WntA

Overview
NameWntA (ACJ64865.1)
Smed IDSMED30022929
Length (bp)2560
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WntA (SMED30022929) t-SNE clustered cells

Violin plots show distribution of expression levels for WntA (SMED30022929) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WntA (SMED30022929) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WntA (SMED30022929) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022929

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 42

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30022929SMESG000051375.1 FJ463750.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30022929SMESG000051375.1 FJ463750.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult fluorescence in situ hybridization evidence
cephalic gangliaSMED30022929SMESG000051375.1 FJ463750.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
esophagusSMED30022929SMESG000051375.1 FJ463750.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
esophagusSMED30022929SMESG000051375.1 FJ463750.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult fluorescence in situ hybridization evidence
mouthSMED30022929SMESG000051375.1 FJ463750.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30022929SMESG000051375.1 FJ463750.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30022929SMESG000051375.1 FJ463750smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30022929SMESG000051375.1 FJ463750smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult fluorescence in situ hybridization evidence
cephalic gangliaSMED30022929SMESG000051375.1 FJ463750smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
esophagusSMED30022929SMESG000051375.1 FJ463750smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult fluorescence in situ hybridization evidence
esophagusSMED30022929SMESG000051375.1 FJ463750smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
mouthSMED30022929SMESG000051375.1 FJ463750smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30022929SMESG000051375.1 FJ463750smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30022929SMESG000051375.1 ACJ64865.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30022929SMESG000051375.1 ACJ64865.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30022929SMESG000051375.1 ACJ64865.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult fluorescence in situ hybridization evidence
esophagusSMED30022929SMESG000051375.1 ACJ64865.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult fluorescence in situ hybridization evidence
esophagusSMED30022929SMESG000051375.1 ACJ64865.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
mouthSMED30022929SMESG000051375.1 ACJ64865.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30022929SMESG000051375.1 ACJ64865.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30022929SMESG000051375.1 SMESG000037126.1 dd_Smed_v4_4877_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30022929SMESG000051375.1 SMESG000037126.1 dd_Smed_v4_4877_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
nervous systemSMED30022929SMESG000051375.1 SMESG000037126.1 dd_Smed_v4_4877_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022929SMESG000051375.1 SMESG000037126.1 dd_Smed_v4_4877_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30022929SMESG000051375.1 SMESG000037126.1 dd_Smed_v4_4877_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022929SMESG000051375.1 SMESG000037126.1 dd_Smed_v4_4877_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30022929SMESG000051375.1 SMESG000037126.1 dd_Smed_v4_4877_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022929SMESG000051375.1 Contig50731newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022929SMESG000051375.1 Contig50731uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
cephalic gangliaSMED30022929SMESG000051375.1 FJ463750.1smed_ncbi_20200123PMID:18063757
Gurley et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
esophagusSMED30022929SMESG000051375.1 FJ463750.1smed_ncbi_20200123PMID:18063757
Gurley et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30022929SMESG000051375.1 FJ463750.1smed_ncbi_20200123PMID:20422023
Felix et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30022929SMESG000051375.1 FJ463750.1smed_ncbi_20200123PMID:19211673
Adell et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30022929SMESG000051375.1 FJ463750.1smed_ncbi_20200123PMID:19211673
Adell et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
mouthSMED30022929SMESG000051375.1 FJ463750.1smed_ncbi_20200123PMID:19211673
Adell et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
ventral nerve cordSMED30022929SMESG000051375.1 FJ463750.1smed_ncbi_20200123PMID:19211673
Adell et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30022929SMESG000051375.1 FJ463750smed_ncbi_20200123PMID:19211673
Adell et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30022929SMESG000051375.1 FJ463750smed_ncbi_20200123PMID:19211673
Adell et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
mouthSMED30022929SMESG000051375.1 FJ463750smed_ncbi_20200123PMID:19211673
Adell et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
ventral nerve cordSMED30022929SMESG000051375.1 FJ463750smed_ncbi_20200123PMID:19211673
Adell et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30022929SMESG000051375.1 SMESG000037126.1 dd_Smed_v4_4877_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WntA vs. Ensembl Human
Match: PRKAG1 (protein kinase AMP-activated non-catalytic subunit gamma 1 [Source:HGNC Symbol;Acc:HGNC:9385])

HSP 1 Score: 292.352 bits (747), Expect = 4.420e-91
Identity = 149/306 (48.69%), Postives = 203/306 (66.34%), Query Frame = 2
Query:  206 DSNNA-FRIFYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
            +SNN+ +  F ++H CYDL+P SSKLVVFDTSL V+KAF+AL+ NGVRA  LWD+ KQ +VGM TITDFI IL   YK +     +   LE   I +WR  Y      F  L  + P  SL  AV +L+  ++HRLPVID  SGN L+I+THKRILKFL + +   P P FM++ + ++ IGTYAN+  +R    +   L +F+Q RVSALPVVD    + DIYSKFDVINLA  +TY+ L+ S++ AL +R   FE V  CY  ++L+ +I+     EVHRL+++D+N  V+GI+SLSD+L+  +
Sbjct:   23 ESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSA---LVQIYELEEHKIETWREVY--LQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALV 323          
BLAST of WntA vs. Ensembl Human
Match: PRKAG1 (protein kinase AMP-activated non-catalytic subunit gamma 1 [Source:HGNC Symbol;Acc:HGNC:9385])

HSP 1 Score: 287.345 bits (734), Expect = 1.051e-89
Identity = 145/295 (49.15%), Postives = 196/295 (66.44%), Query Frame = 2
Query:  236 ENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
            ++H CYDL+P SSKLVVFDTSL V+KAF+AL+ NGVRA  LWD+ KQ +VGM TITDFI IL   YK +     +   LE   I +WR  Y      F  L  + P  SL  AV +L+  ++HRLPVID  SGN L+I+THKRILKFL + +   P P FM++ + ++ IGTYAN+  +R    +   L +F+Q RVSALPVVD    + DIYSKFDVINLA  +TY+ L+ S++ AL +R   FE V  CY  ++L+ +I+     EVHRL+++D+N  V+GI+SLSD+L+  +
Sbjct:    2 KSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSA---LVQIYELEEHKIETWREVY--LQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALV 291          
BLAST of WntA vs. Ensembl Human
Match: PRKAG2 (protein kinase AMP-activated non-catalytic subunit gamma 2 [Source:HGNC Symbol;Acc:HGNC:9386])

HSP 1 Score: 286.189 bits (731), Expect = 4.201e-89
Identity = 145/297 (48.82%), Postives = 201/297 (67.68%), Query Frame = 2
Query:  230 FYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
            F  +H CYD+VP SSKLVVFDT+L V+KAF+AL+ NGVRA  LW++ KQ +VGM TITDFI IL   YK   P  + ++ LE   I +WR  Y      F  L ++ P+ SL  AV +L+  ++HRLPVID ISGN L+I+THKRILKFL + +  +P PAFM Q + ++ IGTY N+  I  D  II+ L +F++ R+SALPVVD    + DIYSKFDVINLA  +TY+ L+ +++ AL +R + FE V  C + + L+ ++D     EVHRL+++++   + GIISLSD+L+  I
Sbjct:    3 FMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGVRAAPLWESKKQSFVGMLTITDFINILHRYYK--SPMVQIYE-LEEHKIETWRELY--LQETFKPLVNISPDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFMSDMPKPAFMKQNLDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALQHRSQYFEGVVKCNKLEILETIVDRIVRAEVHRLVVVNEADSIVGIISLSDILQALI 294          
BLAST of WntA vs. Ensembl Human
Match: PRKAG2 (protein kinase AMP-activated non-catalytic subunit gamma 2 [Source:HGNC Symbol;Acc:HGNC:9386])

HSP 1 Score: 286.574 bits (732), Expect = 5.736e-89
Identity = 145/297 (48.82%), Postives = 201/297 (67.68%), Query Frame = 2
Query:  230 FYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
            F  +H CYD+VP SSKLVVFDT+L V+KAF+AL+ NGVRA  LW++ KQ +VGM TITDFI IL   YK   P  + ++ LE   I +WR  Y      F  L ++ P+ SL  AV +L+  ++HRLPVID ISGN L+I+THKRILKFL + +  +P PAFM Q + ++ IGTY N+  I  D  II+ L +F++ R+SALPVVD    + DIYSKFDVINLA  +TY+ L+ +++ AL +R + FE V  C + + L+ ++D     EVHRL+++++   + GIISLSD+L+  I
Sbjct:   23 FMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGVRAAPLWESKKQSFVGMLTITDFINILHRYYK--SPMVQIYE-LEEHKIETWRELY--LQETFKPLVNISPDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFMSDMPKPAFMKQNLDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALQHRSQYFEGVVKCNKLEILETIVDRIVRAEVHRLVVVNEADSIVGIISLSDILQALI 314          
BLAST of WntA vs. Ensembl Human
Match: PRKAG2 (protein kinase AMP-activated non-catalytic subunit gamma 2 [Source:HGNC Symbol;Acc:HGNC:9386])

HSP 1 Score: 286.574 bits (732), Expect = 5.736e-89
Identity = 145/297 (48.82%), Postives = 201/297 (67.68%), Query Frame = 2
Query:  230 FYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
            F  +H CYD+VP SSKLVVFDT+L V+KAF+AL+ NGVRA  LW++ KQ +VGM TITDFI IL   YK   P  + ++ LE   I +WR  Y      F  L ++ P+ SL  AV +L+  ++HRLPVID ISGN L+I+THKRILKFL + +  +P PAFM Q + ++ IGTY N+  I  D  II+ L +F++ R+SALPVVD    + DIYSKFDVINLA  +TY+ L+ +++ AL +R + FE V  C + + L+ ++D     EVHRL+++++   + GIISLSD+L+  I
Sbjct:   23 FMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGVRAAPLWESKKQSFVGMLTITDFINILHRYYK--SPMVQIYE-LEEHKIETWRELY--LQETFKPLVNISPDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFMSDMPKPAFMKQNLDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALQHRSQYFEGVVKCNKLEILETIVDRIVRAEVHRLVVVNEADSIVGIISLSDILQALI 314          
BLAST of WntA vs. Ensembl Celegans
Match: aakg-1 (AMP-Activated protein Kinase Gamma subunit [Source:UniProtKB/TrEMBL;Acc:A0A1I6CM90])

HSP 1 Score: 288.886 bits (738), Expect = 3.261e-88
Identity = 154/338 (45.56%), Postives = 221/338 (65.38%), Query Frame = 2
Query:  131 LIVRENSATSHSFKSLSSVTIQG-----FFDSNNA-FRIFYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFIRD 1126
            L+++E S  S SF S+S  T        FFD+++A + +F + H CYDL+P SSKLVVFDT L V+KAFYAL+YNGVRA  LWD D Q + GM TITDFIKILC  Y   G + ER + LE Q I+ WR ++   D        + P +SL +AV+ L   +VHRLPV+D  +GN  +I+THKRI+KFL + +  LP P+FM+    ++ IG + ++    +D  I + L +FL+ RVSALP++D +  + DIY+KFDVI+LA   +Y +L+ ++ +AL +R + FE V TC  TDSL  V++     EVHRLI+ D++ +V G++SLSD+L+  + D
Sbjct:   73 LLIKEASLFS-SFDSMSIGTAVPDINAIFFDNHDAVYSLFMKAHKCYDLIPTSSKLVVFDTHLPVRKAFYALVYNGVRAAPLWDTDNQRFTGMLTITDFIKILCKHYD-KGDNSERIRALEDQQISHWRDQFEL-DGTLRPFVYIDPNESLHRAVELLCESKVHRLPVLDRKTGNITYILTHKRIMKFLSLYMRDLPRPSFMSCTPRELGIGAWGDILCCHVDTPIHDALELFLKNRVSALPLIDENGRVVDIYAKFDVISLAAESSYDKLDCTVQEALQHRSEWFEGVQTCLETDSLFQVLEAIVKAEVHRLIVTDQDKKVVGVVSLSDILKNLVLD 407          
BLAST of WntA vs. Ensembl Celegans
Match: aakg-1 (AMP-Activated protein Kinase Gamma subunit [Source:UniProtKB/TrEMBL;Acc:A0A1I6CM90])

HSP 1 Score: 287.73 bits (735), Expect = 4.407e-88
Identity = 145/310 (46.77%), Postives = 208/310 (67.10%), Query Frame = 2
Query:  200 FFDSNNA-FRIFYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFIRD 1126
            FFD+++A + +F + H CYDL+P SSKLVVFDT L V+KAFYAL+YNGVRA  LWD D Q + GM TITDFIKILC  Y   G + ER + LE Q I+ WR ++   D        + P +SL +AV+ L   +VHRLPV+D  +GN  +I+THKRI+KFL + +  LP P+FM+    ++ IG + ++    +D  I + L +FL+ RVSALP++D +  + DIY+KFDVI+LA   +Y +L+ ++ +AL +R + FE V TC  TDSL  V++     EVHRLI+ D++ +V G++SLSD+L+  + D
Sbjct:   73 FFDNHDAVYSLFMKAHKCYDLIPTSSKLVVFDTHLPVRKAFYALVYNGVRAAPLWDTDNQRFTGMLTITDFIKILCKHYD-KGDNSERIRALEDQQISHWRDQFEL-DGTLRPFVYIDPNESLHRAVELLCESKVHRLPVLDRKTGNITYILTHKRIMKFLSLYMRDLPRPSFMSCTPRELGIGAWGDILCCHVDTPIHDALELFLKNRVSALPLIDENGRVVDIYAKFDVISLAAESSYDKLDCTVQEALQHRSEWFEGVQTCLETDSLFQVLEAIVKAEVHRLIVTDQDKKVVGVVSLSDILKNLVLD 380          
BLAST of WntA vs. Ensembl Celegans
Match: aakg-1 (AMP-Activated protein Kinase Gamma subunit [Source:UniProtKB/TrEMBL;Acc:A0A1I6CM90])

HSP 1 Score: 279.256 bits (713), Expect = 5.209e-86
Identity = 140/295 (47.46%), Postives = 197/295 (66.78%), Query Frame = 2
Query:  242 HSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFIRD 1126
            H CYDL+P SSKLVVFDT L V+KAFYAL+YNGVRA  LWD D Q + GM TITDFIKILC  Y   G + ER + LE Q I+ WR ++   D        + P +SL +AV+ L   +VHRLPV+D  +GN  +I+THKRI+KFL + +  LP P+FM+    ++ IG + ++    +D  I + L +FL+ RVSALP++D +  + DIY+KFDVI+LA   +Y +L+ ++ +AL +R + FE V TC  TDSL  V++     EVHRLI+ D++ +V G++SLSD+L+  + D
Sbjct:    4 HKCYDLIPTSSKLVVFDTHLPVRKAFYALVYNGVRAAPLWDTDNQRFTGMLTITDFIKILCKHYD-KGDNSERIRALEDQQISHWRDQFEL-DGTLRPFVYIDPNESLHRAVELLCESKVHRLPVLDRKTGNITYILTHKRIMKFLSLYMRDLPRPSFMSCTPRELGIGAWGDILCCHVDTPIHDALELFLKNRVSALPLIDENGRVVDIYAKFDVISLAAESSYDKLDCTVQEALQHRSEWFEGVQTCLETDSLFQVLEAIVKAEVHRLIVTDQDKKVVGVVSLSDILKNLVLD 296          
BLAST of WntA vs. Ensembl Celegans
Match: aakg-1 (AMP-Activated protein Kinase Gamma subunit [Source:UniProtKB/TrEMBL;Acc:A0A1I6CM90])

HSP 1 Score: 288.5 bits (737), Expect = 1.452e-85
Identity = 154/338 (45.56%), Postives = 221/338 (65.38%), Query Frame = 2
Query:  131 LIVRENSATSHSFKSLSSVTIQG-----FFDSNNA-FRIFYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFIRD 1126
            L+++E S  S SF S+S  T        FFD+++A + +F + H CYDL+P SSKLVVFDT L V+KAFYAL+YNGVRA  LWD D Q + GM TITDFIKILC  Y   G + ER + LE Q I+ WR ++   D        + P +SL +AV+ L   +VHRLPV+D  +GN  +I+THKRI+KFL + +  LP P+FM+    ++ IG + ++    +D  I + L +FL+ RVSALP++D +  + DIY+KFDVI+LA   +Y +L+ ++ +AL +R + FE V TC  TDSL  V++     EVHRLI+ D++ +V G++SLSD+L+  + D
Sbjct:  311 LLIKEASLFS-SFDSMSIGTAVPDINAIFFDNHDAVYSLFMKAHKCYDLIPTSSKLVVFDTHLPVRKAFYALVYNGVRAAPLWDTDNQRFTGMLTITDFIKILCKHYD-KGDNSERIRALEDQQISHWRDQFEL-DGTLRPFVYIDPNESLHRAVELLCESKVHRLPVLDRKTGNITYILTHKRIMKFLSLYMRDLPRPSFMSCTPRELGIGAWGDILCCHVDTPIHDALELFLKNRVSALPLIDENGRVVDIYAKFDVISLAAESSYDKLDCTVQEALQHRSEWFEGVQTCLETDSLFQVLEAIVKAEVHRLIVTDQDKKVVGVVSLSDILKNLVLD 645          
BLAST of WntA vs. Ensembl Celegans
Match: aakg-1 (AMP-Activated protein Kinase Gamma subunit [Source:UniProtKB/TrEMBL;Acc:A0A1I6CM90])

