ++E+I   D L++  + ++L QL     ++++   AE LWR ARA R+LA   N   D  + K+L  +A   AK  L  +E+    +KWY I L   G  EG+K +I NS+ +K HL+ A E  N  D   +H LG WCF  + L W  RK+AA  FA+PPT+T+EEAL +   AE ++P FY+ NLL +GKTY  LK++D+A ++L K  DY  
Sbjct:   73 ADEVIERADYLYSCGETEKLYQLLLQYKDSDD---AEFLWRLARASRDLALVPNVAAD--QKKQLTYEAFDYAKKALEKNEACFAAHKWYAICLSDVGDYEGVKVKIGNSYIIKDHLERAIE-LNPKDATSIHILGYWCFAFAELPWYQRKVAAVIFASPPTATYEEALAYFLKAEDVDPNFYSKNLLMLGKTYMMLKDQDKALLWLHKARDYPA 281          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Cavefish
Match: rmdn3 (regulator of microtubule dynamics protein 3 [Source:NCBI gene;Acc:103042020])

HSP 1 Score: 98.2117 bits (243), Expect = 6.646e-23
Identity = 62/175 (35.43%), Postives = 101/175 (57.71%), Query Frame = 2
Query:  176 TAELLWRHARALRELANNTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIA-NEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCL 697
            + E LWR ARA  ++  +  D+ E +   ++    A++ L ++  N  C+KW+ +L   + + E +  ++++S  +K+HLD A + + +   C  L  LG WCFEVS LSW+ +K AA  F T P S   +ALE+   AE++NPGF  +  LYI K +++L N  EA+ + Q  L
Sbjct:  235 SVEFLWRLARAYNDMCEHVADQEEKRSYAEQGRDEAEAALQHNGLNAECHKWFAVLTGQSSQYESMHGKLKSSHILKEHLDRALSLRDDDPLCYYL--LGRWCFEVSRLSWVEKKTAAALFETLPDSCLNDALENFLKAEELNPGFSKNVRLYIAKCHKELGNYSEARNWAQLAL 407          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Cavefish
Match: rmdn3 (regulator of microtubule dynamics protein 3 [Source:NCBI gene;Acc:103042020])

HSP 1 Score: 97.4413 bits (241), Expect = 1.877e-22
Identity = 62/175 (35.43%), Postives = 101/175 (57.71%), Query Frame = 2
Query:  176 TAELLWRHARALRELANNTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIA-NEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCL 697
            + E LWR ARA  ++  +  D+ E +   ++    A++ L ++  N  C+KW+ +L   + + E +  ++++S  +K+HLD A + + +   C  L  LG WCFEVS LSW+ +K AA  F T P S   +ALE+   AE++NPGF  +  LYI K +++L N  EA+ + Q  L
Sbjct:  279 SVEFLWRLARAYNDMCEHVADQEEKRSYAEQGRDEAEAALQHNGLNAECHKWFAVLTGQSSQYESMHGKLKSSHILKEHLDRALSLRDDDPLCYYL--LGRWCFEVSRLSWVEKKTAAALFETLPDSCLNDALENFLKAEELNPGFSKNVRLYIAKCHKELGNYSEARNWAQLAL 451          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000050699.1 (regulator of microtubule dynamics protein 2 [Source:NCBI gene;Acc:103037124])