HSP 1 Score: 288.5 bits (737), Expect = 1.614e-85
Identity = 154/338 (45.56%), Postives = 221/338 (65.38%), Query Frame = 2
Query:  131 LIVRENSATSHSFKSLSSVTIQG-----FFDSNNA-FRIFYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFIRD 1126
            L+++E S  S SF S+S  T        FFD+++A + +F + H CYDL+P SSKLVVFDT L V+KAFYAL+YNGVRA  LWD D Q + GM TITDFIKILC  Y   G + ER + LE Q I+ WR ++   D        + P +SL +AV+ L   +VHRLPV+D  +GN  +I+THKRI+KFL + +  LP P+FM+    ++ IG + ++    +D  I + L +FL+ RVSALP++D +  + DIY+KFDVI+LA   +Y +L+ ++ +AL +R + FE V TC  TDSL  V++     EVHRLI+ D++ +V G++SLSD+L+  + D
Sbjct:  314 LLIKEASLFS-SFDSMSIGTAVPDINAIFFDNHDAVYSLFMKAHKCYDLIPTSSKLVVFDTHLPVRKAFYALVYNGVRAAPLWDTDNQRFTGMLTITDFIKILCKHYD-KGDNSERIRALEDQQISHWRDQFEL-DGTLRPFVYIDPNESLHRAVELLCESKVHRLPVLDRKTGNITYILTHKRIMKFLSLYMRDLPRPSFMSCTPRELGIGAWGDILCCHVDTPIHDALELFLKNRVSALPLIDENGRVVDIYAKFDVISLAAESSYDKLDCTVQEALQHRSEWFEGVQTCLETDSLFQVLEAIVKAEVHRLIVTDQDKKVVGVVSLSDILKNLVLD 648          
BLAST of WntA vs. Ensembl Fly
Match: SNF4Agamma (gene:FBgn0264357 transcript:FBtr0110937)

HSP 1 Score: 286.96 bits (733), Expect = 1.050e-86
Identity = 152/336 (45.24%), Postives = 215/336 (63.99%), Query Frame = 2
Query:  137 VRENSATSHSFKSLSSVTIQGFFDSNNAFRIFYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFIRDHPSDGV 1144
            ++E    S ++K L +  ++   D +  F  F+  H CYDL+P S+KLVVFDT L V+KAFYAL+YNGVRA  LWD++KQ +VGM TITDFIKIL   YK      E+   LE   + +WRS      +    L S+ P+ SL  A++ L+  R+HRLPVID  +GN L+I+THKRIL+FL + +  LP PA+M + + ++ IGTY N+       +II  L  F++ RVSALP+VD+D  L DIY+KFDVINLA  +TY+ L+ S+  A  +R + FE V  C   +SL  +++     EVHRL+++D+N +V GIISLSD+L + +     +GV
Sbjct:   34 IKEFEQISEAWKRLLAELLKKEEDDSQIFVKFFRFHKCYDLIPTSAKLVVFDTQLLVKKAFYALVYNGVRAAPLWDSEKQQFVGMLTITDFIKILQMYYKSPNASMEQ---LEEHKLDTWRS---VLHNQVMPLVSIGPDASLYDAIKILIHSRIHRLPVIDPATGNVLYILTHKRILRFLFLYINELPKPAYMQKSLRELKIGTYNNIETADETTSIITALKKFVERRVSALPLVDSDGRLVDIYAKFDVINLAAEKTYNDLDVSLRKANEHRNEWFEGVQKCNLDESLYTIMERIVRAEVHRLVVVDENRKVIGIISLSDILLYLVLRPSGEGV 363          
BLAST of WntA vs. Ensembl Fly
Match: SNF4Agamma (gene:FBgn0264357 transcript:FBtr0112915)

HSP 1 Score: 281.182 bits (718), Expect = 7.852e-84
Identity = 148/313 (47.28%), Postives = 204/313 (65.18%), Query Frame = 2
Query:  206 DSNNAFRIFYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFIRDHPSDGV 1144
            D +  F  F+  H CYDL+P S+KLVVFDT L V+KAFYAL+YNGVRA  LWD++KQ +VGM TITDFIKIL   YK      E+   LE   + +WRS      +    L S+ P+ SL  A++ L+  R+HRLPVID  +GN L+I+THKRIL+FL + +  LP PA+M + + ++ IGTY N+       +II  L  F++ RVSALP+VD+D  L DIY+KFDVINLA  +TY+ L+ S+  A  +R + FE V  C   +SL  +++     EVHRL+++D+N +V GIISLSD+L + +     +GV
Sbjct:  133 DDSQIFVKFFRFHKCYDLIPTSAKLVVFDTQLLVKKAFYALVYNGVRAAPLWDSEKQQFVGMLTITDFIKILQMYYKSPNASMEQ---LEEHKLDTWRS---VLHNQVMPLVSIGPDASLYDAIKILIHSRIHRLPVIDPATGNVLYILTHKRILRFLFLYINELPKPAYMQKSLRELKIGTYNNIETADETTSIITALKKFVERRVSALPLVDSDGRLVDIYAKFDVINLAAEKTYNDLDVSLRKANEHRNEWFEGVQKCNLDESLYTIMERIVRAEVHRLVVVDENRKVIGIISLSDILLYLVLRPSGEGV 439          
BLAST of WntA vs. Ensembl Fly
Match: SNF4Agamma (gene:FBgn0264357 transcript:FBtr0112916)

HSP 1 Score: 281.182 bits (718), Expect = 7.852e-84
Identity = 148/313 (47.28%), Postives = 204/313 (65.18%), Query Frame = 2
Query:  206 DSNNAFRIFYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFIRDHPSDGV 1144
            D +  F  F+  H CYDL+P S+KLVVFDT L V+KAFYAL+YNGVRA  LWD++KQ +VGM TITDFIKIL   YK      E+   LE   + +WRS      +    L S+ P+ SL  A++ L+  R+HRLPVID  +GN L+I+THKRIL+FL + +  LP PA+M + + ++ IGTY N+       +II  L  F++ RVSALP+VD+D  L DIY+KFDVINLA  +TY+ L+ S+  A  +R + FE V  C   +SL  +++     EVHRL+++D+N +V GIISLSD+L + +     +GV
Sbjct:  133 DDSQIFVKFFRFHKCYDLIPTSAKLVVFDTQLLVKKAFYALVYNGVRAAPLWDSEKQQFVGMLTITDFIKILQMYYKSPNASMEQ---LEEHKLDTWRS---VLHNQVMPLVSIGPDASLYDAIKILIHSRIHRLPVIDPATGNVLYILTHKRILRFLFLYINELPKPAYMQKSLRELKIGTYNNIETADETTSIITALKKFVERRVSALPLVDSDGRLVDIYAKFDVINLAAEKTYNDLDVSLRKANEHRNEWFEGVQKCNLDESLYTIMERIVRAEVHRLVVVDENRKVIGIISLSDILLYLVLRPSGEGV 439          
BLAST of WntA vs. Ensembl Fly
Match: SNF4Agamma (gene:FBgn0264357 transcript:FBtr0301585)

HSP 1 Score: 281.182 bits (718), Expect = 7.852e-84
Identity = 148/313 (47.28%), Postives = 204/313 (65.18%), Query Frame = 2
Query:  206 DSNNAFRIFYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFIRDHPSDGV 1144
            D +  F  F+  H CYDL+P S+KLVVFDT L V+KAFYAL+YNGVRA  LWD++KQ +VGM TITDFIKIL   YK      E+   LE   + +WRS      +    L S+ P+ SL  A++ L+  R+HRLPVID  +GN L+I+THKRIL+FL + +  LP PA+M + + ++ IGTY N+       +II  L  F++ RVSALP+VD+D  L DIY+KFDVINLA  +TY+ L+ S+  A  +R + FE V  C   +SL  +++     EVHRL+++D+N +V GIISLSD+L + +     +GV
Sbjct:  133 DDSQIFVKFFRFHKCYDLIPTSAKLVVFDTQLLVKKAFYALVYNGVRAAPLWDSEKQQFVGMLTITDFIKILQMYYKSPNASMEQ---LEEHKLDTWRS---VLHNQVMPLVSIGPDASLYDAIKILIHSRIHRLPVIDPATGNVLYILTHKRILRFLFLYINELPKPAYMQKSLRELKIGTYNNIETADETTSIITALKKFVERRVSALPLVDSDGRLVDIYAKFDVINLAAEKTYNDLDVSLRKANEHRNEWFEGVQKCNLDESLYTIMERIVRAEVHRLVVVDENRKVIGIISLSDILLYLVLRPSGEGV 439          
BLAST of WntA vs. Ensembl Fly
Match: SNF4Agamma (gene:FBgn0264357 transcript:FBtr0084024)

HSP 1 Score: 280.026 bits (715), Expect = 1.518e-81
Identity = 148/313 (47.28%), Postives = 204/313 (65.18%), Query Frame = 2
Query:  206 DSNNAFRIFYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFIRDHPSDGV 1144
            D +  F  F+  H CYDL+P S+KLVVFDT L V+KAFYAL+YNGVRA  LWD++KQ +VGM TITDFIKIL   YK      E+   LE   + +WRS      +    L S+ P+ SL  A++ L+  R+HRLPVID  +GN L+I+THKRIL+FL + +  LP PA+M + + ++ IGTY N+       +II  L  F++ RVSALP+VD+D  L DIY+KFDVINLA  +TY+ L+ S+  A  +R + FE V  C   +SL  +++     EVHRL+++D+N +V GIISLSD+L + +     +GV
Sbjct:  333 DDSQIFVKFFRFHKCYDLIPTSAKLVVFDTQLLVKKAFYALVYNGVRAAPLWDSEKQQFVGMLTITDFIKILQMYYKSPNASMEQ---LEEHKLDTWRS---VLHNQVMPLVSIGPDASLYDAIKILIHSRIHRLPVIDPATGNVLYILTHKRILRFLFLYINELPKPAYMQKSLRELKIGTYNNIETADETTSIITALKKFVERRVSALPLVDSDGRLVDIYAKFDVINLAAEKTYNDLDVSLRKANEHRNEWFEGVQKCNLDESLYTIMERIVRAEVHRLVVVDENRKVIGIISLSDILLYLVLRPSGEGV 639          
BLAST of WntA vs. Ensembl Zebrafish
Match: prkag1 (protein kinase, AMP-activated, gamma 1 non-catalytic subunit [Source:ZFIN;Acc:ZDB-GENE-040426-2188])

HSP 1 Score: 294.664 bits (753), Expect = 3.095e-92
Identity = 151/309 (48.87%), Postives = 209/309 (67.64%), Query Frame = 2
Query:  215 NAFRIFYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFIRDHPSDG 1141
            N +  F ++H CYDLVP SSKLVVFDTSL V+KAF+AL+ NGVRA  LWD+ KQ +VGM TITDFI IL   YK   P  + ++ LE   I +WR  Y      F  L S+ P  SL  AV +LL  ++HRLPVID ++GN L+I+THKRILKFL + +  +P PAF++Q + ++ IGT+ N+  +  D  +   L +F++ RVSALPVVD +  + DIYSKFDVINLA  +TY+ L+ +++ AL +R + FE V TC  +++LQA+I+     EVHRL+I+D+   V+GI+SLSD+L+  +     DG
Sbjct:   25 NVYTRFMKSHRCYDLVPTSSKLVVFDTSLQVKKAFFALVSNGVRAAPLWDSKKQCFVGMLTITDFINILHRYYK--SPLVQIYE-LEEHKIETWREVY--LQDSFKPLVSISPNASLYDAVSSLLKHKIHRLPVIDPLTGNALYILTHKRILKFLKLFISEIPKPAFLSQTLEELNIGTFDNIAVVHSDTPLYAALGIFVEQRVSALPVVDENGRVVDIYSKFDVINLAAEKTYNNLDITVTKALQHRSQYFEGVLTCRASETLQAIINRLVEAEVHRLVIVDEQEVVKGIVSLSDILQALVLTSGDDG 328          
BLAST of WntA vs. Ensembl Zebrafish
Match: prkag2a (protein kinase, AMP-activated, gamma 2 non-catalytic subunit a [Source:ZFIN;Acc:ZDB-GENE-060929-160])

HSP 1 Score: 293.508 bits (750), Expect = 7.884e-92
Identity = 146/297 (49.16%), Postives = 203/297 (68.35%), Query Frame = 2
Query:  230 FYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
            F ++H CYD+VP SSKLVVFDT+L V+KAF+AL+ NGVRA  LW+  KQ +VGM TITDFI IL   YK   P  + ++ LE   I +WR  Y      F  L ++ P+ S+  AV +L+  ++HRLPVID +SGN L+I+THKRILKFL + +  +P PAFM Q + ++ IGTY N+  I  D  II+ L++F+  RVSALPVVD    + DIYSKFDVINLA  +TY+ L+ S++ AL +R + FE V  C R ++L+ ++D     EVHRL+++D+N  + GI+SLSD+L+  +
Sbjct:   23 FMKSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGVRAAPLWETKKQSFVGMLTITDFINILHRYYK--SPMVQIYE-LEEHKIETWRELY--LQETFKPLVNISPDASIFDAVYSLIKNKIHRLPVIDPVSGNALYILTHKRILKFLQLFVCEMPKPAFMKQTLEELSIGTYNNIAFIHPDTPIIKALSIFVDRRVSALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDISVTQALMHRSQYFEGVMKCNRLETLETIVDRIVKAEVHRLVVVDENGSIVGIVSLSDILQALV 314          
BLAST of WntA vs. Ensembl Zebrafish
Match: prkag2a (protein kinase, AMP-activated, gamma 2 non-catalytic subunit a [Source:ZFIN;Acc:ZDB-GENE-060929-160])

HSP 1 Score: 293.508 bits (750), Expect = 2.558e-90
Identity = 146/297 (49.16%), Postives = 203/297 (68.35%), Query Frame = 2
Query:  230 FYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
            F ++H CYD+VP SSKLVVFDT+L V+KAF+AL+ NGVRA  LW+  KQ +VGM TITDFI IL   YK   P  + ++ LE   I +WR  Y      F  L ++ P+ S+  AV +L+  ++HRLPVID +SGN L+I+THKRILKFL + +  +P PAFM Q + ++ IGTY N+  I  D  II+ L++F+  RVSALPVVD    + DIYSKFDVINLA  +TY+ L+ S++ AL +R + FE V  C R ++L+ ++D     EVHRL+++D+N  + GI+SLSD+L+  +
Sbjct:  129 FMKSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGVRAAPLWETKKQSFVGMLTITDFINILHRYYK--SPMVQIYE-LEEHKIETWRELY--LQETFKPLVNISPDASIFDAVYSLIKNKIHRLPVIDPVSGNALYILTHKRILKFLQLFVCEMPKPAFMKQTLEELSIGTYNNIAFIHPDTPIIKALSIFVDRRVSALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDISVTQALMHRSQYFEGVMKCNRLETLETIVDRIVKAEVHRLVVVDENGSIVGIVSLSDILQALV 420          
BLAST of WntA vs. Ensembl Zebrafish
Match: prkag2b (protein kinase, AMP-activated, gamma 2 non-catalytic subunit b [Source:ZFIN;Acc:ZDB-GENE-070912-442])

HSP 1 Score: 292.352 bits (747), Expect = 3.264e-89
Identity = 145/297 (48.82%), Postives = 199/297 (67.00%), Query Frame = 2
Query:  230 FYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
            F  +H CYDL+P SSKLVVFDT+L V+KAF+AL+ NGVRA  LW+   Q +VGM TITDFI IL   YK       +   LE   I +WR  Y      F  L ++ P  ++  AV +L+  ++HRLPVID ++GN L+I+THKRILKFL + +  +P PAFM Q + ++ IGTY+N+  I  D  II+ L MF++ RVSALPVVD    + DIYSKFDVINLA  +TY+ L+ +++ AL +R + FE V  CYR ++L+ ++D     EVHRL+++D N  +EGIISLSD+L+  +
Sbjct:  188 FMMSHKCYDLIPTSSKLVVFDTTLQVKKAFFALVANGVRAAPLWETKTQSFVGMLTITDFIIILHRYYKS---PLVQIYALEEHKIETWRELY--LQETFKPLVNISPNANIFNAVYSLIKNKIHRLPVIDPVTGNALYILTHKRILKFLQLFVCEMPKPAFMKQTLVELGIGTYSNIAYIHPDTPIIKALGMFVERRVSALPVVDVTGKVVDIYSKFDVINLAAEKTYNNLDITVTQALLHRSQYFEGVMKCYRHETLETIVDRIVKAEVHRLVVVDDNSSIEGIISLSDILQALV 479          
BLAST of WntA vs. Ensembl Zebrafish
Match: prkag2b (protein kinase, AMP-activated, gamma 2 non-catalytic subunit b [Source:ZFIN;Acc:ZDB-GENE-070912-442])