HSP 1 Score: 83.1889 bits (204), Expect = 3.046e-18
Identity = 55/172 (31.98%), Postives = 90/172 (52.33%), Query Frame = 2
Query:  164 EEY-QTAELLWRHARALRELANNTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAK 676
            EE+ Q  + LWR  RA  +  +   D  E K+  +K   V    +  +      ++WY I+  L    E ++ +I+N +  K HLD A E     D    + LG WC+ V+  +WI RK+AAT F  PP++T ++AL++   AE++ P +   N +++ K Y+ L  K +AK
Sbjct:   72 EEFEQKCQYLWRLTRAYADAHDLAGDSQEKKKFAEKGKQVGAQAISVNPMCAESHQWYAIVCGLLSEYESVQNKIKNGYLFKDHLDKAIE-LKPQDPLSYYLLGRWCYAVAQCTWIERKIAATLFGEPPSATMQDALQNFLKAEELCPKYSKFNYVFLAKCYKDLGQKTQAK 242          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003862.1 (pep scaffold:Pmarinus_7.0:GL489646:3760:6869:-1 gene:ENSPMAG00000003521.1 transcript:ENSPMAT00000003862.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 129.028 bits (323), Expect = 8.826e-37
Identity = 75/183 (40.98%), Postives = 110/183 (60.11%), Query Frame = 2
Query:  182 ELLWRHARALRELANNT-TDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDYDG-TDVDT 724
            E+LWR ARA R+LA  + T   E +RL  +AL  AK  L  + S+  C+KWY I +   G  EGIK +I N+F +K+H   A E  N  D   LH +G+WCF  + + W  R++ A  FA+PP++TF +AL++ + AE++ P FY+ N+L +GKT  +L N   A ++L K  D+   TD D 
Sbjct:    4 EVLWRLARAARDLAQRSGTTTEERRRLAYEALDAAKRALDKNPSSFACHKWYAICVSDVGDFEGIKVKIANAFVIKEHFQKAIE-LNPRDPTSLHLMGLWCFTFAEMPWYQRRITAVLFASPPSATFYDALQYFSEAEQVEPSFYSKNMLMLGKTQLRLGNVRGALLWLTKARDFPARTDEDA 185          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Sea Lamprey
Match: rmdn3 (regulator of microtubule dynamics 3 [Source:ZFIN;Acc:ZDB-GENE-041014-256])

HSP 1 Score: 90.5077 bits (223), Expect = 6.102e-21
Identity = 58/162 (35.80%), Postives = 88/162 (54.32%), Query Frame = 2
Query:  176 TAELLWRHARALRELANNTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKN 661
            +AE LWR  R   +L   TTD  + K        VA   +  +E +  C++WY ++       E  + RI+N F  K+H+D A E  N SD    + LG WC+ VS L+WI RK+AAT FA  P +T ++AL +    E++ P F  +N ++I K Y++L +
Sbjct:  211 SAEFLWRLVRGYSDLFEMTTDTEQKKIYAYAGKEVAVESIKVNEQSSNCHQWYAVMCGFLADYETTQNRIKNGFLFKEHIDRAIE-LNPSDPLNYYLLGRWCYGVSQLTWIERKVAATLFAITPMATIQDALANFLKTEELKPKFSKANQVFIAKCYDQLGD 371          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009395.1 (pep scaffold:Pmarinus_7.0:GL478442:15946:21596:1 gene:ENSPMAG00000008488.1 transcript:ENSPMAT00000009395.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.2629 bits (199), Expect = 1.896e-18
Identity = 59/164 (35.98%), Postives = 91/164 (55.49%), Query Frame = 2
Query:  191 WRHARALRELANNTTDKAENKRLLQKALS---VAKSGLVNDESNVGCNKWYGIL-LDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDE 670
            WR ARA  ++   T DK+E  RL+  AL+    A+ GL        C KW+ I+ LD    ++  + ++ NSF VK+HL+  N   N SD  +LH LG W F ++ L+WI R++  + F   PTS+  EAL++   AE++ P F  +N ++I K    L  ++E
Sbjct:   51 WRMARAFGDMCEITEDKSE--RLIH-ALTGKESAEKGLKWRSCIRECRKWFAIICLDYLWELQTTQHQMRNSFSVKRHLE-QNLATNPSDPEMLHLLGRWGFAMANLTWIERRVCNSIFKDYPTSSVNEALQYFLKAEELQPNFSKANQVFIVKCCASLGLQEE 210          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Nematostella
Match: EDO33467 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS47])

HSP 1 Score: 123.25 bits (308), Expect = 3.377e-34
Identity = 75/199 (37.69%), Postives = 112/199 (56.28%), Query Frame = 2
Query:   98 DDLFAKKDFKELCQLFETKYNTEEYQTAELLWRHARALRELANNTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKC 694
            D+LF   D   + +L+E     +E   A  +WR ARA R  A    D  E K+   +AL  AK  +  D+ +  C+KWY I +   G  EG K +I+N++ ++ H   A +  N +D    H LG+WCF  + + W   KLAA  F+TPP+ST++EAL H   AE + P F++ N L +GKTY +LK  ++AK +L+K 
Sbjct:    5 DELF---DNNAIDELYEVLIKFKESDKAGTMWRLARAARNKAERAKDGNEKKKFTYEALEYAKKSVELDDRDFACHKWYAITVSNVGDFEGTKTKIQNAYTIRDHFQKAVD-LNPTDATSRHLLGLWCFTFADMPWYQHKLAAAIFSTPPSSTYDEALNHFEMAESLQPNFFSKNHLMLGKTYARLKKLEKAKFWLEKA 199          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Nematostella
Match: EDO34531 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP21])