HSP 1 Score: 292.738 bits (748), Expect = 8.349e-89
Identity = 146/297 (49.16%), Postives = 201/297 (67.68%), Query Frame = 2
Query:  230 FYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
            F  +H CYDL+P SSKLVVFDT+L V+KAF+AL+ NGVRA  LW+   Q +VGM TITDFI IL   YK   P  + +  LE   I +WR  Y      F  L ++ P  ++  AV +L+  ++HRLPVID ++GN L+I+THKRILKFL + +  +P PAFM Q + ++ IGTY+N+  I  D  II+ L MF++ RVSALPVVD    + DIYSKFDVINLA  +TY+ L+ +++ AL +R + FE V  CYR ++L+ ++D     EVHRL+++D N  +EGIISLSD+L+  +
Sbjct:  233 FMMSHKCYDLIPTSSKLVVFDTTLQVKKAFFALVANGVRAAPLWETKTQSFVGMLTITDFIIILHRYYK--SPLVQIYA-LEEHKIETWRELY--LQETFKPLVNISPNANIFNAVYSLIKNKIHRLPVIDPVTGNALYILTHKRILKFLQLFVCEMPKPAFMKQTLVELGIGTYSNIAYIHPDTPIIKALGMFVERRVSALPVVDVTGKVVDIYSKFDVINLAAEKTYNNLDITVTQALLHRSQYFEGVMKCYRHETLETIVDRIVKAEVHRLVVVDDNSSIEGIISLSDILQALV 524          
BLAST of WntA vs. Ensembl Xenopus
Match: c1orf50 (chromosome 1 open reading frame 50 [Source:Xenbase;Acc:XB-GENE-1004912])

HSP 1 Score: 288.886 bits (738), Expect = 5.386e-90
Identity = 150/315 (47.62%), Postives = 207/315 (65.71%), Query Frame = 2
Query:  176 LSSVTIQGFFDSNNAFRIFYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
            L  +T++     +  +  F +NH CYDL+P SSKLVVFDTSL V+KAF+AL+ NGVRA  LWD+ KQ +VGM TITDFI IL   YK   P  + ++ LE   I +WR  Y      F  L S+ P  SL  AV +L+  R+HRLPVI   SGN L+I+THKRILKFL + +  +  PAF+T+ + D+ IGTY N+  +R D  +   L +F+Q RVSALPVVD    + DIYSKFDVINLA  +TY+ L+ +++ AL +R   FE V  CY+ ++L+ +I+     EVHRL+++D+N   +GI+SLSD+L+  +
Sbjct:   10 LCVLTLKFLESDSGVYTRFMKNHKCYDLIPISSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQGFVGMLTITDFINILHRYYK--SPMVQIYE-LEEHKIETWRELY--LQDSFKPLVSISPSASLFDAVSSLIKNRIHRLPVISPDSGNTLYILTHKRILKFLKLFMSEVEKPAFVTKSLKDLHIGTYENIALVRPDTPVYVALGIFVQRRVSALPVVDDSGRVVDIYSKFDVINLAAEKTYNNLDITVTKALGHRSHYFEGVLKCYQHETLETIINRLVEAEVHRLVVVDENDVAKGIVSLSDILQCLV 319          
BLAST of WntA vs. Ensembl Xenopus
Match: c1orf50 (chromosome 1 open reading frame 50 [Source:Xenbase;Acc:XB-GENE-1004912])

HSP 1 Score: 288.886 bits (738), Expect = 5.838e-90
Identity = 148/297 (49.83%), Postives = 200/297 (67.34%), Query Frame = 2
Query:  230 FYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
            F +NH CYDL+P SSKLVVFDTSL V+KAF+AL+ NGVRA  LWD+ KQ +VGM TITDFI IL   YK   P  + ++ LE   I +WR  Y      F  L S+ P  SL  AV +L+  R+HRLPVI   SGN L+I+THKRILKFL + +  +  PAF+T+ + D+ IGTY N+  +R D  +   L +F+Q RVSALPVVD    + DIYSKFDVINLA  +TY+ L+ +++ AL +R   FE V  CY+ ++L+ +I+     EVHRL+++D+N   +GI+SLSD+L+  +
Sbjct:   24 FMKNHKCYDLIPISSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQGFVGMLTITDFINILHRYYK--SPMVQIYE-LEEHKIETWRELY--LQDSFKPLVSISPSASLFDAVSSLIKNRIHRLPVISPDSGNTLYILTHKRILKFLKLFMSEVEKPAFVTKSLKDLHIGTYENIALVRPDTPVYVALGIFVQRRVSALPVVDDSGRVVDIYSKFDVINLAAEKTYNNLDITVTKALGHRSHYFEGVLKCYQHETLETIINRLVEAEVHRLVVVDENDVAKGIVSLSDILQCLV 315          
BLAST of WntA vs. Ensembl Xenopus
Match: c1orf50 (chromosome 1 open reading frame 50 [Source:Xenbase;Acc:XB-GENE-1004912])

HSP 1 Score: 288.886 bits (738), Expect = 8.689e-90
Identity = 148/297 (49.83%), Postives = 200/297 (67.34%), Query Frame = 2
Query:  230 FYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
            F +NH CYDL+P SSKLVVFDTSL V+KAF+AL+ NGVRA  LWD+ KQ +VGM TITDFI IL   YK   P  + ++ LE   I +WR  Y      F  L S+ P  SL  AV +L+  R+HRLPVI   SGN L+I+THKRILKFL + +  +  PAF+T+ + D+ IGTY N+  +R D  +   L +F+Q RVSALPVVD    + DIYSKFDVINLA  +TY+ L+ +++ AL +R   FE V  CY+ ++L+ +I+     EVHRL+++D+N   +GI+SLSD+L+  +
Sbjct:   33 FMKNHKCYDLIPISSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQGFVGMLTITDFINILHRYYK--SPMVQIYE-LEEHKIETWRELY--LQDSFKPLVSISPSASLFDAVSSLIKNRIHRLPVISPDSGNTLYILTHKRILKFLKLFMSEVEKPAFVTKSLKDLHIGTYENIALVRPDTPVYVALGIFVQRRVSALPVVDDSGRVVDIYSKFDVINLAAEKTYNNLDITVTKALGHRSHYFEGVLKCYQHETLETIINRLVEAEVHRLVVVDENDVAKGIVSLSDILQCLV 324          
BLAST of WntA vs. Ensembl Xenopus
Match: c1orf50 (chromosome 1 open reading frame 50 [Source:Xenbase;Acc:XB-GENE-1004912])

HSP 1 Score: 287.73 bits (735), Expect = 1.589e-89
Identity = 148/297 (49.83%), Postives = 200/297 (67.34%), Query Frame = 2
Query:  230 FYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
            F +NH CYDL+P SSKLVVFDTSL V+KAF+AL+ NGVRA  LWD+ KQ +VGM TITDFI IL   YK   P  + ++ LE   I +WR  Y      F  L S+ P  SL  AV +L+  R+HRLPVI   SGN L+I+THKRILKFL + +  +  PAF+T+ + D+ IGTY N+  +R D  +   L +F+Q RVSALPVVD    + DIYSKFDVINLA  +TY+ L+ +++ AL +R   FE V  CY+ ++L+ +I+     EVHRL+++D+N   +GI+SLSD+L+  +
Sbjct:   30 FMKNHKCYDLIPISSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQGFVGMLTITDFINILHRYYK--SPMVQIYE-LEEHKIETWRELY--LQDSFKPLVSISPSASLFDAVSSLIKNRIHRLPVISPDSGNTLYILTHKRILKFLKLFMSEVEKPAFVTKSLKDLHIGTYENIALVRPDTPVYVALGIFVQRRVSALPVVDDSGRVVDIYSKFDVINLAAEKTYNNLDITVTKALGHRSHYFEGVLKCYQHETLETIINRLVEAEVHRLVVVDENDVAKGIVSLSDILQCLV 321          
BLAST of WntA vs. Ensembl Xenopus
Match: c1orf50 (chromosome 1 open reading frame 50 [Source:Xenbase;Acc:XB-GENE-1004912])

HSP 1 Score: 287.73 bits (735), Expect = 3.067e-89
Identity = 151/311 (48.55%), Postives = 207/311 (66.56%), Query Frame = 2
Query:  191 IQGFFDSNNA-FRIFYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
            I  F +S++  +  F +NH CYDL+P SSKLVVFDTSL V+KAF+AL+ NGVRA  LWD+ KQ +VGM TITDFI IL   YK   P  + ++ LE   I +WR  Y      F  L S+ P  SL  AV +L+  R+HRLPVI   SGN L+I+THKRILKFL + +  +  PAF+T+ + D+ IGTY N+  +R D  +   L +F+Q RVSALPVVD    + DIYSKFDVINLA  +TY+ L+ +++ AL +R   FE V  CY+ ++L+ +I+     EVHRL+++D+N   +GI+SLSD+L+  +
Sbjct:   29 ITLFLESDSGVYTRFMKNHKCYDLIPISSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQGFVGMLTITDFINILHRYYK--SPMVQIYE-LEEHKIETWRELY--LQDSFKPLVSISPSASLFDAVSSLIKNRIHRLPVISPDSGNTLYILTHKRILKFLKLFMSEVEKPAFVTKSLKDLHIGTYENIALVRPDTPVYVALGIFVQRRVSALPVVDDSGRVVDIYSKFDVINLAAEKTYNNLDITVTKALGHRSHYFEGVLKCYQHETLETIINRLVEAEVHRLVVVDENDVAKGIVSLSDILQCLV 334          
BLAST of WntA vs. Ensembl Mouse
Match: Prkag1 (protein kinase, AMP-activated, gamma 1 non-catalytic subunit [Source:MGI Symbol;Acc:MGI:108411])

HSP 1 Score: 291.582 bits (745), Expect = 5.937e-91
Identity = 152/326 (46.63%), Postives = 210/326 (64.42%), Query Frame = 2
Query:  146 NSATSHSFKSLSSVTIQGFFDSNNA-FRIFYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
             S  + S  +L +   Q   +SNN+ +  F ++H CYDL+P SSKLVVFDTSL V+KAF+AL+ NGVRA  LWD+ KQ +VGM TITDFI IL   YK +     +   LE   I +WR  Y      F  L  + P  SL  AV +L+  ++HRLPVID  SGN L+I+THKRILKFL + +   P P FM++ + ++ IGTYAN+  +R    +   L +F+Q RVSALPVVD    + DIYSKFDVINLA  +TY+ L+ S++ AL +R   FE V  CY  ++L+ +I+     EVHRL+++D++  V+GI+SLSD+L+  +
Sbjct:    2 ESVAAESSPALENEHFQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSA---LVQIYELEEHKIETWREVY--LQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLQELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDEHDVVKGIVSLSDILQALV 322          
BLAST of WntA vs. Ensembl Mouse
Match: Prkag2 (protein kinase, AMP-activated, gamma 2 non-catalytic subunit [Source:MGI Symbol;Acc:MGI:1336153])

HSP 1 Score: 288.115 bits (736), Expect = 8.158e-90
Identity = 145/297 (48.82%), Postives = 202/297 (68.01%), Query Frame = 2
Query:  230 FYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
            F  +H CYD+VP SSKLVVFDT+L V+KAF+AL+ NGVRA  LW++ KQ +VGM TITDFI IL   YK   P  + ++ LE   I +WR  Y      F  L ++ P+ SL  AV +L+  ++HRLPVID ISGN L+I+THKRILKFL + +  +P PAFM Q + ++ IGTY N+  I  D  II+ L +F++ R+SALPVVD    + DIYSKFDVINLA  +TY+ L+ +++ AL +R + FE V  C + ++L+ ++D     EVHRL+++++   + GIISLSD+L+  I
Sbjct:   21 FMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGVRAAPLWESKKQSFVGMLTITDFINILHRYYK--SPMVQIYE-LEEHKIETWRELY--LQETFKPLVNISPDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFMSDMPKPAFMKQNLDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALQHRSQYFEGVVKCSKLETLETIVDRIVRAEVHRLVVVNEADSIVGIISLSDILQALI 312          
BLAST of WntA vs. Ensembl Mouse
Match: Prkag2 (protein kinase, AMP-activated, gamma 2 non-catalytic subunit [Source:MGI Symbol;Acc:MGI:1336153])

HSP 1 Score: 286.96 bits (733), Expect = 7.909e-88
Identity = 145/297 (48.82%), Postives = 202/297 (68.01%), Query Frame = 2
Query:  230 FYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
            F  +H CYD+VP SSKLVVFDT+L V+KAF+AL+ NGVRA  LW++ KQ +VGM TITDFI IL   YK   P  + ++ LE   I +WR  Y      F  L ++ P+ SL  AV +L+  ++HRLPVID ISGN L+I+THKRILKFL + +  +P PAFM Q + ++ IGTY N+  I  D  II+ L +F++ R+SALPVVD    + DIYSKFDVINLA  +TY+ L+ +++ AL +R + FE V  C + ++L+ ++D     EVHRL+++++   + GIISLSD+L+  I
Sbjct:  138 FMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGVRAAPLWESKKQSFVGMLTITDFINILHRYYK--SPMVQIYE-LEEHKIETWRELY--LQETFKPLVNISPDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFMSDMPKPAFMKQNLDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALQHRSQYFEGVVKCSKLETLETIVDRIVRAEVHRLVVVNEADSIVGIISLSDILQALI 429          
BLAST of WntA vs. Ensembl Mouse
Match: Prkag2 (protein kinase, AMP-activated, gamma 2 non-catalytic subunit [Source:MGI Symbol;Acc:MGI:1336153])

HSP 1 Score: 286.96 bits (733), Expect = 2.602e-86
Identity = 145/297 (48.82%), Postives = 202/297 (68.01%), Query Frame = 2
Query:  230 FYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
            F  +H CYD+VP SSKLVVFDT+L V+KAF+AL+ NGVRA  LW++ KQ +VGM TITDFI IL   YK   P  + ++ LE   I +WR  Y      F  L ++ P+ SL  AV +L+  ++HRLPVID ISGN L+I+THKRILKFL + +  +P PAFM Q + ++ IGTY N+  I  D  II+ L +F++ R+SALPVVD    + DIYSKFDVINLA  +TY+ L+ +++ AL +R + FE V  C + ++L+ ++D     EVHRL+++++   + GIISLSD+L+  I
Sbjct:  261 FMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGVRAAPLWESKKQSFVGMLTITDFINILHRYYK--SPMVQIYE-LEEHKIETWRELY--LQETFKPLVNISPDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFMSDMPKPAFMKQNLDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALQHRSQYFEGVVKCSKLETLETIVDRIVRAEVHRLVVVNEADSIVGIISLSDILQALI 552          
BLAST of WntA vs. Ensembl Mouse
Match: Prkag3 (protein kinase, AMP-activated, gamma 3 non-catalytic subunit [Source:MGI Symbol;Acc:MGI:1891343])

HSP 1 Score: 254.988 bits (650), Expect = 1.229e-75
Identity = 129/297 (43.43%), Postives = 190/297 (63.97%), Query Frame = 2
Query:  230 FYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
            F + H+CYD +  SSKLV+FDT+L ++KAF+A++ NGVRA  LWD+ KQ +VGM TITDFI +L   Y+       +   +E   I +WR  Y      F  L S+ P DSL +AV AL+  R+HRLPV+D +SG  L+I+THKR+LKFLHI    LP P+F+ + I D+ IGT+ ++  +     ++  L +F+  RVSALPVV+    +  +YS+FDVI+LA  +TY+ L+ S+ +AL  R    E V +C   +SL  VID     +VHRL+++D+   + G++SLSD+L+  +
Sbjct:  162 FMQEHTCYDAMATSSKLVIFDTTLEIKKAFFAMVANGVRAAPLWDSKKQSFVGMLTITDFILVLHRYYRSP---LVQIYEIEEHKIETWREIY--LQGCFKPLVSISPNDSLFEAVYALIKNRIHRLPVLDPVSGTVLYILTHKRLLKFLHIFGALLPRPSFLCRTIQDLGIGTFRDLAVVLETAPVLTALDIFVDRRVSALPVVNESGQVVGLYSRFDVIHLAAQQTYNHLDMSVGEALRQRTLCLEGVLSCQPHESLGEVIDRIAREQVHRLVLVDETQHLLGVVSLSDILQALV 453          
BLAST of WntA vs. UniProt/SwissProt
Match: sp|P58108|AAKG1_BOVIN (5'-AMP-activated protein kinase subunit gamma-1 OS=Bos taurus OX=9913 GN=PRKAG1 PE=2 SV=2)

HSP 1 Score: 295.049 bits (754), Expect = 1.584e-91
Identity = 153/327 (46.79%), Postives = 213/327 (65.14%), Query Frame = 2
Query:  143 ENSATSHSFKSLSSVTIQGFFDSNNA-FRIFYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
            E   +S S+ ++ +  +Q   +SNN+ +  F ++H CYDL+P SSKLVVFDTSL V+KAF+AL+ NGVRA  LWD+ KQ +VGM TITDFI IL   YK +     +   LE   I +WR  Y      F  L  + P  SL  AV +L+  ++HRLPVID  SGN L+I+THKRILKFL + +   P P FM++ + ++ IGTYAN+  +R    +   L +F+Q RVSALPVVD    + DIYSKFDVINLA  +TY+ L+ S++ AL +R   FE V  CY  ++L+ +I+     EVHRL+++D+N  V+GI+SLSD+L+  +
Sbjct:    2 EAVPSSDSYPAVENEHLQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSA---LVQIYELEEHKIETWREVY--LQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALV 323          
BLAST of WntA vs. UniProt/SwissProt
Match: sp|Q09138|AAKG1_PIG (5'-AMP-activated protein kinase subunit gamma-1 OS=Sus scrofa OX=9823 GN=PRKAG1 PE=1 SV=2)