HSP 1 Score: 110.153 bits (274), Expect = 4.256e-29
Identity = 68/186 (36.56%), Postives = 105/186 (56.45%), Query Frame = 2
Query:  167 EYQTAELLWRHARALRELANNTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGI-LLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVW-----CFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDYD 706
            E +  E+LWR +RA R +A+ T D AE +  +      A  G+  D++N GC+KW+ + L+   G   G +++++N   VK+H   A +  N +D    H LG W      F +S L W+ RK+  T  + PP +T+EEALE    AEK+ P F+  N L + KT+ +LKN  +AK +LQK +D+ 
Sbjct:   33 ETKEPEVLWRLSRASRVVADRTPDAAEKQTYVNMIKEFASRGMEIDDNNSGCHKWFAMGLMQAAG---GPQEKMKNVHIVKEHFQKAID-LNPNDPHAHHVLGTWYVTMMFFNLSDLPWLMRKMLNTIQSNPPKATYEEALEQFEEAEKLQPNFFGRNSLLLAKTHMRLKNLPKAKEFLQKAVDFP 214          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Nematostella
Match: EDO32079 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW51])

HSP 1 Score: 90.1225 bits (222), Expect = 1.395e-20
Identity = 66/179 (36.87%), Postives = 93/179 (51.96%), Query Frame = 2
Query:  179 AELLWRHARALRELAN-NTTDKAENKR--LLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDYD 706
            AEL WR ARA  +L+      + E K+  LL K L+ A+  +  ++     +KW  I+L  T   E  + +I   F+ K+H+  A E  N  D    H LG WC+EVS LSW  RK A    A PP ST EEAL++   AE + PGF+ SN  +I   Y +     ++K ++ K L  D
Sbjct:  187 AELWWRLARAYSDLSPIKAKQEGEEKKKDLLYKGLAAAQKAVELNDKLSNAHKWCSIMLGSTTEYESTQDQILQGFKYKEHIVKAIE-LNHKDPTCYHLLGRWCYEVSQLSWWKRKAATAIAAEPPASTVEEALDNFLKAEALQPGFWLSNTYWIAMCYYQQSAYSKSKEWVTKALAMD 364          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Nematostella
Match: EDO28338 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6R7])

HSP 1 Score: 52.373 bits (124), Expect = 6.120e-9
Identity = 28/84 (33.33%), Postives = 47/84 (55.95%), Query Frame = 2
Query:  167 EYQTAELLWRHARALRELANNTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGI-LLDLTGRIEGIKKRIENSFEVKKHL 415
            E +  E+LWR +RA R +A+ TTD  E +  +      A  G+  D+ N GC+KW+ + L+   G   G +++++N   VK+H 
Sbjct:   33 ETKEPEVLWRLSRASRVVADRTTDSTEKQTYVNMIKEFASRGIEIDDKNSGCHKWFAMGLMQAAG---GPQEKMKNVHIVKEHF 113          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Medaka
Match: rmdn1 (regulator of microtubule dynamics 1 [Source:NCBI gene;Acc:101164760])

HSP 1 Score: 134.806 bits (338), Expect = 3.205e-37
Identity = 86/215 (40.00%), Postives = 125/215 (58.14%), Query Frame = 2
Query:   68 MSSNEIITELDDLFAKKDFKELCQLFETKYNTEEYQTAELLWRHARALRELAN-NTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDYDG 709
            +  +EI+ + D L++  + ++L +L     +++E   AE LWR ARA REL+    TD     +L  +A    K  L  D++N   +KWY I L   G  +G+K +I NSF +++HL+ A +  N  D   LH LG WCF  + L W  RK+AA  F +PPTSTFEEALE    AE+++P FY+ NLL +GKTY  +K+   A ++L K  DY  
Sbjct:   77 LEKDEILEQADYLYSCAETEKLYELLVKYKDSDE---AEFLWRLARASRELSFLPDTDPQRKTQLTSEAFEFVKRALERDDTNFAVHKWYAICLSDIGESQGVKAKIGNSFIIREHLEKAIQ-LNPKDPTSLHILGYWCFAFAELPWYQRKVAAVIFESPPTSTFEEALEFFLKAEEVDPNFYSKNLLMLGKTYMAMKDDQNALLWLTKAKDYPA 287          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Medaka
Match: rmdn1 (regulator of microtubule dynamics 1 [Source:NCBI gene;Acc:101164760])

HSP 1 Score: 134.806 bits (338), Expect = 4.607e-37
Identity = 86/215 (40.00%), Postives = 125/215 (58.14%), Query Frame = 2
Query:   68 MSSNEIITELDDLFAKKDFKELCQLFETKYNTEEYQTAELLWRHARALRELAN-NTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDYDG 709
            +  +EI+ + D L++  + ++L +L     +++E   AE LWR ARA REL+    TD     +L  +A    K  L  D++N   +KWY I L   G  +G+K +I NSF +++HL+ A +  N  D   LH LG WCF  + L W  RK+AA  F +PPTSTFEEALE    AE+++P FY+ NLL +GKTY  +K+   A ++L K  DY  
Sbjct:   77 LEKDEILEQADYLYSCAETEKLYELLVKYKDSDE---AEFLWRLARASRELSFLPDTDPQRKTQLTSEAFEFVKRALERDDTNFAVHKWYAICLSDIGESQGVKAKIGNSFIIREHLEKAIQ-LNPKDPTSLHILGYWCFAFAELPWYQRKVAAVIFESPPTSTFEEALEFFLKAEEVDPNFYSKNLLMLGKTYMAMKDDQNALLWLTKAKDYPA 287          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Medaka
Match: rmdn3 (regulator of microtubule dynamics protein 3 [Source:NCBI gene;Acc:101162569])

HSP 1 Score: 87.4261 bits (215), Expect = 5.001e-19
Identity = 60/172 (34.88%), Postives = 92/172 (53.49%), Query Frame = 2
Query:  161 TEEYQTAELLWRHARALRELANNTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIA-NEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEA 673
             E   + E LWR ARA  ++     DK E     QK    A++ L  +  N  C+KW  +L  L+   +    ++++ F +K+HLD A   + +   C  L  LG WCFEV++L W+ +K AA  + + PTS+  +ALE+   AE+++PGF     LYI   ++KL N  EA
Sbjct:  284 AEHGHSREFLWRLARAYVDVYFAAQDKQERMSYAQKGRDEAEAALKRNGLNAECHKWLAVLSSLSAEHDSTHSKLKSGFLLKEHLDRALRLRDDDPVCYFL--LGRWCFEVASLDWLEKKAAAALYRSAPTSSLHDALENFLKAEELSPGFSRMVRLYIAMCHKKLGNISEA 453          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Medaka
Match: ENSORLT00000041136.1 (regulator of microtubule dynamics protein 2 [Source:NCBI gene;Acc:105355721])

HSP 1 Score: 73.559 bits (179), Expect = 8.183e-15
Identity = 57/211 (27.01%), Postives = 102/211 (48.34%), Query Frame = 2
Query:   77 NEIITELDDLFAKKDFKELCQL-FETKYNTEEYQTAELLWRHARALRELANNTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDYD 706
            N ++ E+D L    +F +   L    K   E  Q +  LWR  RA  ++ + ++   E K   +    V +  +  +      ++W+ I+  +    + ++ +I+N +  K HLD A E     D    + LG WC+ V+ LSWI RK AA  F  PP++T E+AL++    E+I+P +   N +++ K Y+ L   ++A+   +     D
Sbjct:   34 NVLLKEVDRLHEGTEFDKRESLNILLKQEAEFGQDSRFLWRLTRAYCDVHDISSTLEEKKTHAETGKRVGEEAVTLNPLCAESHQWFAIMCGIMTEYDTVQNKIKNGYIFKDHLDKAIE-LKPQDPLSYYLLGRWCYSVAQLSWIERKAAAALFGEPPSATVEDALKNFLKVEEIHPAYSKFNYVFLAKCYKDLGKINKARTMCEAAYSMD 243          
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Medaka
Match: ENSORLT00000033047.1 (regulator of microtubule dynamics protein 2 [Source:NCBI gene;Acc:105355721])