HSP 1 Score: 292.352 bits (747), Expect = 1.756e-90
Identity = 153/327 (46.79%), Postives = 211/327 (64.53%), Query Frame = 2
Query:  143 ENSATSHSFKSLSSVTIQGFFDSNNA-FRIFYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
            E   +S S  ++ +   Q   +SNN+ +  F ++H CYDL+P SSKLVVFDTSL V+KAF+AL+ NGVRA  LWD+ KQ +VGM TITDFI IL   YK +     +   LE   I +WR  Y      F  L  + P  SL  AV +L+  ++HRLPVID  SGN L+I+THKRILKFL + +   P P FM++ + ++ IGTYAN+  +R    +   L +F+Q RVSALPVVD    + DIYSKFDVINLA  +TY+ L+ S++ AL +R   FE V  CY  ++L+ +I+     EVHRL+++D+N  V+GI+SLSD+L+  +
Sbjct:    2 ETVTSSDSSSAVENEHPQDTPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSA---LVQIYELEEHKIETWREVY--LQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALV 323          
BLAST of WntA vs. UniProt/SwissProt
Match: sp|P54619|AAKG1_HUMAN (5'-AMP-activated protein kinase subunit gamma-1 OS=Homo sapiens OX=9606 GN=PRKAG1 PE=1 SV=1)

HSP 1 Score: 292.352 bits (747), Expect = 2.123e-90
Identity = 149/306 (48.69%), Postives = 203/306 (66.34%), Query Frame = 2
Query:  206 DSNNA-FRIFYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
            +SNN+ +  F ++H CYDL+P SSKLVVFDTSL V+KAF+AL+ NGVRA  LWD+ KQ +VGM TITDFI IL   YK +     +   LE   I +WR  Y      F  L  + P  SL  AV +L+  ++HRLPVID  SGN L+I+THKRILKFL + +   P P FM++ + ++ IGTYAN+  +R    +   L +F+Q RVSALPVVD    + DIYSKFDVINLA  +TY+ L+ S++ AL +R   FE V  CY  ++L+ +I+     EVHRL+++D+N  V+GI+SLSD+L+  +
Sbjct:   23 ESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSA---LVQIYELEEHKIETWREVY--LQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALV 323          
BLAST of WntA vs. UniProt/SwissProt
Match: sp|O54950|AAKG1_MOUSE (5'-AMP-activated protein kinase subunit gamma-1 OS=Mus musculus OX=10090 GN=Prkag1 PE=1 SV=2)

HSP 1 Score: 291.582 bits (745), Expect = 4.153e-90
Identity = 152/326 (46.63%), Postives = 210/326 (64.42%), Query Frame = 2
Query:  146 NSATSHSFKSLSSVTIQGFFDSNNA-FRIFYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
             S  + S  +L +   Q   +SNN+ +  F ++H CYDL+P SSKLVVFDTSL V+KAF+AL+ NGVRA  LWD+ KQ +VGM TITDFI IL   YK +     +   LE   I +WR  Y      F  L  + P  SL  AV +L+  ++HRLPVID  SGN L+I+THKRILKFL + +   P P FM++ + ++ IGTYAN+  +R    +   L +F+Q RVSALPVVD    + DIYSKFDVINLA  +TY+ L+ S++ AL +R   FE V  CY  ++L+ +I+     EVHRL+++D++  V+GI+SLSD+L+  +
Sbjct:    2 ESVAAESSPALENEHFQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSA---LVQIYELEEHKIETWREVY--LQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLQELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDEHDVVKGIVSLSDILQALV 322          
BLAST of WntA vs. UniProt/SwissProt
Match: sp|P80385|AAKG1_RAT (5'-AMP-activated protein kinase subunit gamma-1 OS=Rattus norvegicus OX=10116 GN=Prkag1 PE=1 SV=3)

HSP 1 Score: 290.426 bits (742), Expect = 8.391e-90
Identity = 148/306 (48.37%), Postives = 204/306 (66.67%), Query Frame = 2
Query:  206 DSNNA-FRIFYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
            +SN++ +  F ++H CYDL+P SSKLVVFDTSL V+KAF+AL+ NGVRA  LWD+ KQ +VGM TITDFI IL   YK +     +   LE   I +WR  Y      F  L  + P  SL  AV +L+  ++HRLPVID  SGN L+I+THKRILKFL + +   P P FM++ + ++ IGTYAN+  +R    +   L +F+Q RVSALPVVD    + DIYSKFDVINLA  +TY+ L+ S++ AL +R   FE V  CY  ++L+A+I+     EVHRL+++D++  V+GI+SLSD+L+  +
Sbjct:   22 ESNSSVYTTFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSA---LVQIYELEEHKIETWREVY--LQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLEAIINRLVEAEVHRLVVVDEHDVVKGIVSLSDILQALV 322          
BLAST of WntA vs. TrEMBL
Match: C3U5B1 (Protein Wnt OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 834.328 bits (2154), Expect = 0.000e+0
Identity = 398/401 (99.25%), Postives = 399/401 (99.50%), Query Frame = 2
Query: 1193 MILCHTNMIIQSMLVLILRFIAETYSSGLVFSMYQLQQISSNKYNHLSDSDPTSNPESSQNQQMTINNSPSKTVICQTFSLHQRKLCHQHFRLMESVVNGFLLGLNECQFQFADQIWNCKGHNVTIGGHRTKSKPRKKGKTYLDKLVSKSTPEAAYVSSVISAGVAHQVTKACSKGVHDSCGCDRTIYDTPESERFKWSGCSHNIHFGAAFTRQFLDVPDKIRVSKKPEKALTKLHNNHVGRQAVIMKMAKKCKCHGVSGSCEMKTCIRALPDFRVVGDLLKSRFHKAMQVHFVDSRLIPRYWPSRMFTDNDLIYLLKSPNYCVHNPHFGSLGTQGRKCAESSLLEKKPEETRGSCEELCCGRGHKKRTFSRVEQCHCKFHWCCDVKCDQCRKDVIEAVCD 2395
            MILCHTNMIIQSMLVLILRFIAETYSSGLVFSMYQLQQISSNKYNHLSDSDPTSNPESSQNQQMTINNSPSKTVICQTFSLHQRKLCHQHFRLMESVVNGFLLGLNECQFQFADQIWNCKGHN+TIGGHRTKSKPRKKGKTYLDKLVSK TPEAAYVSSVISAGVAHQVTKACSKGVHDSCGCDRTIYDTPESERFKWSGCSHNIHFGAAFTRQFLDVPDKIRVSKKPEKALTKLHNNHVGRQAVIMKMAKKCKCHGVSGSCEMKTCIRALPDFRVVGDLLKSRFHKAMQVHFVDSRLIPRYWPSRMFTDNDLIYLLKSPNYCVHNPHFGSLGTQGRKCAE SLLEKKPEETRGSCEELCCGRGHKKRTFSRVEQCHCKFHWCCDVKCDQCRKDVIEAVCD
Sbjct:    1 MILCHTNMIIQSMLVLILRFIAETYSSGLVFSMYQLQQISSNKYNHLSDSDPTSNPESSQNQQMTINNSPSKTVICQTFSLHQRKLCHQHFRLMESVVNGFLLGLNECQFQFADQIWNCKGHNLTIGGHRTKSKPRKKGKTYLDKLVSKGTPEAAYVSSVISAGVAHQVTKACSKGVHDSCGCDRTIYDTPESERFKWSGCSHNIHFGAAFTRQFLDVPDKIRVSKKPEKALTKLHNNHVGRQAVIMKMAKKCKCHGVSGSCEMKTCIRALPDFRVVGDLLKSRFHKAMQVHFVDSRLIPRYWPSRMFTDNDLIYLLKSPNYCVHNPHFGSLGTQGRKCAEMSLLEKKPEETRGSCEELCCGRGHKKRTFSRVEQCHCKFHWCCDVKCDQCRKDVIEAVCD 401          
BLAST of WntA vs. TrEMBL
Match: Q589S7 (Protein Wnt OS=Dugesia japonica OX=6161 GN=Djwnt-A PE=2 SV=1)

HSP 1 Score: 722.62 bits (1864), Expect = 0.000e+0
Identity = 345/402 (85.82%), Postives = 374/402 (93.03%), Query Frame = 2
Query: 1190 LMILCHTNMIIQSMLVLILRFIAETYSSGLVFSMYQLQQISSNKYNHLSDSDPTSNPESSQNQQMTINNSPSKTVICQTFSLHQRKLCHQHFRLMESVVNGFLLGLNECQFQFADQIWNCKGHNVTIGGHRTKSKPRKKGKTYLDKLVSKSTPEAAYVSSVISAGVAHQVTKACSKGVHDSCGCDRTIYDTPESERFKWSGCSHNIHFGAAFTRQFLDVPDKIRVSKKPEKALTKLHNNHVGRQAVIMKMAKKCKCHGVSGSCEMKTCIRALPDFRVVGDLLKSRFHKAMQVHFVDSRLIPRYWPSRMFTDNDLIYLLKSPNYCVHNPHFGSLGTQGRKCAESSLLEKKPEETRGSCEELCCGRGHKKRTFSRVEQCHCKFHWCCDVKCDQCRKDVIEAVCD 2395
            +M+L H+NMIIQ +L+LI RFI ETY SGLV+SMYQLQQ+S+NKYN++ DSD  SN +S QNQQ+ INNSPSK +ICQTFS HQRKLC+QHFRLMESVVNGFLLGLNECQFQFADQIWNCKGHN+TIGG+R+KSKPRKKGKTYLDKLVSK TPEAAYV SVISAGVAHQVTKACSKGVHDSCGCDRTIYD PE+  FKWSGCSHNIHFGAAFTRQFLD+ +K RV+K+PEKALTKLHNNHVGRQAVI+KM KKCKCHGVSGSCEMKTCIRALPDFRVVGDLLKSRFHKAMQVHFVDSRLIPRY P+RMFTDNDLIYLLKSPNYCVHNPH GSLGTQGRKCAES+LLEKKP ET G+CEELCCGRGHKKRTFSR+EQC CKF WCCDVKCD C+KDVIE+VCD
Sbjct:    1 MMLLSHSNMIIQWLLILIFRFITETYCSGLVYSMYQLQQLSANKYNNIGDSDSISNSDSGQNQQLPINNSPSKDMICQTFSRHQRKLCNQHFRLMESVVNGFLLGLNECQFQFADQIWNCKGHNMTIGGNRSKSKPRKKGKTYLDKLVSKGTPEAAYVLSVISAGVAHQVTKACSKGVHDSCGCDRTIYDIPETATFKWSGCSHNIHFGAAFTRQFLDITEKTRVNKRPEKALTKLHNNHVGRQAVILKMGKKCKCHGVSGSCEMKTCIRALPDFRVVGDLLKSRFHKAMQVHFVDSRLIPRYSPNRMFTDNDLIYLLKSPNYCVHNPHIGSLGTQGRKCAESALLEKKPGETNGTCEELCCGRGHKKRTFSRMEQCRCKFQWCCDVKCDLCKKDVIESVCD 402          
BLAST of WntA vs. TrEMBL
Match: T1E0Z8 (Protein Wnt OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 584.719 bits (1506), Expect = 0.000e+0
Identity = 276/396 (69.70%), Postives = 323/396 (81.57%), Query Frame = 2
Query: 1208 TNMIIQSMLVLILRFIAETYSSGLVFSMYQLQQISSNKYNHLSDSDPTSNPESSQNQQMTINNSPSKTVICQTFSLHQRKLCHQHFRLMESVVNGFLLGLNECQFQFADQIWNCKGHNVTIGGHRTKSKPRKKGKTYLDKLVSKSTPEAAYVSSVISAGVAHQVTKACSKGVHDSCGCDRTIYDTPESERFKWSGCSHNIHFGAAFTRQFLDVPDKIRVSKKPEKALTKLHNNHVGRQAVIMKMAKKCKCHGVSGSCEMKTCIRALPDFRVVGDLLKSRFHKAMQVHFVDSRLIPRYWPSRMFTDNDLIYLLKSPNYCVHNPHFGSLGTQGRKCAESSLLEKKPEETRGSCEELCCGRGHKKRTFSRVEQCHCKFHWCCDVKCDQCRKDVIEAVCD 2395
            +NM     ++++++ + E+    +V+++Y+LQQ+S+NKYN LSDSD   +P+S+  Q  T    P+K V+C+TF  HQR LCHQHFRLMESV+NGFLLGL ECQ+QFADQIWNCKGHN+TI     K     K +TYLDKL+++ TPEAAYV SVISAGVAHQVTKACSKGVHDSCGCDRTIYDTPE+  FKWSGCSHNIHFGAAFTRQFLDV +K+R+ K+PEKAL  LHNNHVGRQAVI  M KKCKCHGVSGSCEMKTCIRALPDFR+VGDLLKSRFHK MQVHF +SRL+PR   +RMFTDNDLIYL  SPNYC HNP  GSLGT+GRKC ES+LLEKK  E  G+C ELCC RGH +RTF R EQC CKF WCCDVKCD C+K+V+E+VC+
Sbjct:    6 SNMCFHLSMIILVQMLMESNCKEVVYNIYRLQQMSANKYNQLSDSD---DPDSNLEQPAT----PNKEVLCRTFGNHQRALCHQHFRLMESVINGFLLGLTECQYQFADQIWNCKGHNITIATKSKKKNKTTKKRTYLDKLIARGTPEAAYVLSVISAGVAHQVTKACSKGVHDSCGCDRTIYDTPETANFKWSGCSHNIHFGAAFTRQFLDVNEKVRLKKRPEKALMNLHNNHVGRQAVITNMGKKCKCHGVSGSCEMKTCIRALPDFRIVGDLLKSRFHKGMQVHFDNSRLVPRNPTTRMFTDNDLIYLNLSPNYCKHNPKIGSLGTRGRKCVESALLEKKTTENTGNCNELCCNRGHTRRTFIREEQCRCKFQWCCDVKCDLCKKEVVESVCN 394          
BLAST of WntA vs. TrEMBL
Match: B0LMF7 (Protein Wnt OS=Schmidtea mediterranea OX=79327 GN=wntP-2 PE=2 SV=1)