HSP 1 Score: 73.9442 bits (180), Expect = 8.806e-15
Identity = 57/211 (27.01%), Postives = 102/211 (48.34%), Query Frame = 2
Query:   77 NEIITELDDLFAKKDFKELCQL-FETKYNTEEYQTAELLWRHARALRELANNTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDYD 706
            N ++ E+D L    +F +   L    K   E  Q +  LWR  RA  ++ + ++   E K   +    V +  +  +      ++W+ I+  +    + ++ +I+N +  K HLD A E     D    + LG WC+ V+ LSWI RK AA  F  PP++T E+AL++    E+I+P +   N +++ K Y+ L   ++A+   +     D
Sbjct:   34 NVLLKEVDRLHEGTEFDKRESLNILLKQEAEFGQDSRFLWRLTRAYCDVHDISSTLEEKKTHAETGKRVGEEAVTLNPLCAESHQWFAIMCGIMTEYDTVQNKIKNGYIFKDHLDKAIE-LKPQDPLSYYLLGRWCYSVAQLSWIERKAAAALFGEPPSATVEDALKNFLKVEEIHPAYSKFNYVFLAKCYKDLGKINKARTMCEAAYSMD 243          
BLAST of Regulator of microtubule dynamics protein 1 vs. Planmine SMEST
Match: SMESG000038855.1 (SMESG000038855.1)

HSP 1 Score: 420.239 bits (1079), Expect = 3.271e-150
Identity = 220/221 (99.55%), Postives = 220/221 (99.55%), Query Frame = 2
Query:   68 MSSNEIITELDDLFAKKDFKELCQLFETKYNTEEYQTAELLWRHARALRELANNTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDYDGTDVDTMN 730
            MSSNEIITELDDLFAKKDFKELCQLFETKYNTEEYQTAELLWRHARALRELANNT DKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLAATFFATPPTSTFEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDYDGTDVDTMN
Sbjct:    1 MSSNEIITELDDLFAKKDFKELCQLFETKYNTEEYQTAELLWRHARALRELANNTADKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLAATFFATPPTSTFEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDYDGTDVDTMN 221          
BLAST of Regulator of microtubule dynamics protein 1 vs. Planmine SMEST
Match: SMESG000038799.1 (SMESG000038799.1)

HSP 1 Score: 267.7 bits (683), Expect = 5.877e-90
Identity = 135/218 (61.93%), Postives = 180/218 (82.57%), Query Frame = 2
Query:   77 NEIITELDDLFAKKDFKELCQLFETKYNTEEYQTAELLWRHARALRELANNTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDYDGTDVDTMN 730
            +E I  LD L+A+K +KE C LF+ +YN++EY  +EL+WRHARALRELANN+ DK E+ +LL + L+VAK+ L+ DE++ GCNKWY  LLDLTGRIEG KKRIENS+ VKKHLDIA  K+N +D G LH+LGVWC+E+++LSW+NRK+AATFFATPPTS+++E+L++L +AEKI+PGFY+ N LY+GK YEK+    EAK YLQKC++Y+  D+DT+N
Sbjct:    5 SEAIKFLDKLYAEKKYKEQCDLFKVQYNSKEYNNSELMWRHARALRELANNSKDKKEHDKLLNEGLNVAKNCLLIDENSSGCNKWYAFLLDLTGRIEGTKKRIENSYAVKKHLDIATVKSNGTDVGALHALGVWCYEITSLSWLNRKVAATFFATPPTSSYQESLKYLEAAEKISPGFYSQNYLYLGKVYEKMGKNGEAKEYLQKCVNYNSDDMDTVN 222          
BLAST of Regulator of microtubule dynamics protein 1 vs. Planmine SMEST
Match: SMESG000038833.1 (SMESG000038833.1)