HSP 1 Score: 402.519 bits (1033), Expect = 3.871e-129
Identity = 197/406 (48.52%), Postives = 268/406 (66.01%), Query Frame = 2
Query: 1226 SMLVLILRFIAE----TYSSGLVFSMYQLQQISSNKYNHLSDSDPTSNPESSQNQQMTINNSPSKTVICQTFSLHQRKLCHQHFRLMESVVNGFLLGLNECQFQFADQIWNCKGHNVT---------IGGHRTKSKPRKKGK---TYLDKLVSKSTPEAAYVSSVISAGVAHQVTKACSKGVHDSCGCDRTIYDTPESERFKWSGCSHNIHFGAAFTRQFLDVPDKIRVSKKPEKALTKLHNNHVGRQAVIMKMAKKCKCHGVSGSCEMKTCIRALPDFRVVGDLLKSRFHKAMQVHFVDSRLIPRYWPSRMFTDNDLIYLLKSPNYCVHNPHFGSLGTQGRKCAESSLLEKKPEETRGSCEELCCGRGHKKRTFSRVEQCHCKFHWCCDVKCDQCRKDVIEAVCD 2395
            SML L++             GLV++M Q+ +I +                    Q    N   S + IC+    +Q+ LC +HF LM SV++GF+LG+NECQFQFA+ +WNC+GHN T         +     + KP++  K   TY+D+L++KSTPE+A++ S+ISAGV++QVTKACS+GVH +CGCDRT+YD P+  +F WSGCSHNIHFGAAF+R+FLD  +KIR+ K+   ALT +HNNHVGR++VI KM  KCKCHGVSGSCEM+TC R LP FRVVGD LK RF K +QV F D++LIP+Y    MF + D++YL  SP++C H+   G+LGT GR C ++       +E   SC  LCC RG+  +T+ + EQCHCKF WCC V C+ C++ VI+A+C+
Sbjct:   14 SMLTLLIVMTIHCKICISGRGLVYTMIQIHKIGTRHQGF---------------QNTYANEYLSTSKICKRVLKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDT--YNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVIDAICN 402          
BLAST of WntA vs. TrEMBL
Match: T1D114 (Protein Wnt OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 400.208 bits (1027), Expect = 2.410e-128
Identity = 196/405 (48.40%), Postives = 265/405 (65.43%), Query Frame = 2
Query: 1214 MIIQSMLVLILRFIAETYSSGLVFSMYQLQQISSNKYNHLSDSDPTSNPESSQNQQMTINNSPSKTVICQTFSLHQRKLCHQHFRLMESVVNGFLLGLNECQFQFADQIWNCKGHNVTIGGH-----------RTKSKPRKKGKTYLDKLVSKSTPEAAYVSSVISAGVAHQVTKACSKGVHDSCGCDRTIYDTPESERFKWSGCSHNIHFGAAFTRQFLDVPDKIRVSKKPEKALTKLHNNHVGRQAVIMKMAKKCKCHGVSGSCEMKTCIRALPDFRVVGDLLKSRFHKAMQVHFVDSRLIPRYWPSRMFTDNDLIYLLKSPNYCVHNPHFGSLGTQGRKCAESSLLEKKPEETRGSCEELCCGRGHKKRTFSRVEQCHCKFHWCCDVKCDQCRKDVIEAVCD 2395
            M I  +++L + F     S GLVF+M Q+ +I         DSD         NQ    N   + T IC+     QR LC +H+ LM SV++GF+LG++ECQ QF++ +WNC+GHN T+              +     R+   TYLD+L++KSTPE+AY+ ++ISAGV+HQVTKACS+G+H+SCGCDRT+YDTP   +F WSGCSHNIHFGAAF R FLD  +K R  K+P  ALT +HNNHVGRQ++I KM  KCKCHGVSGSCE+KTC R LP FR++GD LK RF   +QV ++D +L P+Y    MF + ++IYL  SP++C H+   G+LGT GR C  ++    +PE    SC +LCC RG+  +T+ R E C CKF WCC V C+ C++ VI+A+C+
Sbjct:   13 MFIVLIIILTMNFRMCRSSKGLVFTMSQIHKIG------YKDSD---------NQNQFTNQYLANTKICKKVLKKQRPLCKEHYPLMPSVISGFVLGISECQHQFSNDMWNCQGHNRTVNYRPLFEKSDETVTKFNKSSRRIKDTYLDRLIAKSTPESAYILAIISAGVSHQVTKACSQGIHNSCGCDRTVYDTPREGKFTWSGCSHNIHFGAAFARTFLDAREKKRSEKQPYTALTNMHNNHVGRQSIINKMKIKCKCHGVSGSCEIKTCSRNLPSFRLIGDFLKERFKNIIQVDYIDGKLAPKYPSKEMFGEVEMIYLNDSPDHCNHDFIKGTLGTTGRIC-NATFKNNEPEPI-NSCFKLCCQRGYHIKTYIRNENCRCKFKWCCKVICESCKRKVIDAICN 400          
BLAST of WntA vs. Ensembl Cavefish
Match: prkag2a (protein kinase, AMP-activated, gamma 2 non-catalytic subunit a [Source:ZFIN;Acc:ZDB-GENE-060929-160])

HSP 1 Score: 292.352 bits (747), Expect = 9.270e-92
Identity = 145/295 (49.15%), Postives = 204/295 (69.15%), Query Frame = 2
Query:  236 ENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
            ++H CYD+VP SSKLVVFDT+L V+KAF+AL+ NGVRA  LW+  KQ +VGM TITDFI IL   YK   P  + ++ LE   I +WR  Y      F  L ++ P+ S+  AV +L+  ++HRLPVID +SGN L+I+THKRILKFL + +  +P PAFM Q + ++ IGTY+N+  I  D  II+ L++F++ RVSALPVVD    + DIYSKFDVINLA  +TY+ L+ S++ AL +R + FE V  C R ++L+ ++D     EVHRL+++D+N  + GI+SLSD+L+  +
Sbjct:    2 KSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGVRAAPLWETKKQSFVGMLTITDFINILHRYYK--SPMVQIYE-LEEHKIETWRELY--LQETFKPLVNISPDASIFDAVYSLIKNKIHRLPVIDPVSGNALYILTHKRILKFLQLFVCEMPKPAFMKQTLEELGIGTYSNIAFIHPDTPIIKALSIFVERRVSALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDISVTQALMHRSQYFEGVMKCNRLETLETIVDRIVKAEVHRLVVVDENACIVGIVSLSDILQALV 291          
BLAST of WntA vs. Ensembl Cavefish
Match: prkag2b (5'-AMP-activated protein kinase subunit gamma-1 [Source:NCBI gene;Acc:103041568])

HSP 1 Score: 295.049 bits (754), Expect = 1.384e-90
Identity = 145/297 (48.82%), Postives = 205/297 (69.02%), Query Frame = 2
Query:  230 FYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
            F ++H CYDL+P SSKLVVFDT+L V+KAF+AL+ NGVRA  LW+  KQ +VGM TITDFI IL   YK   P  + ++ LE   I +WR  Y      F  L ++ P+ S+  AV +L+  ++HRLPVID ++GN L+I+THKRILKFL + +  +P PAFM   +G++ IGTY+N+  I  D  II+ L++F++ RVSALPVVD +  + DIYSKFDVINLA  +TY+ L+ S++ AL +R + FE V  C R ++L+ ++      EVHRL+++D N  +EGI+SLSD+L+  +
Sbjct:  162 FMKSHQCYDLIPTSSKLVVFDTTLQVKKAFFALVANGVRAAPLWETKKQSFVGMLTITDFIIILHRYYK--SPLVQIYE-LEEHKIETWRELY--LQETFKPLVNISPDASIYDAVYSLIKNKIHRLPVIDPVTGNALYILTHKRILKFLQLFVCEMPKPAFMKLTLGELGIGTYSNIAFIHPDTPIIKALSIFVEKRVSALPVVDVNGRVVDIYSKFDVINLAAEKTYNNLDVSVTQALQHRSQYFEGVMKCNRHETLETIVTRIVKAEVHRLVVVDSNSSIEGIVSLSDILQALV 453          
BLAST of WntA vs. Ensembl Cavefish
Match: prkag2b (5'-AMP-activated protein kinase subunit gamma-1 [Source:NCBI gene;Acc:103041568])

HSP 1 Score: 294.664 bits (753), Expect = 2.257e-89
Identity = 144/297 (48.48%), Postives = 202/297 (68.01%), Query Frame = 2
Query:  230 FYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
            F ++H CYDL+P SSKLVVFDT+L V+KAF+AL+ NGVRA  LW+  KQ +VGM TITDFI IL   YK       +   LE   I +WR  Y      F  L ++ P+ S+  AV +L+  ++HRLPVID ++GN L+I+THKRILKFL + +  +P PAFM   +G++ IGTY+N+  I  D  II+ L++F++ RVSALPVVD +  + DIYSKFDVINLA  +TY+ L+ S++ AL +R + FE V  C R ++L+ ++      EVHRL+++D N  +EGI+SLSD+L+  +
Sbjct:  256 FMKSHQCYDLIPTSSKLVVFDTTLQVKKAFFALVANGVRAAPLWETKKQSFVGMLTITDFIIILHRYYKS---PLVQIYELEEHKIETWRELY--LQETFKPLVNISPDASIYDAVYSLIKNKIHRLPVIDPVTGNALYILTHKRILKFLQLFVCEMPKPAFMKLTLGELGIGTYSNIAFIHPDTPIIKALSIFVEKRVSALPVVDVNGRVVDIYSKFDVINLAAEKTYNNLDVSVTQALQHRSQYFEGVMKCNRHETLETIVTRIVKAEVHRLVVVDSNSSIEGIVSLSDILQALV 547          
BLAST of WntA vs. Ensembl Cavefish
Match: prkag3b (protein kinase, AMP-activated, gamma 3b non-catalytic subunit [Source:ZFIN;Acc:ZDB-GENE-060421-6938])

HSP 1 Score: 258.455 bits (659), Expect = 1.212e-78
Identity = 132/297 (44.44%), Postives = 193/297 (64.98%), Query Frame = 2
Query:  230 FYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
            F+  H CYD +P SSKL++ DT+L V+KAF+AL+ NGVRA  LWD+ +Q +VGM TITDFI IL   YK   P  + ++ LE   I +WR  +       + L S+ PE SL  AV +LL  ++HRLPVID  SGN LHI+THKRILKFLHI    +P P F+ + I ++ IGT+  +  I+    + + L++F++ RVSALPVV+    +  +YS+FDVINLA  + Y+ LN ++ +A+  R    E V  CY  ++L+ +I+     EVHRL+++++   V+GI+SLSD+L+  +
Sbjct:   24 FFMKHCCYDAIPTSSKLLILDTTLKVKKAFFALVANGVRAAPLWDHKQQCFVGMLTITDFINILHRYYK--SPMVQIYE-LEEHKIETWREIF--LQYSINSLISITPESSLFDAVYSLLKNKIHRLPVIDPESGNVLHILTHKRILKFLHIFGSMIPKPRFLQKRIEEVEIGTFKEIATIQKTATVYDALSIFVERRVSALPVVNEQGKVVALYSRFDVINLAAQKNYNNLNMTMQEAIEGRLCCVEGVLKCYPHETLETIINRIAEAEVHRLVLVNEEDLVKGIVSLSDLLQALV 315          
BLAST of WntA vs. Ensembl Cavefish
Match: prkag3b (protein kinase, AMP-activated, gamma 3b non-catalytic subunit [Source:ZFIN;Acc:ZDB-GENE-060421-6938])

HSP 1 Score: 258.07 bits (658), Expect = 1.225e-78
Identity = 134/303 (44.22%), Postives = 196/303 (64.69%), Query Frame = 2
Query:  230 FYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFIRDHPSD 1138
            F+  H CYD +P SSKL++ DT+L V+KAF+AL+ NGVRA  LWD+ +Q +VGM TITDFI IL   YK   P  + ++ LE   I +WR  +       + L S+ PE SL  AV +LL  ++HRLPVID  SGN LHI+THKRILKFLHI    +P P F+ + I ++ IGT+  +  I+    + + L++F++ RVSALPVV+    +  +YS+FDVINLA  + Y+ LN ++ +A+  R    E V  CY  ++L+ +I+     EVHRL+++++   V+GI+SLSD+L+  +   P+D
Sbjct:   20 FFMKHCCYDAIPTSSKLLILDTTLKVKKAFFALVANGVRAAPLWDHKQQCFVGMLTITDFINILHRYYK--SPMVQIYE-LEEHKIETWREIF--LQYSINSLISITPESSLFDAVYSLLKNKIHRLPVIDPESGNVLHILTHKRILKFLHIFGSMIPKPRFLQKRIEEVEIGTFKEIATIQKTATVYDALSIFVERRVSALPVVNEQGKVVALYSRFDVINLAAQKNYNNLNMTMQEAIEGRLCCVEGVLKCYPHETLETIINRIAEAEVHRLVLVNEEDLVKGIVSLSDLLQALVLT-PAD 316          
BLAST of WntA vs. Ensembl Sea Lamprey
Match: prkag2b (protein kinase, AMP-activated, gamma 2 non-catalytic subunit b [Source:ZFIN;Acc:ZDB-GENE-070912-442])

HSP 1 Score: 284.648 bits (727), Expect = 2.655e-89
Identity = 139/297 (46.80%), Postives = 203/297 (68.35%), Query Frame = 2
Query:  230 FYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
            F ++  CYD++P SSKLVVFD SL V++AF+AL+ NGVRA  LWDN  Q +VGM TITDFI IL   YK   P  + ++ LE   I++WR  Y      F  L S+ P  S+  AV +L+  ++HRLPV+D+++GN L+I+THKRILKFL +    +P P+FM+Q + ++ IGTY ++  +     II+ L +F++ RVSALPVVD D  + D+YSKFDVIN+A  +TY+ L+ +++ AL++R + FE V  C+R +SL+ +ID     EVHRL+++D+   V GI+SLSD+L+  +
Sbjct:   21 FMKSRKCYDIIPTSSKLVVFDISLQVKRAFFALVSNGVRAAPLWDNKMQCFVGMLTITDFINILHQYYK--SPMVQIYE-LEEHRISTWREVY--LQDSFKPLVSISPNASVFDAVYSLIKNKIHRLPVLDSVAGNALYILTHKRILKFLQLFAPEMPKPSFMSQSLQELGIGTYKDIAVVSPSTPIIKALGIFVERRVSALPVVDEDGKVVDVYSKFDVINMAAEKTYNNLDITVTQALSHRSQYFEGVIRCFRHESLETIIDRIVKAEVHRLVVLDEKEVVTGIVSLSDILQALV 312          
BLAST of WntA vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006067.1 (pep scaffold:Pmarinus_7.0:GL477824:15771:29650:-1 gene:ENSPMAG00000005482.1 transcript:ENSPMAT00000006067.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 281.182 bits (718), Expect = 5.959e-88
Identity = 141/293 (48.12%), Postives = 199/293 (67.92%), Query Frame = 2
Query:  242 HSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
              CY+++P SSKLVVFDTSL V+KAF+AL+ +GVRA  LWD+  Q +VGM TITDFI IL   YK   P  + ++ LE   I +WR  Y      F  L S+ PE SL  AV +L+  ++HRLP+ID +SGN L+I+THKRIL+FLH+ +  LP P FM +P+G++ +GT+ ++  I  D  II  L +F++ RVSAL VVD    + D+YSKFDVINLA  + Y+ L+ +++ AL +R + FE V  C+R +SL+ +I      EVHR++++D+N RV GI+SLSD+L+  I
Sbjct:   27 QCCYEVIPTSSKLVVFDTSLQVKKAFFALVDSGVRAAPLWDSKLQTFVGMLTITDFINILHRYYK--SPMVQIYE-LEEHKIETWREVY--LQDSFKPLVSITPEASLFDAVYSLIKNKIHRLPIIDPVSGNVLYILTHKRILRFLHLFISELPKPRFMCRPLGELRVGTFNDIAFIYTDTPIITALNLFVERRVSALSVVDQSGRVVDVYSKFDVINLAAEKNYNNLDVTVTQALRHRSQYFEGVVKCHRQESLETIIGRLVQAEVHRVVVVDENDRVVGILSLSDILQALI 314          
BLAST of WntA vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004653.1 (pep scaffold:Pmarinus_7.0:GL479099:29087:37224:1 gene:ENSPMAG00000004236.1 transcript:ENSPMAT00000004653.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 209.534 bits (532), Expect = 1.538e-62
Identity = 106/221 (47.96%), Postives = 147/221 (66.52%), Query Frame = 2
Query:  230 FYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVI 892
            F + H CYD++P SSKLVVFD SL V+KAF+AL+ NGVRA  LWDN +Q +VGM TITDFI IL   YK   P  + ++ LE   I +WR  Y      F  L ++ P  SL  AV +L+  ++HRLPV+D ++GN L+I+THKR+L+FL + +  +P P FM   + ++ IGT+ ++  I     +I  L++F++ RVSALPVVD+   + DIYSKFDVI
Sbjct:   18 FMKAHRCYDIIPTSSKLVVFDVSLQVKKAFFALVANGVRAAPLWDNHRQAFVGMLTITDFINILHRYYK--SPLVQIYE-LEEHKIETWRELY--LQDSFKPLVNIPPHASLFDAVNSLIKNKIHRLPVVDPVTGNALYILTHKRVLRFLTLFMSEMPQPPFMKHSLEELGIGTFRDIAIIHPGTPVICALSLFVERRVSALPVVDSSGKVVDIYSKFDVI 233          
BLAST of WntA vs. Ensembl Sea Lamprey
Match: wnt3 (wingless-type MMTV integration site family, member 3 [Source:ZFIN;Acc:ZDB-GENE-081003-1])