HSP 1 Score: 259.61 bits (662), Expect = 6.870e-87
Identity = 138/220 (62.73%), Postives = 172/220 (78.18%), Query Frame = 2
Query:   68 MSSNEIITELDDLFAKKDFKELCQLFETKYNTEEYQTAELLWRHARALRELANNTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDYDGTDVDTM 727
            MS  + I E+D+L   K  KE+  +FETKYN+EE+Q  +LLWR+A +L ++     DKAE+KRLL K L ++K GL  DE+N GCNKWYGILLD+TGRIEGIK+RIENSF VKKHL+IANEK+NKSDC VLH+LGVWC+EVSALSWINRK+A TFFA+PPTSTFEEAL  L  AEK  PG+ A+N +Y+GKTY +L  K EAK + QK +D+  +D DT+
Sbjct:    1 MSVAQAIAEIDELRCNKKVKEVIDVFETKYNSEEFQVPDLLWRYAASLYDIGIGEKDKAEHKRLLTKGLDMSKLGLDKDENNAGCNKWYGILLDVTGRIEGIKQRIENSFIVKKHLEIANEKSNKSDCLVLHALGVWCYEVSALSWINRKVAETFFASPPTSTFEEALVFLLDAEKKKPGYLAANYVYLGKTYFQLNQKAEAKEFFQKTIDFQASDADTV 220          
BLAST of Regulator of microtubule dynamics protein 1 vs. Planmine SMEST
Match: SMESG000038799.1 (SMESG000038799.1)

HSP 1 Score: 208.379 bits (529), Expect = 1.824e-67
Identity = 109/173 (63.01%), Postives = 145/173 (83.82%), Query Frame = 2
Query:   77 NEIITELDDLFAKKDFKELCQLFETKYNTEEYQTAELLWRHARALRELANNTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEK 595
            +E I  LD L+A+K +KE C LF+ +YN++EY  +EL+WRHARALRELANN+ DK E+ +LL + L+VAK+ L+ DE++ GCNKWY  LLDLTGRIEG KKRIENS+ VKKHLDIA  K+N +D G LH+LGVWC+E+++LSW+NRK+AATFFATPPTS+++E+L++L +AEK
Sbjct:    5 SEAIKFLDKLYAEKKYKEQCDLFKVQYNSKEYNNSELMWRHARALRELANNSKDKKEHDKLLNEGLNVAKNCLLIDENSSGCNKWYAFLLDLTGRIEGTKKRIENSYAVKKHLDIATVKSNGTDVGALHALGVWCYEITSLSWLNRKVAATFFATPPTSSYQESLKYLEAAEK 177          
BLAST of Regulator of microtubule dynamics protein 1 vs. Planmine SMEST
Match: SMESG000026356.1 (SMESG000026356.1)

HSP 1 Score: 62.7734 bits (151), Expect = 2.751e-11
Identity = 54/187 (28.88%), Postives = 91/187 (48.66%), Query Frame = 2
Query:  179 AELLWRHARALRELANNTT------DKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIEGIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRKLXXXXXXXXXXXXXEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKDEAKIYLQKCLDYDGTDVD 721
             E LWR+A     +  NTT      +   N+R+   A + A S +     +   +KW  IL  +TG +   +KRI N ++ K+H+D      N  D    H  G +C++VS L +  RK+AA  FA PP +T +EAL      E++ P  Y  N  ++   Y+ L +  ++  +++   +   +D+D
Sbjct:   62 GEFLWRYAM----ITYNTTILQDLDEDIRNQRIF-GAFNNALSAVKRSPRSSEAHKWLAILYGVTGLLSDTQKRILNGYKFKEHIDKC-LNLNPLDGYANHLKGRFCYQVSNLHFYERKIAAWLFAAPPVATLDEALILFQKCEELAPNKYGENHYFLSLCYQSLGDYSKSSKFMKSAKELPCSDID 242          
The following BLAST results are available for this feature:
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RMDN11.428e-3841.71regulator of microtubule dynamics 1 [Source:HGNC S... [more]
RMDN16.388e-3038.86regulator of microtubule dynamics 1 [Source:HGNC S... [more]
RMDN12.715e-2742.65regulator of microtubule dynamics 1 [Source:HGNC S... [more]
RMDN13.061e-2539.88regulator of microtubule dynamics 1 [Source:HGNC S... [more]
RMDN11.349e-2336.02regulator of microtubule dynamics 1 [Source:HGNC S... [more]
back to top
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F33H2.66.505e-3344.91pep chromosome:WBcel235:I:15014851:15016595:-1 gen... [more]
rmd-63.901e-1630.54Regulator of Microtubule Dynamics [Source:UniProt... [more]
rmd-31.124e-1530.54Regulator of Microtubule Dynamics [Source:UniProt... [more]
rmd-23.568e-1529.33Regulator of Microtubule Dynamics [Source:UniProt... [more]
rmd-23.568e-1529.33Regulator of Microtubule Dynamics [Source:UniProt... [more]
back to top
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rmdn14.805e-3738.79regulator of microtubule dynamics 1 [Source:ZFIN;A... [more]
rmdn31.899e-2236.21regulator of microtubule dynamics 3 [Source:ZFIN;A... [more]
rmdn32.441e-2236.21regulator of microtubule dynamics 3 [Source:ZFIN;A... [more]
back to top
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crhr21.557e-3841.71corticotropin releasing hormone receptor 2 [Source... [more]
crhr22.377e-3841.71corticotropin releasing hormone receptor 2 [Source... [more]
crhr21.782e-3238.99corticotropin releasing hormone receptor 2 [Source... [more]
sult5a15.198e-2135.29sulfotransferase family 5A, member 1 [Source:Xenba... [more]
sult5a16.085e-2135.29sulfotransferase family 5A, member 1 [Source:Xenba... [more]
back to top
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rmdn13.477e-3639.34regulator of microtubule dynamics 1 [Source:MGI Sy... [more]
Rmdn35.633e-2129.95regulator of microtubule dynamics 3 [Source:MGI Sy... [more]
Rmdn21.208e-1733.73regulator of microtubule dynamics 2 [Source:MGI Sy... [more]
Rmdn21.208e-1733.73regulator of microtubule dynamics 2 [Source:MGI Sy... [more]
Rmdn15.905e-1436.52regulator of microtubule dynamics 1 [Source:MGI Sy... [more]
back to top
BLAST of Regulator of microtubule dynamics protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q32KL4|RMD1_BOVIN3.187e-3840.74Regulator of microtubule dynamics protein 1 OS=Bos... [more]
sp|Q96DB5|RMD1_HUMAN6.857e-3841.71Regulator of microtubule dynamics protein 1 OS=Hom... [more]
sp|Q5R8E4|RMD1_PONAB2.973e-3741.71Regulator of microtubule dynamics protein 1 OS=Pon... [more]
sp|Q9DCV4|RMD1_MOUSE2.432e-3539.34Regulator of microtubule dynamics protein 1 OS=Mus... [more]
sp|Q4G069|RMD1_RAT8.455e-3540.28Regulator of microtubule dynamics protein 1 OS=Rat... [more]
back to top
BLAST of Regulator of microtubule dynamics protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8G7Y46.175e-4950.00TPR_REGION domain-containing protein OS=Macrostomu... [more]
A0A1I8J6206.206e-4950.00TPR_REGION domain-containing protein OS=Macrostomu... [more]
A0A267EG726.296e-4950.00TPR_REGION domain-containing protein (Fragment) OS... [more]
A0A267G6356.523e-4950.00TPR_REGION domain-containing protein (Fragment) OS... [more]
A0A267EID17.099e-4950.00TPR_REGION domain-containing protein (Fragment) OS... [more]