HSP 1 Score: 209.149 bits (531), Expect = 7.434e-61
Identity = 127/360 (35.28%), Postives = 177/360 (49.17%), Query Frame = 2
Query: 1325 NHLSDSDPTSNPESSQNQQMTINNSPSKTVICQTFS---LHQRKLCHQHFRLMESVVNGFLLGLNECQFQFADQIWNCKGHNVTIGGHRTKSKPRKKGKTYLDKLVSKSTPEAAYVSSVISAGVAHQVTKACSKGVHDSCGCDRTIYDTPESERFKWSGCSHNIHFGAAFTRQFLDVPDKIRVSKKPEKALTKLHNNHVGRQAVIMKMAKKCKCHGVSGSCEMKTCIRALPDFRVVGDLLKSRFHKAMQVHFVDSR--------LIPRYWPSRMFTDNDLIYLLKSPNYCVHNPHFGSLGTQGRKCAESSLLEKKPEETRGSCEELCCGRGHKKRTFSRVEQCHCKFHWCCDVKCDQCRK 2371
             H+  S PT+ P  S        +  S+ V+C +       Q + C  +  LM SV  G  LG+ ECQ QF  + WNC                  +G      ++ ++T EA++V +V SAGV   VT+AC+ G    CGCD      P S  +KW GCS +  FG   +R+F D     R ++   ++    HNN  GR +++  M +KCKCHG+SGSCE+KTC  A P FR VGD LK ++  A ++     R        L P+Y   +   + DL+Y   SPN+C  +   GSLGT GR C  +S            C+ LCC RG+   T  R E+C C FHWCC V C +C +
Sbjct:   15 THIPVSPPTT-PCRSLGVGPQWASLGSQPVLCASIPGLVPKQLRFCRNYQELMPSVAEGVRLGIQECQHQFRGRRWNCTTMT--------------EGPAIFGPVLERATREASFVHAVSSAGVGFAVTRACADGTSTICGCDNKHRGEP-SGGWKWGGCSEDADFGVMVSREFADA----RENRPDARSAMNRHNNEAGRVSILDFMQRKCKCHGLSGSCEVKTCWWAQPSFRTVGDHLKDKYDSASEMLVERHRESRGWVETLRPKYPLFKPPAERDLVYYETSPNFCEPSAETGSLGTHGRPCNLTS-------HGIDGCDLLCCSRGYNTHTERRREKCKCVFHWCCYVSCQECAR 347          
BLAST of WntA vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010914.1 (pep scaffold:Pmarinus_7.0:GL478525:6655:13730:-1 gene:ENSPMAG00000009890.1 transcript:ENSPMAT00000010914.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 205.297 bits (521), Expect = 2.835e-59
Identity = 126/354 (35.59%), Postives = 173/354 (48.87%), Query Frame = 2
Query: 1403 SKTVICQTFSLH--QRKLCHQHFRLMESVVNGFLLGLNECQFQFADQIWNCKGHNVTIGGHRTKSKPRKKGKTYLDKLVSKSTPEAAYVSSVISAGVAHQVTKACSKGVHDSCGCDRTIYDTPESERFKWSGCSHNIHFGAAFTRQFLDVPDK------------------IRVSKKPEKALTKLHNNHVGRQAVIMKMAKKCKCHGVSGSCEMKTCIRALPDFRVVGDLLKSRFH-KAMQVHFVDSRLIPRYWPSRMFTD---NDLIYLLKSPNYCVHNPHFGSLGTQGRKCAESSLLEKKPEETRGSCEELCCGRGHKKRTFSRVEQCHCKFHWCCDVKCDQCRKDVIEAVC 2392
            S   +CQ   L   QRKLCH +   +  + +G  L + ECQ QF  + WNC                  +G +   +L    + E A+  ++ +AGVAH V++AC +G   +CGC R          + W GC  N+ +G  F R+F+D  ++                   R S +  + L  LHNN  GR+AV       CKCHGVSGSC +KTC   L DFR VG  LK ++   +       ++L P    +R F+     DL+YL  SP+YCV N   GSLGT GR C ++S       E    CE +CCGRG+     + VE+C+CKFHWCC VKC +C   V   VC
Sbjct:   44 SAQPLCQLVGLSPGQRKLCHLYQDHVPHIADGARLAVRECQHQFRTRRWNCSA---------------GEGDSVFGRLTHIGSRETAFAHAISAAGVAHAVSRACREGELATCGCSRAPRPRELQRDWLWGGCGDNLEYGYRFAREFVDAREREQGGQQQQQQQQQQQQLAARHSVEHSRTLMNLHNNEAGRRAVYGLADVACKCHGVSGSCSLKTCWLQLADFRKVGKFLKEKYDSASAARAGRRAKLEP---ANRKFSPPSAGDLVYLDASPDYCVRNETTGSLGTIGRSCNKTS-------EGMDGCELMCCGRGYDHFKATVVERCNCKFHWCCYVKCKKCTSVVDRFVC 372          
BLAST of WntA vs. Ensembl Yeast
Match: SNF4 (Activating gamma subunit of the AMP-activated Snf1p kinase complex; additional subunits of the complex are Snf1p and a Sip1p/Sip2p/Gal83p family member; activates glucose-repressed genes, represses glucose-induced genes; role in sporulation, and peroxisome biogenesis; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000003083])

HSP 1 Score: 165.236 bits (417), Expect = 8.564e-46
Identity = 93/305 (30.49%), Postives = 162/305 (53.11%), Query Frame = 2
Query:  218 AFRIFYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGN----PLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
            + R F  + + YD++P S +L+V DTSL V+K+   L+ N + +  LWD+    + G+ T TDFI ++  +Y  S PD  +F+ ++   +   +        D     S+ P   L +A   +L  R  R+P+ID          + ++T  RILKF+ +N        F+  PIGD+ I T  N+   ++   +I+ + M  Q RVS++P++D +  L ++Y  +DV+ L     Y+ L+ S+ +AL  R   FE V TC + D L  ++D+     VHR  ++D   R+ G+++LSD+L++ +
Sbjct:   21 SIRKFLNSKTSYDVLPVSYRLIVLDTSLLVKKSLNVLLQNSIVSAPLWDSKTSRFAGLLTTTDFINVI--QYYFSNPD--KFELVDKLQLDGLKDIERALGVDQLDTASIHPSRPLFEACLKMLESRSGRIPLIDQDEETHREIVVSVLTQYRILKFVALNCRE---THFLKIPIGDLNIITQDNMKSCQMTTPVIDVIQMLTQGRVSSVPIIDENGYLINVYEAYDVLGLIKGGIYNDLSLSVGEALMRRSDDFEGVYTCTKNDKLSTIMDNIRKARVHRFFVVDDVGRLVGVLTLSDILKYIL 318          
BLAST of WntA vs. Ensembl Nematostella
Match: EDO43862 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXK5])

HSP 1 Score: 250.366 bits (638), Expect = 2.211e-74
Identity = 138/309 (44.66%), Postives = 195/309 (63.11%), Query Frame = 2
Query:  194 QGFFDSNNAFRIFYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
            +     N  +  F ++  C++L+P SSK+VVFDT LNV+KAF+AL+ NGVR+  ++D+ +QD+VGM TITDFI IL   YK       +   LE   I +WR +  +  SD S L  + P  SL +AV+ LL  ++HRLPVID  +GN L+IITHKRILKFL   +  L +P FM + + D+ IGTY  V  +     +I  L MF + RVSALPVVD   ++ DIY+KFDVINLA  +TY+ L+ ++  AL +R + FE V  CY  ++L  +++      VHRL+++DK     G++SLSD+L F I
Sbjct:  162 ESMMGENWCYSNFLKSRMCHELMPKSSKIVVFDTKLNVKKAFFALLANGVRSAPVFDSSRQDFVGMLTITDFINILKCYYKSP---LVQMDELEEHKIETWR-RLQSLKSD-SSLVRISPTQSLYEAVRMLLEFKIHRLPVIDPSTGNALYIITHKRILKFLFAYMQELKMPDFMYKTLEDLGIGTYKCVATVSPSTPLIRVLHMFSEKRVSALPVVDDKGVVVDIYAKFDVINLAAEKTYNNLDVTVQQALEHRAEGFEGVHRCYLEETLFLIVERLIEARVHRLVVVDKEDHCIGVLSLSDILRFLI 465          
BLAST of WntA vs. Ensembl Nematostella
Match: EDO31000 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7SZ54])

HSP 1 Score: 240.35 bits (612), Expect = 4.974e-72
Identity = 133/331 (40.18%), Postives = 190/331 (57.40%), Query Frame = 2
Query: 1415 ICQTFSLHQRKLCHQHFRLMESVVNGFLLGLNECQFQFADQIWNCKGHNVTIGGHRTKSKPRKKGKTYLDKLVSKSTPEAAYVSSVISAGVAHQVTKACSKG-VHDSCGCDRTIYDTPESERFKWSGCSHNIHFGAAFTRQFLDVPDKIRVSKKPEKALTKLHNNHVGRQAVIMKMAKKCKCHGVSGSCEMKTCIRALPDFRVVGDLLKSRFHKAMQVHF--VDSR--LIPRYWPSRMFTDNDLIYLLKSPNYCVHNPHFGSLGTQGRKCAESSLLEKKPEETRGSCEELCCGRGHKKRTFSRVEQCHCKFHWCCDVKCDQCRKDVIEAVC 2392
            I Q  +  Q ++C ++ ++M+SV +G  + L ECQ QF  + WNC     T+   R+               ++  T EAA+V ++ SAGVA+ VT+ACS G +   CGCDR      +++ F W+GCS +I FG  F  +F+D  ++      P + L  LHNN  GR AV   M  +CKCHGVSGSC +KTC RALP+FR+VGD +K +F  A +V +  +  +  L+P+    +  T  DL+YL++SP++C  NP  GSLGTQGR C  +S       +    C+ +CCGRG+  RT  R EQC CKF WCC V+C  C + V  + C
Sbjct:   45 IGQLLNHRQVQVCKRNIQVMDSVKDGASVALFECQHQFRYRPWNC----TTVQFSRSP---------VFGNSINGGTREAAFVHAISSAGVAYAVTQACSSGRLGQKCGCDRKTRG--QADGFNWAGCSDDIDFGMTFATRFVDARERGSGIGSPARVLMNLHNNRGGRLAVKKFMDLQCKCHGVSGSCNIKTCWRALPNFRIVGDYIKEKFDGATEVEYKLIGGKHVLVPKNRKYKPHTQMDLVYLVQSPDFCEPNPKTGSLGTQGRICNRTS-------QAIDGCDLMCCGRGYVSRTEVRQEQCACKFFWCCHVRCQTCMRRVEVSYC 353          
BLAST of WntA vs. Ensembl Nematostella
Match: WNT2 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7S3E5])

HSP 1 Score: 228.024 bits (580), Expect = 1.707e-67
Identity = 125/318 (39.31%), Postives = 177/318 (55.66%), Query Frame = 2
Query: 1439 QRKLCHQHFRLMESVVNGFLLGLNECQFQFADQIWNCKGHNVTIGGHRTKSKPRKKGKTYLDKLVSKSTPEAAYVSSVISAGVAHQVTKACSKGVHDSCGCDRTIYDTPESERFKWSGCSHNIHFGAAFTRQFLDVPDKIRVSKKPEKALTKLHNNHVGRQAVIMKMAKKCKCHGVSGSCEMKTCIRALPDFRVVGDLLKSRFHKAMQVHFVDS--RLIPRYWPSRMFTDNDLIYLLKSPNYCVHNPHFGSLGTQGRKCAESSLLEKKPEETRGSCEELCCGRGHKKRTFSRVEQCHCKFHWCCDVKCDQCRKDVIEA 2386
            QR++C  +  +M S+  G  LG+ ECQ QF DQ WNC     T+ G            T   K++ +++ E A+V ++ SAGV H+VT++CS G    C C      + +   F+W GCS NI +G  F + F+D     R  +K  +AL  LHNNHVGR+ V   M+  CKCHGVSGSC ++TC +++  FR+VG  L+ ++  A+QV    S   L       +  + +DL+YL  SPNYC+ + + GSLGT GR+C  S+       +T G+C  LCCGRG          +CHCKFHWCC VKC  CR+  +  
Sbjct:   52 QRQMCLDNPDVMVSIGKGAKLGVEECQHQFRDQRWNCS----TVNGD----------ATVFGKVMRRASRETAFVYAISSAGVVHEVTRSCSLGELKDCSCRNKKGRSRKG--FEWGGCSDNIQYGLNFAKAFVDS----REVEKDARALMNLHNNHVGRRVVKTNMSLDCKCHGVSGSCSVRTCWKSISSFRIVGQHLREKYTTAVQVTVGQSGGELTNAEVSYKKPSRDDLVYLEDSPNYCMVDSNTGSLGTSGRECNGSA------SDTTGACSLLCCGRGFNTIQIEEEYKCHCKFHWCCYVKCQTCRRTTLAG 343          
BLAST of WntA vs. Ensembl Nematostella
Match: WNT3 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7RXF5])

HSP 1 Score: 224.172 bits (570), Expect = 3.500e-66
Identity = 129/342 (37.72%), Postives = 196/342 (57.31%), Query Frame = 2
Query: 1379 QMTINNSPSK-TVIC---QTFSLHQRKLCHQHFRLMESVVNGFLLGLNECQFQFADQIWNCKGHNVTIGGHRTKSKPRKKGKTYLDKLVSKSTPEAAYVSSVISAGVAHQVTKACSKGVHDSCGCDRTIYDTPESERFKWSGCSHNIHFGAAFTRQFLDVPDKIRVSKKPEKALTKLHNNHVGRQAVIMKMAKKCKCHGVSGSCEMKTCIRALPDFRVVGDLLKSRFHKAMQV-----HFVDSRLIPRYWPSRMFTDNDLIYLLKSPNYCVHNPHFGSLGTQGRKCAESSLLEKKPEETRGSCEELCCGRGHKKRTFSRVEQCHCKFHWCCDVKCDQCRKDV 2377
            Q+++++ P+K +++C   + F+  Q+++C ++  LME V +G   G++EC+ QF ++ WNC             S  R+ G  + + ++SK   EAA+V +V +AGVAH VT ACSKG  +SC CDR +     S+ + WSGC+ NI FG  F++QF +  ++        + +   HN+  GR+A+   + +KCKCHG+SGSC MKTC     +FR +GD LK ++  A+++          RL P+Y   +  +D DLIY   SPNYC  N   GSLGT GR+C  +S            CE LCCGRGH  +       C+C F WCC+VKC++C++ V
Sbjct:   28 QLSVSSDPAKKSMLCYVTRQFNSRQQEVCRKNPDLMEHVAHGAKYGVHECRHQFRNRRWNC-------------STIRESGSLF-ESVLSKGCREAAFVHAVTAAGVAHSVTDACSKGRIESCDCDRNL-SGRSSKGWTWSGCNSNIKFGVWFSKQFTEARER----GGDLRQIMNRHNSRAGRKALEELVWRKCKCHGLSGSCSMKTCWMQQANFRQIGDHLKVKYDSAVEMTTKVNRRGKKRLKPKYSHFKKPSDKDLIYFETSPNYCDKNVTVGSLGTSGRQCNYTS-------NGIDGCELLCCGRGHNIQQAKITRNCNCVFKWCCEVKCERCKEVV 343          
BLAST of WntA vs. Ensembl Nematostella
Match: EDO49431 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7RGH9])

HSP 1 Score: 215.312 bits (547), Expect = 9.304e-63
Identity = 122/351 (34.76%), Postives = 183/351 (52.14%), Query Frame = 2
Query: 1385 TINNSPSKTVICQTFSLHQRKLCHQHFRLMESVVNGFLLGLNECQFQFADQIWNCKGHNVTIGGHRTKSKPRKKGKTYLDKLVSKSTPEAAYVSSVISAGVAHQVTKACSKGVHDSCGCDRTIYDTPESERFKWSGCSHNIHFGAAFTRQFLDVPDKIRVSKKPEKALTKLHNNHVGRQAVIMKMAKKCKCHGVSGSCEMKTCIRALPDFRVVGDLLKSRFHKAMQVHFVD---------------SRLIPRYWPSRMFTDNDLIYLLKSPNYCVHNPHFGSLGTQGRKCAESSLLEKKPEETRGSCEELCCGRGHKKRTFSRVEQCHCKFHWCCDVKCDQCRKDVIEAVC 2392
             I  SP   +  +  +  Q ++  ++  L++ +  G    ++ECQ QF ++ WNC  H+                +    K++ ++  E A+  ++ +AGV+H + +AC +G   +C CD+  Y     + ++W GCS NIHF   F+++F+D  +K R      +A   LHNN  GR AV   M  +CKCHG+S +C +KTC + LPDFR+VGD LK +F  A  V +                 +  IP     R  T  DL+Y   SPN+C  NP  GSLGTQGR+C  +S+       T G CE +CCGRG    +  RVE C+C+F WCC+VKC +C+   I + C
Sbjct:   41 NIQLSPPNQI--RALTQKQIRISRRYPELIQYIAGGARTAIHECQHQFRNRKWNCSAHSP---------------ENVFGKILKRACRETAFTYAITAAGVSHAIARACGEGKLSACSCDQR-YRGVSKQGWQWGGCSDNIHFADNFSKRFVDAQEKGR----DFRAQINLHNNEAGRAAVRNNMIVECKCHGLSEACTVKTCWKRLPDFRLVGDDLKRKFDNASMVEYQQNNNNRNSNRNRNEDPALFIPSKPYLRRPTVYDLVYYEHSPNFCERNPSAGSLGTQGRECNTTSM------GTDG-CELMCCGRGFTTSSQERVENCNCRFFWCCEVKCQKCKTRRIISNC 362          
BLAST of WntA vs. Ensembl Medaka
Match: prkag1 (protein kinase AMP-activated non-catalytic subunit gamma 1 [Source:NCBI gene;Acc:101155677])

HSP 1 Score: 294.664 bits (753), Expect = 2.957e-92
Identity = 148/303 (48.84%), Postives = 209/303 (68.98%), Query Frame = 2
Query:  212 NNAFRIFYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
            +NA+  F ++H CYDLVP SSKLVVFDTSL V+KAF+AL+ NGVRA  LWD+ KQ +VGM TITDFI IL   YK   P  + ++ LE   I +WR  Y      F  L S+ P  SL  AV +LL  ++HRLPVID ++GN L+I+THKRILKFL + +  +P P+F+++ + ++ IGT+ N+  +R D  +   L +F++ RVSALPVVD    + DIYSKFDVINLA  +TY+ L+ +++ AL +R + FE V TC+  D+L+A+I+     EVHRL+++D+   V+GI+SLSD+L+  +
Sbjct:   24 HNAYTRFMKSHRCYDLVPTSSKLVVFDTSLQVKKAFFALVSNGVRAAPLWDSKKQCFVGMLTITDFINILHRYYK--SPLVQIYE-LEEHKIETWRELY--LQDSFKPLVSISPNASLYDAVSSLLRNKIHRLPVIDPLTGNTLYILTHKRILKFLKLFISEMPRPSFLSKTVEELNIGTFKNIAMVRKDTPVYTALGIFVEQRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVTVTKALQHRSQYFEGVLTCHIHDTLEAIINRLVEAEVHRLVVVDEQEVVKGIVSLSDILQALV 321          
BLAST of WntA vs. Ensembl Medaka
Match: prkag1 (protein kinase AMP-activated non-catalytic subunit gamma 1 [Source:NCBI gene;Acc:101155677])

HSP 1 Score: 294.664 bits (753), Expect = 4.323e-92
Identity = 148/302 (49.01%), Postives = 208/302 (68.87%), Query Frame = 2
Query:  215 NAFRIFYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
            NA+  F ++H CYDLVP SSKLVVFDTSL V+KAF+AL+ NGVRA  LWD+ KQ +VGM TITDFI IL   YK   P  + ++ LE   I +WR  Y      F  L S+ P  SL  AV +LL  ++HRLPVID ++GN L+I+THKRILKFL + +  +P P+F+++ + ++ IGT+ N+  +R D  +   L +F++ RVSALPVVD    + DIYSKFDVINLA  +TY+ L+ +++ AL +R + FE V TC+  D+L+A+I+     EVHRL+++D+   V+GI+SLSD+L+  +
Sbjct:   45 NAYTRFMKSHRCYDLVPTSSKLVVFDTSLQVKKAFFALVSNGVRAAPLWDSKKQCFVGMLTITDFINILHRYYK--SPLVQIYE-LEEHKIETWRELY--LQDSFKPLVSISPNASLYDAVSSLLRNKIHRLPVIDPLTGNTLYILTHKRILKFLKLFISEMPRPSFLSKTVEELNIGTFKNIAMVRKDTPVYTALGIFVEQRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVTVTKALQHRSQYFEGVLTCHIHDTLEAIINRLVEAEVHRLVVVDEQEVVKGIVSLSDILQALV 341          
BLAST of WntA vs. Ensembl Medaka
Match: prkag2b (5'-AMP-activated protein kinase subunit gamma-2 [Source:NCBI gene;Acc:101160591])

HSP 1 Score: 297.745 bits (761), Expect = 1.224e-90
Identity = 143/297 (48.15%), Postives = 207/297 (69.70%), Query Frame = 2
Query:  230 FYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
            F ++H CYD+VP SSKLVVFDT+L V+KAF+AL+ NGVRA  LWD +KQ +VGM TITDFI IL   YK   P  + ++ LE   + +WR  Y    + F  L ++ P+ SL  AV  L+  ++HRLPVID ++GN L+I+THKRILKFL + +Y +P PAFM Q + ++ IGTY ++  I  D  II+ L +F++ RVSALPVVD    + DIYSKFDVINLA  +TY+ L+ +++ AL +R + FE V  C++ ++++A++D     EVHRL+++D+   ++GI+SLSD+L+  +
Sbjct:  239 FMKSHKCYDIVPTSSKLVVFDTALQVKKAFFALVANGVRAAPLWDTEKQSFVGMLTITDFIIILHRYYK--SPMVQIYE-LEEHKLETWREVY--LQATFKPLVNISPDASLFDAVYTLIKNKIHRLPVIDPVTGNALYILTHKRILKFLQLFMYEMPKPAFMKQTLSELGIGTYHDIAYIHPDTPIIKALNIFVEKRVSALPVVDDSGTVVDIYSKFDVINLAAEKTYNNLDITVTQALKHRSQYFEGVVKCHKMETMEAIVDRIVKAEVHRLVVVDERSGIQGIVSLSDILQALV 530          
BLAST of WntA vs. Ensembl Medaka
Match: ENSORLT00000004916.2 (protein kinase AMP-activated non-catalytic subunit gamma 2 [Source:NCBI gene;Acc:101171705])

HSP 1 Score: 289.271 bits (739), Expect = 4.498e-90
Identity = 143/297 (48.15%), Postives = 203/297 (68.35%), Query Frame = 2
Query:  230 FYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
            F + H CYD++P SSKLVVFDT+L V+KAF+AL  NGVRA  LW++ KQ +VGM TITDFI IL   YK   P  + ++ LE   I +WR  Y      F  L  + P+ S+ +AV +L+  ++HRLPVID ISGN L+I+THKRILKFL + +  +P+PAFM Q +  + +GTY+N+  I  D  +I  L++F   RVSALPVVD +  + DIYSKFDVINLA  +TY+ L+ +++ AL +R + FE V  C R ++L+ ++D     EVHRL+++D++ R+ GI+SLSD+L+  +
Sbjct:   37 FMKCHKCYDIIPTSSKLVVFDTTLQVKKAFFALGANGVRAAPLWESKKQSFVGMLTITDFINILTRYYK--SPMVQIYE-LEEHKIETWRELY--LQETFKPLVHIPPDASIFEAVYSLIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFVCEMPMPAFMKQSLQQLGVGTYSNIAYIHPDTPLITALSVFTHRRVSALPVVDHNGRVVDIYSKFDVINLAAEKTYNNLDVTVTQALRHRSQYFEGVMKCNRLETLETIVDRIVKAEVHRLVVVDEDSRIVGIVSLSDILQALV 328          
BLAST of WntA vs. Ensembl Medaka
Match: prkag3b (5'-AMP-activated protein kinase subunit gamma-1 [Source:NCBI gene;Acc:101160204])

HSP 1 Score: 266.929 bits (681), Expect = 3.139e-82
Identity = 137/297 (46.13%), Postives = 193/297 (64.98%), Query Frame = 2
Query:  230 FYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFI 1120
            F + H CYD +P SSKLV+FDT L V+KAF+AL+ N VRA  LWD+  Q +VGM TITDFI IL   YK   P  + ++ LE   I +WR  Y    ++   L S+ PE SL  A+ +LL  ++HRLPVID  SGN LHI+THKRILKFLHI    +P P F+ + I ++PIGT+  +  ++    + + L++F++ RVSALPVV+   +   +YS+FDVINLA  + Y+ LN ++ +A+A R    E V  CY  ++L+ +ID     EVHRL+++D N  V GI+SLSD+L+  +
Sbjct:    3 FMKRHCCYDAIPTSSKLVIFDTMLQVKKAFFALVANSVRAAPLWDSKLQCFVGMLTITDFINILHRYYK--SPLVQIYE-LEEHKIETWREIYLQYSNN--RLISITPESSLFDAIYSLLKNKIHRLPVIDPTSGNVLHILTHKRILKFLHIFGSMIPKPRFLQKSISEVPIGTFKQIATVQESATVYQALSIFVERRVSALPVVNEQVV--ALYSRFDVINLAAQKNYNNLNITMREAIACRSCWMEGVLKCYPHETLETIIDRIAKAEVHRLVLVDSNDVVRGIVSLSDLLQALV 292          
BLAST of WntA vs. Planmine SMEST
Match: SMESG000051375.1 (SMESG000051375.1)

HSP 1 Score: 838.565 bits (2165), Expect = 0.000e+0
Identity = 400/401 (99.75%), Postives = 401/401 (100.00%), Query Frame = 2
Query: 1193 MILCHTNMIIQSMLVLILRFIAETYSSGLVFSMYQLQQISSNKYNHLSDSDPTSNPESSQNQQMTINNSPSKTVICQTFSLHQRKLCHQHFRLMESVVNGFLLGLNECQFQFADQIWNCKGHNVTIGGHRTKSKPRKKGKTYLDKLVSKSTPEAAYVSSVISAGVAHQVTKACSKGVHDSCGCDRTIYDTPESERFKWSGCSHNIHFGAAFTRQFLDVPDKIRVSKKPEKALTKLHNNHVGRQAVIMKMAKKCKCHGVSGSCEMKTCIRALPDFRVVGDLLKSRFHKAMQVHFVDSRLIPRYWPSRMFTDNDLIYLLKSPNYCVHNPHFGSLGTQGRKCAESSLLEKKPEETRGSCEELCCGRGHKKRTFSRVEQCHCKFHWCCDVKCDQCRKDVIEAVCD 2395
            MILCHTNMIIQSMLVLILRFIAETYSSGLVFSMYQLQQISSNKYNHLSDSDPTSNPESSQNQQMTINNSPSKTVICQTFSLHQRKLCHQHFRLMESVVNGFLLGLNECQFQFADQIWNCKGHN+TIGGHRTKSKPRKKGKTYLDKLVSKSTPEAAYVSSVISAGVAHQVTKACSKGVHDSCGCDRTIYDTPESERFKWSGCSHNIHFGAAFTRQFLDVPDKIRVSKKPEKALTKLHNNHVGRQAVIMKMAKKCKCHGVSGSCEMKTCIRALPDFRVVGDLLKSRFHKAMQVHFVDSRLIPRYWPSRMFTDNDLIYLLKSPNYCVHNPHFGSLGTQGRKCAESSLLEKKPEETRGSCEELCCGRGHKKRTFSRVEQCHCKFHWCCDVKCDQCRKDVIEAVCD
Sbjct:    1 MILCHTNMIIQSMLVLILRFIAETYSSGLVFSMYQLQQISSNKYNHLSDSDPTSNPESSQNQQMTINNSPSKTVICQTFSLHQRKLCHQHFRLMESVVNGFLLGLNECQFQFADQIWNCKGHNLTIGGHRTKSKPRKKGKTYLDKLVSKSTPEAAYVSSVISAGVAHQVTKACSKGVHDSCGCDRTIYDTPESERFKWSGCSHNIHFGAAFTRQFLDVPDKIRVSKKPEKALTKLHNNHVGRQAVIMKMAKKCKCHGVSGSCEMKTCIRALPDFRVVGDLLKSRFHKAMQVHFVDSRLIPRYWPSRMFTDNDLIYLLKSPNYCVHNPHFGSLGTQGRKCAESSLLEKKPEETRGSCEELCCGRGHKKRTFSRVEQCHCKFHWCCDVKCDQCRKDVIEAVCD 401          
BLAST of WntA vs. Planmine SMEST
Match: SMESG000051375.1 (SMESG000051375.1)

HSP 1 Score: 813.527 bits (2100), Expect = 0.000e+0
Identity = 388/389 (99.74%), Postives = 389/389 (100.00%), Query Frame = 2
Query: 1229 MLVLILRFIAETYSSGLVFSMYQLQQISSNKYNHLSDSDPTSNPESSQNQQMTINNSPSKTVICQTFSLHQRKLCHQHFRLMESVVNGFLLGLNECQFQFADQIWNCKGHNVTIGGHRTKSKPRKKGKTYLDKLVSKSTPEAAYVSSVISAGVAHQVTKACSKGVHDSCGCDRTIYDTPESERFKWSGCSHNIHFGAAFTRQFLDVPDKIRVSKKPEKALTKLHNNHVGRQAVIMKMAKKCKCHGVSGSCEMKTCIRALPDFRVVGDLLKSRFHKAMQVHFVDSRLIPRYWPSRMFTDNDLIYLLKSPNYCVHNPHFGSLGTQGRKCAESSLLEKKPEETRGSCEELCCGRGHKKRTFSRVEQCHCKFHWCCDVKCDQCRKDVIEAVCD 2395
            MLVLILRFIAETYSSGLVFSMYQLQQISSNKYNHLSDSDPTSNPESSQNQQMTINNSPSKTVICQTFSLHQRKLCHQHFRLMESVVNGFLLGLNECQFQFADQIWNCKGHN+TIGGHRTKSKPRKKGKTYLDKLVSKSTPEAAYVSSVISAGVAHQVTKACSKGVHDSCGCDRTIYDTPESERFKWSGCSHNIHFGAAFTRQFLDVPDKIRVSKKPEKALTKLHNNHVGRQAVIMKMAKKCKCHGVSGSCEMKTCIRALPDFRVVGDLLKSRFHKAMQVHFVDSRLIPRYWPSRMFTDNDLIYLLKSPNYCVHNPHFGSLGTQGRKCAESSLLEKKPEETRGSCEELCCGRGHKKRTFSRVEQCHCKFHWCCDVKCDQCRKDVIEAVCD
Sbjct:    1 MLVLILRFIAETYSSGLVFSMYQLQQISSNKYNHLSDSDPTSNPESSQNQQMTINNSPSKTVICQTFSLHQRKLCHQHFRLMESVVNGFLLGLNECQFQFADQIWNCKGHNLTIGGHRTKSKPRKKGKTYLDKLVSKSTPEAAYVSSVISAGVAHQVTKACSKGVHDSCGCDRTIYDTPESERFKWSGCSHNIHFGAAFTRQFLDVPDKIRVSKKPEKALTKLHNNHVGRQAVIMKMAKKCKCHGVSGSCEMKTCIRALPDFRVVGDLLKSRFHKAMQVHFVDSRLIPRYWPSRMFTDNDLIYLLKSPNYCVHNPHFGSLGTQGRKCAESSLLEKKPEETRGSCEELCCGRGHKKRTFSRVEQCHCKFHWCCDVKCDQCRKDVIEAVCD 389          
BLAST of WntA vs. Planmine SMEST
Match: SMESG000037126.1 (SMESG000037126.1)

HSP 1 Score: 746.888 bits (1927), Expect = 0.000e+0
Identity = 361/362 (99.72%), Postives = 362/362 (100.00%), Query Frame = 2
Query:   59 MTTESKGTKKKLKNSASLNEKDKYLIVRENSATSHSFKSLSSVTIQGFFDSNNAFRIFYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFIRDHPSDGV 1144
            MTTESKGTKKKLKNSASLNEKDKYLIVRENSATSHSFKSLSSVTIQGFFDSNNAFRIFYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNI+SWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFIRDHPSDGV
Sbjct:    1 MTTESKGTKKKLKNSASLNEKDKYLIVRENSATSHSFKSLSSVTIQGFFDSNNAFRIFYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGILWDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNISSWRSKYSTTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITHKRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTMFLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYREKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVLEFFIRDHPSDGV 362          
BLAST of WntA vs. Planmine SMEST
Match: SMESG000066476.1 (SMESG000066476.1)

HSP 1 Score: 402.905 bits (1034), Expect = 7.559e-133
Identity = 198/406 (48.77%), Postives = 268/406 (66.01%), Query Frame = 2
Query: 1226 SMLVLILRFIAE----TYSSGLVFSMYQLQQISSNKYNHLSDSDPTSNPESSQNQQMTINNSPSKTVICQTFSLHQRKLCHQHFRLMESVVNGFLLGLNECQFQFADQIWNCKGHNVT---------IGGHRTKSKPRKKGK---TYLDKLVSKSTPEAAYVSSVISAGVAHQVTKACSKGVHDSCGCDRTIYDTPESERFKWSGCSHNIHFGAAFTRQFLDVPDKIRVSKKPEKALTKLHNNHVGRQAVIMKMAKKCKCHGVSGSCEMKTCIRALPDFRVVGDLLKSRFHKAMQVHFVDSRLIPRYWPSRMFTDNDLIYLLKSPNYCVHNPHFGSLGTQGRKCAESSLLEKKPEETRGSCEELCCGRGHKKRTFSRVEQCHCKFHWCCDVKCDQCRKDVIEAVCD 2395
            SML L++             GLV++M Q+ +I +                    Q    N   S + IC+    +Q+ LC +HF LM SVV+GF+LG+NECQFQFA+ +WNC+GHN T         +     + KP++  K   TY+D+L++KSTPE+A++ S+ISAGV++QVTKACS+GVH +CGCDRT+YD P+  +F WSGCSHNIHFGAAF+R+FLD  +KIR+ K+   ALT +HNNHVGR++VI KM  KCKCHGVSGSCEM+TC R LP FRVVGD LK RF K +QV F D++LIP+Y    MF + D++YL  SP++C H+   G+LGT GR C ++       +E   SC  LCC RG+  +T+ + EQCHCKF WCC V C+ C++ VI+A+C+
Sbjct:   14 SMLTLLIVMTIHCKICISGRGLVYTMIQIHKIGTRHQGF---------------QNTYANEYLSTSKICKRVLKNQKPLCEEHFPLMPSVVSGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDT--YNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVIDAICN 402          
BLAST of WntA vs. Planmine SMEST
Match: SMESG000067888.1 (SMESG000067888.1)