back to top
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rmdn11.379e-3740.93regulator of microtubule dynamics 1 [Source:NCBI g... [more]
rmdn12.055e-3740.93regulator of microtubule dynamics 1 [Source:NCBI g... [more]
rmdn36.646e-2335.43regulator of microtubule dynamics protein 3 [Sourc... [more]
rmdn31.877e-2235.43regulator of microtubule dynamics protein 3 [Sourc... [more]
ENSAMXT00000050699.13.046e-1831.98regulator of microtubule dynamics protein 2 [Sourc... [more]
back to top
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000003862.18.826e-3740.98pep scaffold:Pmarinus_7.0:GL489646:3760:6869:-1 ge... [more]
rmdn36.102e-2135.80regulator of microtubule dynamics 3 [Source:ZFIN;A... [more]
ENSPMAT00000009395.11.896e-1835.98pep scaffold:Pmarinus_7.0:GL478442:15946:21596:1 g... [more]
back to top
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO334673.377e-3437.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO345314.256e-2936.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320791.395e-2036.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO283386.120e-933.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Regulator of microtubule dynamics protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rmdn13.205e-3740.00regulator of microtubule dynamics 1 [Source:NCBI g... [more]
rmdn14.607e-3740.00regulator of microtubule dynamics 1 [Source:NCBI g... [more]
rmdn35.001e-1934.88regulator of microtubule dynamics protein 3 [Sourc... [more]
ENSORLT00000041136.18.183e-1527.01regulator of microtubule dynamics protein 2 [Sourc... [more]
ENSORLT00000033047.18.806e-1527.01regulator of microtubule dynamics protein 2 [Sourc... [more]
back to top
BLAST of Regulator of microtubule dynamics protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038855.13.271e-15099.55SMESG000038855.1[more]
SMESG000038799.15.877e-9061.93SMESG000038799.1[more]
SMESG000038833.16.870e-8762.73SMESG000038833.1[more]
SMESG000038799.11.824e-6763.01SMESG000038799.1[more]
SMESG000026356.12.751e-1128.88SMESG000026356.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022956 ID=SMED30022956|Name=Regulator of microtubule dynamics protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=879bp
TTAACATCAATCACAAATAATTTAATACGATTATATTTAATATTAAATTT
TTATTAATCTTTTAATAATGTCCTCCAATGAAATTATTACTGAATTAGAT
GATCTTTTCGCAAAAAAAGACTTTAAAGAATTGTGCCAATTATTTGAAAC
TAAATATAATACTGAAGAATATCAAACAGCAGAGTTATTATGGCGTCATG
CTAGAGCATTGAGAGAATTAGCCAACAATACAACTGATAAGGCTGAAAAC
AAACGTCTACTTCAAAAAGCTTTGTCGGTTGCAAAAAGTGGTCTGGTGAA
TGACGAAAGCAATGTCGGATGTAATAAATGGTACGGAATTTTGCTTGATT
TAACTGGAAGAATCGAAGGAATTAAAAAACGAATTGAAAATTCATTTGAG
GTCAAAAAACATTTGGATATAGCCAATGAGAAAGCAAATAAATCCGATTG
CGGTGTGTTGCATTCACTAGGTGTTTGGTGCTTTGAAGTTTCTGCTTTGA
GCTGGATCAATAGAAAGCTAGCGGCAACATTTTTTGCAACACCTCCTACA
TCAACATTTGAAGAGGCTCTTGAACATCTGACTTCAGCTGAAAAAATTAA
TCCTGGTTTTTATGCATCAAATTTGTTATATATTGGGAAAACGTATGAAA
AATTGAAAAATAAAGATGAAGCCAAAATTTACTTACAAAAATGTTTGGAC
TACGACGGAACCGATGTTGATACAATGAATGCGAAGGAAGAGGCGAAGGA
ATTAATGAAGAAATTGTAGGATAATTGTCGAAAATGAAAATTACTGAAAG
ATTTTTAACGTTGATATTTTCTGTTGTTGGTGTGTTTTAAATTTAGTTAA
TTGAAATCATTTGTCTTGTTGAAAAAAAA
back to top

protein sequence of SMED30022956-orf-1

>SMED30022956-orf-1 ID=SMED30022956-orf-1|Name=SMED30022956-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=234bp
MSSNEIITELDDLFAKKDFKELCQLFETKYNTEEYQTAELLWRHARALRE
LANNTTDKAENKRLLQKALSVAKSGLVNDESNVGCNKWYGILLDLTGRIE
GIKKRIENSFEVKKHLDIANEKANKSDCGVLHSLGVWCFEVSALSWINRK
LAATFFATPPTSTFEEALEHLTSAEKINPGFYASNLLYIGKTYEKLKNKD
EAKIYLQKCLDYDGTDVDTMNAKEEAKELMKKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR011990TPR-like_helical_dom_sf
IPR013026TPR-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0000922spindle pole
GO:0005737cytoplasm
GO:0005819spindle
GO:0005856cytoskeleton
GO:0005874microtubule
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 4..233
e-value: 3.1E-11
score: 45.2
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 54..229
NoneNo IPR availablePANTHERPTHR16056:SF16coord: 4..232
NoneNo IPR availablePANTHERPTHR16056UNCHARACTERIZEDcoord: 4..232
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 164..216
score: 8.755