HSP 1 Score: 345.895 bits (886), Expect = 2.454e-111
Identity = 165/342 (48.25%), Postives = 222/342 (64.91%), Query Frame = 2
Query: 1370 QNQQMTINNSPSKTVICQTFSLHQRKLCHQHFRLMESVVNGFLLGLNECQFQFADQIWNCKGHNVTIGGHRTKSKPRKKGKTYLDKLVSKSTPEAAYVSSVISAGVAHQVTKACSKGVHDSCGCDRTIYDTPESERFKWSGCSHNIHFGAAFTRQFLDVPDKIRVSKKPEKALTKLHNNHVGRQAVIMKMAKKCKCHGVSGSCEMKTCIRALPDFRVVGDLLKSRFHKAMQVHFVDSRLIPRYWPSRMFTDNDLIYLLKSPNYCVHNPHFGSLGTQGRKCAESSLLEKKPEETRGSCEELCCGRGHKKRTFSRVEQCHCKFHWCCDVKCDQCRKDVIEAVCD 2395
            ++ +  +NN+    + C      QR +C +H  L+ SV++G  +G+ ECQ QF +  WNC GHN++I         +K  KTYLD L++K  PE+A++ S+ SA VAHQV+KACS G +  CGCDRTIY+TPE + F+W+GCS N+HFGAAF+++FLD P K ++ + P   L  LHN+H G + VI  M  KCKCHGVSGSCE KTC RALPD R VGD+LK +F KA+ V   D +L+P +      T++DL YL +SPN+C HNP +GSLGTQGR C  + +LE   E   GSC  LCC RG   + F   E+C CKF WCC V+C  C    +E+ C+
Sbjct:   37 ESTKFDLNNT---NIFCNQLMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPE-DNFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEH--EFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCEILKVESRCN 372          
The following BLAST results are available for this feature:
BLAST of WntA vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRKAG14.420e-9148.69protein kinase AMP-activated non-catalytic subunit... [more]
PRKAG11.051e-8949.15protein kinase AMP-activated non-catalytic subunit... [more]
PRKAG24.201e-8948.82protein kinase AMP-activated non-catalytic subunit... [more]
PRKAG25.736e-8948.82protein kinase AMP-activated non-catalytic subunit... [more]
PRKAG25.736e-8948.82protein kinase AMP-activated non-catalytic subunit... [more]
back to top
BLAST of WntA vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aakg-13.261e-8845.56AMP-Activated protein Kinase Gamma subunit [Sourc... [more]
aakg-14.407e-8846.77AMP-Activated protein Kinase Gamma subunit [Sourc... [more]
aakg-15.209e-8647.46AMP-Activated protein Kinase Gamma subunit [Sourc... [more]
aakg-11.452e-8545.56AMP-Activated protein Kinase Gamma subunit [Sourc... [more]
aakg-11.614e-8545.56AMP-Activated protein Kinase Gamma subunit [Sourc... [more]
back to top
BLAST of WntA vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SNF4Agamma1.050e-8645.24gene:FBgn0264357 transcript:FBtr0110937[more]
SNF4Agamma7.852e-8447.28gene:FBgn0264357 transcript:FBtr0112915[more]
SNF4Agamma7.852e-8447.28gene:FBgn0264357 transcript:FBtr0112916[more]
SNF4Agamma7.852e-8447.28gene:FBgn0264357 transcript:FBtr0301585[more]
SNF4Agamma1.518e-8147.28gene:FBgn0264357 transcript:FBtr0084024[more]
back to top
BLAST of WntA vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkag13.095e-9248.87protein kinase, AMP-activated, gamma 1 non-catalyt... [more]
prkag2a7.884e-9249.16protein kinase, AMP-activated, gamma 2 non-catalyt... [more]
prkag2a2.558e-9049.16protein kinase, AMP-activated, gamma 2 non-catalyt... [more]
prkag2b3.264e-8948.82protein kinase, AMP-activated, gamma 2 non-catalyt... [more]
prkag2b8.349e-8949.16protein kinase, AMP-activated, gamma 2 non-catalyt... [more]
back to top
BLAST of WntA vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
c1orf505.386e-9047.62chromosome 1 open reading frame 50 [Source:Xenbase... [more]
c1orf505.838e-9049.83chromosome 1 open reading frame 50 [Source:Xenbase... [more]
c1orf508.689e-9049.83chromosome 1 open reading frame 50 [Source:Xenbase... [more]
c1orf501.589e-8949.83chromosome 1 open reading frame 50 [Source:Xenbase... [more]
c1orf503.067e-8948.55chromosome 1 open reading frame 50 [Source:Xenbase... [more]
back to top
BLAST of WntA vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prkag15.937e-9146.63protein kinase, AMP-activated, gamma 1 non-catalyt... [more]
Prkag28.158e-9048.82protein kinase, AMP-activated, gamma 2 non-catalyt... [more]
Prkag27.909e-8848.82protein kinase, AMP-activated, gamma 2 non-catalyt... [more]
Prkag22.602e-8648.82protein kinase, AMP-activated, gamma 2 non-catalyt... [more]
Prkag31.229e-7543.43protein kinase, AMP-activated, gamma 3 non-catalyt... [more]
back to top
BLAST of WntA vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P58108|AAKG1_BOVIN1.584e-9146.795'-AMP-activated protein kinase subunit gamma-1 OS... [more]
sp|Q09138|AAKG1_PIG1.756e-9046.795'-AMP-activated protein kinase subunit gamma-1 OS... [more]
sp|P54619|AAKG1_HUMAN2.123e-9048.695'-AMP-activated protein kinase subunit gamma-1 OS... [more]
sp|O54950|AAKG1_MOUSE4.153e-9046.635'-AMP-activated protein kinase subunit gamma-1 OS... [more]
sp|P80385|AAKG1_RAT8.391e-9048.375'-AMP-activated protein kinase subunit gamma-1 OS... [more]
back to top
BLAST of WntA vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C3U5B10.000e+099.25Protein Wnt OS=Schmidtea mediterranea OX=79327 PE=... [more]
Q589S70.000e+085.82Protein Wnt OS=Dugesia japonica OX=6161 GN=Djwnt-A... [more]
T1E0Z80.000e+069.70Protein Wnt OS=Dendrocoelum lacteum OX=27895 PE=2 ... [more]
B0LMF73.871e-12948.52Protein Wnt OS=Schmidtea mediterranea OX=79327 GN=... [more]
T1D1142.410e-12848.40Protein Wnt OS=Dendrocoelum lacteum OX=27895 PE=2 ... [more]
back to top
BLAST of WntA vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkag2a9.270e-9249.15protein kinase, AMP-activated, gamma 2 non-catalyt... [more]
prkag2b1.384e-9048.825'-AMP-activated protein kinase subunit gamma-1 [S... [more]
prkag2b2.257e-8948.485'-AMP-activated protein kinase subunit gamma-1 [S... [more]
prkag3b1.212e-7844.44protein kinase, AMP-activated, gamma 3b non-cataly... [more]
prkag3b1.225e-7844.22protein kinase, AMP-activated, gamma 3b non-cataly... [more]
back to top
BLAST of WntA vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkag2b2.655e-8946.80protein kinase, AMP-activated, gamma 2 non-catalyt... [more]
ENSPMAT00000006067.15.959e-8848.12pep scaffold:Pmarinus_7.0:GL477824:15771:29650:-1 ... [more]
ENSPMAT00000004653.11.538e-6247.96pep scaffold:Pmarinus_7.0:GL479099:29087:37224:1 g... [more]
wnt37.434e-6135.28wingless-type MMTV integration site family, member... [more]
ENSPMAT00000010914.12.835e-5935.59pep scaffold:Pmarinus_7.0:GL478525:6655:13730:-1 g... [more]
back to top
BLAST of WntA vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SNF48.564e-4630.49Activating gamma subunit of the AMP-activated Snf1... [more]
back to top
BLAST of WntA vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO438622.211e-7444.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO310004.974e-7240.18Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7SZ54][more]
WNT21.707e-6739.31Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7S3E5][more]
WNT33.500e-6637.72Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7RXF5][more]
EDO494319.304e-6334.76Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7RGH9][more]
back to top
BLAST of WntA vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkag12.957e-9248.84protein kinase AMP-activated non-catalytic subunit... [more]
prkag14.323e-9249.01protein kinase AMP-activated non-catalytic subunit... [more]
prkag2b1.224e-9048.155'-AMP-activated protein kinase subunit gamma-2 [S... [more]
ENSORLT00000004916.24.498e-9048.15protein kinase AMP-activated non-catalytic subunit... [more]
prkag3b3.139e-8246.135'-AMP-activated protein kinase subunit gamma-1 [S... [more]
back to top
BLAST of WntA vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051375.10.000e+099.75SMESG000051375.1[more]
SMESG000051375.10.000e+099.74SMESG000051375.1[more]
SMESG000037126.10.000e+099.72SMESG000037126.1[more]
SMESG000066476.17.559e-13348.77SMESG000066476.1[more]
SMESG000067888.12.454e-11148.25SMESG000067888.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30022929
GenBankACJ64865.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022929 ID=SMED30022929|Name=WntA|organism=Schmidtea mediterranea sexual|type=transcript|length=2560bp
ATTTAATTTAAAATTAAAATTTATTTGATATTAAAATTGTATTTAAACAT
CTAGTTAAATGACTACCGAAAGCAAAGGCACTAAAAAAAAGCTGAAAAAT
TCGGCATCGCTGAACGAAAAAGACAAGTATTTAATAGTTCGTGAAAATTC
AGCGACATCTCACTCTTTCAAATCTTTAAGCTCGGTTACAATTCAGGGTT
TTTTCGATAGCAACAACGCTTTCAGAATATTCTATGAGAACCACTCGTGC
TATGACCTCGTGCCTGATAGTTCGAAATTGGTCGTGTTCGACACTTCATT
AAATGTTCAGAAGGCGTTCTATGCTCTCATTTACAACGGGGTTCGTGCCG
GAATTCTCTGGGATAATGATAAACAGGACTATGTCGGCATGTTCACCATT
ACCGATTTCATTAAGATACTATGTAGCGAATATAAGGTTTCTGGCCCGGA
TTTCGAGCGGTTTCAGCACTTGGAGTCCCAGAATATTGCCAGCTGGAGAA
GCAAATACAGCACGACTGACAGCGATTTCAGCGGGCTCGGCAGTGTCCGT
CCGGAGGATTCATTGAAGCAAGCGGTTCAAGCGTTGCTGAGCAAGCGCGT
GCATAGATTGCCTGTGATAGACAATATCTCTGGCAATCCTTTGCATATTA
TCACGCACAAACGAATCCTGAAATTTCTCCATATCAATCTCTACCATTTG
CCCATCCCGGCATTCATGACCCAGCCTATCGGAGATATCCCAATCGGCAC
CTATGCAAATGTGTGCAAGATCCGCCTCGATCAAGCCATCATTGAAGGTC
TCACTATGTTTCTCCAGTTTCGAGTTTCGGCACTGCCAGTTGTCGATGCT
GACGATATTCTCCAGGATATTTATTCAAAATTTGATGTTATTAATCTCGC
CACAACAAGGACTTACCACCAGCTGAACAGGAGCATCAGTGACGCGCTAG
CTTATAGAGAAAAGAAATTCGAGCAAGTGGCCACGTGTTACAGAACTGAT
AGTTTGCAGGCAGTGATTGACCATTTCCACACTCATGAGGTCCACCGATT
AATCATCATAGACAAAAATCATCGAGTGGAAGGCATCATTTCTTTATCAG
ACGTACTTGAATTCTTTATTAGAGATCACCCGAGTGACGGAGTGTAGTTA
TTGATTGATTATTATCATTATTATTATTATTCCATTAATCTAATGATTTT
GTGCCATACGAATATGATTATACAATCGATGCTGGTATTGATTCTCAGAT
TCATCGCAGAAACGTACAGTTCTGGACTTGTCTTTAGCATGTACCAGTTA
CAGCAGATCTCATCAAACAAATACAATCATTTAAGTGATTCTGATCCAAC
CTCAAATCCCGAATCCAGTCAAAACCAGCAAATGACAATTAACAACTCAC
CAAGTAAAACAGTAATATGTCAGACATTCAGCCTTCATCAAAGGAAGCTG
TGCCATCAGCATTTCCGACTGATGGAGAGTGTGGTCAATGGGTTTCTACT
GGGTTTGAATGAGTGCCAATTTCAGTTTGCTGATCAGATTTGGAATTGTA
AAGGACATAACGTGACGATCGGTGGACACCGAACAAAATCAAAACCACGC
AAGAAAGGAAAAACCTATTTAGATAAGCTAGTGTCAAAAAGTACTCCAGA
AGCAGCTTATGTATCATCAGTAATATCTGCTGGAGTAGCCCACCAAGTGA
CCAAGGCATGCAGTAAAGGGGTTCATGATAGTTGTGGCTGTGATCGGACA
ATATACGATACGCCTGAATCAGAAAGGTTTAAATGGAGTGGCTGCAGTCA
TAATATACATTTCGGTGCTGCATTTACTCGTCAATTCCTAGATGTTCCAG
ACAAAATTCGTGTTAGTAAAAAACCAGAAAAAGCATTGACGAAACTTCAC
AATAATCATGTTGGAAGACAAGCGGTGATTATGAAAATGGCCAAAAAATG
CAAATGTCATGGTGTCAGTGGCTCCTGTGAAATGAAGACGTGCATTCGAG
CTCTACCTGATTTCCGAGTTGTCGGTGATCTTTTAAAATCTAGATTCCAT
AAAGCAATGCAGGTACATTTTGTCGATTCCAGACTCATACCTCGATATTG
GCCAAGCCGAATGTTTACTGACAATGATCTCATTTACCTTCTCAAATCTC
CGAATTACTGTGTTCACAATCCTCACTTTGGCAGTTTAGGAACCCAGGGC
CGAAAGTGTGCAGAATCGTCTTTACTTGAAAAAAAGCCAGAAGAAACAAG
AGGGAGCTGCGAAGAATTGTGCTGTGGCAGAGGTCACAAGAAAAGAACAT
TTTCAAGGGTTGAGCAGTGTCATTGCAAGTTTCATTGGTGTTGTGATGTG
AAATGTGATCAGTGCAGAAAGGATGTGATTGAAGCTGTATGCGATTGATT
GGTCTGATTGTCATTTATCATTGTTATTGTTTATGGAAGGACAAATTAGA
AATCGAATCATTGCACAATTGGATCTATTTTTTGTTTCATTCGATCCGAT
TTTCTCATCTGTCATTACACATTTTATTGATTTTATTTATCACCATAAAT
TTAATTTCGG
back to top

protein sequence of SMED30022929-orf-1

>SMED30022929-orf-1 ID=SMED30022929-orf-1|Name=SMED30022929-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=363bp
MTTESKGTKKKLKNSASLNEKDKYLIVRENSATSHSFKSLSSVTIQGFFD
SNNAFRIFYENHSCYDLVPDSSKLVVFDTSLNVQKAFYALIYNGVRAGIL
WDNDKQDYVGMFTITDFIKILCSEYKVSGPDFERFQHLESQNIASWRSKY
STTDSDFSGLGSVRPEDSLKQAVQALLSKRVHRLPVIDNISGNPLHIITH
KRILKFLHINLYHLPIPAFMTQPIGDIPIGTYANVCKIRLDQAIIEGLTM
FLQFRVSALPVVDADDILQDIYSKFDVINLATTRTYHQLNRSISDALAYR
EKKFEQVATCYRTDSLQAVIDHFHTHEVHRLIIIDKNHRVEGIISLSDVL
EFFIRDHPSDGV*
back to top

protein sequence of SMED30022929-orf-2

>SMED30022929-orf-2 ID=SMED30022929-orf-2|Name=SMED30022929-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=402bp
MILCHTNMIIQSMLVLILRFIAETYSSGLVFSMYQLQQISSNKYNHLSDS
DPTSNPESSQNQQMTINNSPSKTVICQTFSLHQRKLCHQHFRLMESVVNG
FLLGLNECQFQFADQIWNCKGHNVTIGGHRTKSKPRKKGKTYLDKLVSKS
TPEAAYVSSVISAGVAHQVTKACSKGVHDSCGCDRTIYDTPESERFKWSG
CSHNIHFGAAFTRQFLDVPDKIRVSKKPEKALTKLHNNHVGRQAVIMKMA
KKCKCHGVSGSCEMKTCIRALPDFRVVGDLLKSRFHKAMQVHFVDSRLIP
RYWPSRMFTDNDLIYLLKSPNYCVHNPHFGSLGTQGRKCAESSLLEKKPE
ETRGSCEELCCGRGHKKRTFSRVEQCHCKFHWCCDVKCDQCRKDVIEAVC
D*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000044cephalic ganglia
PLANA:0000062esophagus
PLANA:0000072mouth
PLANA:0000097ventral nerve cord
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000136whole organism
PLANA:0000142posterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR043158Wnt_C
IPR005817Wnt
IPR018161Wnt_CS
IPR000644CBS_dom
Vocabulary: molecular function
TermDefinition
GO:0005102signaling receptor binding
Vocabulary: biological process
TermDefinition
GO:0016055Wnt signaling pathway
GO:0007275multicellular organism development
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005578proteinaceous extracellular matrix
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005817WntPRINTSPR01349WNTPROTEINcoord: 171..184
score: 49.18
coord: 152..166
score: 41.48
coord: 312..323
score: 59.22
coord: 254..268
score: 76.17
coord: 196..208
score: 50.06
IPR005817WntSMARTSM00097wnt1_3coord: 75..401
e-value: 8.9E-99
score: 344.1
IPR005817WntPFAMPF00110wntcoord: 77..400
e-value: 2.3E-100
score: 336.1
IPR005817WntPANTHERPTHR12027WNT RELATEDcoord: 68..400
IPR043158Wnt, C-terminal domainGENE3DG3DSA:3.30.2460.20coord: 334..401
e-value: 3.8E-17
score: 64.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 45..66
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..26
score: 0.629
IPR018161Wnt protein, conserved sitePROSITEPS00246WNT1coord: 253..262