Synaptotagmin

Overview
NameSynaptotagmin
Smed IDSMED30022907
Uniprot Best hitSynaptotagmin-1 OS=Aplysia californica OX=6500 GN=SYT1 PE=1 SV=2 (E=2.45247e-177)
Length (bp)1814
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Synaptotagmin (SMED30022907) t-SNE clustered cells

Violin plots show distribution of expression levels for Synaptotagmin (SMED30022907) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Synaptotagmin (SMED30022907) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Synaptotagmin (SMED30022907) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top

Expression Details

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Anatomical Expression

PAGE et. al., 2020




SMED30022907

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 26

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30022907SMESG000025329.1 SmedASXL_010967SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30022907SMESG000025329.1 dd_Smed_v4_4222_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30022907SMESG000025329.1 dd_Smed_v4_4222_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30022907SMESG000025329.1 dd_Smed_v6_4222_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30022907SMESG000025329.1 SMED30022907smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
nervous systemSMED30022907SMESG000025329.1 SMED30022907smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
nervous systemSMED30022907SMESG000025329.1 SMED30022907smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
nervous systemSMED30022907SMESG000025329.1 SMED30022907smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
cephalic gangliaSMED30022907SMESG000025329.1 SMED30022907smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
cephalic gangliaSMED30022907SMESG000025329.1 SMED30022907smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
cephalic gangliaSMED30022907SMESG000025329.1 SMED30022907smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
peripheral nervous systemSMED30022907SMESG000025329.1 SMED30022907smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
peripheral nervous systemSMED30022907SMESG000025329.1 SMED30022907smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
peripheral nervous systemSMED30022907SMESG000025329.1 SMED30022907smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
ventral nerve cordSMED30022907SMESG000025329.1 SMED30022907smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
ventral nerve cordSMED30022907SMESG000025329.1 SMED30022907smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
ventral nerve cordSMED30022907SMESG000025329.1 SMED30022907smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
pharynx nerve plexusSMED30022907SMESG000025329.1 SMED30022907smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
pharynx nerve plexusSMED30022907SMESG000025329.1 SMED30022907smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
pharynx nerve plexusSMED30022907SMESG000025329.1 SMED30022907smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
embryonic pharynx neuronSMED30022907SMESG000025329.1 SMED30022907smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 4 colorimetric in situ hybridization evidence
embryonic pharynx neuronSMED30022907SMESG000025329.1 SMED30022907smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 3 colorimetric in situ hybridization evidence
headSMED30022907SMESG000025329.1 OX_Smed_1.0.23351ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
neuronSMED30022907SMESG000025329.1 dd_Smed_v6_4222_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30022907SMESG000025329.1 dd_Smed_v6_4222_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30022907SMESG000025329.1 dd_Smed_v6_4222_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Synaptotagmin vs. Ensembl Human
Match: SYT1 (synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509])

HSP 1 Score: 414.075 bits (1063), Expect = 1.126e-139
Identity = 213/311 (68.49%), Postives = 256/311 (82.32%), Query Frame = 3
Query:  339 VVDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
             ++MK  + LG + K++   D +      +  E  + KE+  LGKLQYSLDYDFQ  +L VG+IQA +LPA+DM GTSDPYVK++LLPDKKKKFETKVHRK LNPVFNE F FKVP++E+  KTL+  VYDFDRFSKHD IG+ KVP+  +D G V EEW++L+S E   E++ +LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV ++VTV+DYD+IG ++ IG++ +G N+TGAELRHWSDMLANPRRPIAQWHTLQ
Sbjct:  101 AINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK--EEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQ 409          
BLAST of Synaptotagmin vs. Ensembl Human
Match: SYT1 (synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509])

HSP 1 Score: 414.075 bits (1063), Expect = 1.126e-139
Identity = 213/311 (68.49%), Postives = 256/311 (82.32%), Query Frame = 3
Query:  339 VVDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
             ++MK  + LG + K++   D +      +  E  + KE+  LGKLQYSLDYDFQ  +L VG+IQA +LPA+DM GTSDPYVK++LLPDKKKKFETKVHRK LNPVFNE F FKVP++E+  KTL+  VYDFDRFSKHD IG+ KVP+  +D G V EEW++L+S E   E++ +LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV ++VTV+DYD+IG ++ IG++ +G N+TGAELRHWSDMLANPRRPIAQWHTLQ
Sbjct:  101 AINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK--EEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQ 409          
BLAST of Synaptotagmin vs. Ensembl Human
Match: SYT1 (synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509])

HSP 1 Score: 414.075 bits (1063), Expect = 1.126e-139
Identity = 213/311 (68.49%), Postives = 256/311 (82.32%), Query Frame = 3
Query:  339 VVDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
             ++MK  + LG + K++   D +      +  E  + KE+  LGKLQYSLDYDFQ  +L VG+IQA +LPA+DM GTSDPYVK++LLPDKKKKFETKVHRK LNPVFNE F FKVP++E+  KTL+  VYDFDRFSKHD IG+ KVP+  +D G V EEW++L+S E   E++ +LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV ++VTV+DYD+IG ++ IG++ +G N+TGAELRHWSDMLANPRRPIAQWHTLQ
Sbjct:  101 AINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK--EEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQ 409          
BLAST of Synaptotagmin vs. Ensembl Human
Match: SYT1 (synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509])

HSP 1 Score: 412.149 bits (1058), Expect = 4.796e-139
Identity = 204/269 (75.84%), Postives = 237/269 (88.10%), Query Frame = 3
Query:  465 LGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            LGKLQYSLDYDFQ  +L VG+IQA +LPA+DM GTSDPYVK++LLPDKKKKFETKVHRK LNPVFNE F FKVP++E+  KTL+  VYDFDRFSKHD IG+ KVP+  +D G V EEW++L+S E   E++ +LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV ++VTV+DYD+IG ++ IG++ +G N+TGAELRHWSDMLANPRRPIAQWHTLQ
Sbjct:  140 LGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK--EEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQ 406          
BLAST of Synaptotagmin vs. Ensembl Human
Match: SYT2 (synaptotagmin 2 [Source:HGNC Symbol;Acc:HGNC:11510])

HSP 1 Score: 402.134 bits (1032), Expect = 4.066e-135
Identity = 196/270 (72.59%), Postives = 236/270 (87.41%), Query Frame = 3
Query:  462 HLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            +LGKLQ+SLDYDFQ  +LTVGV+QA +LPA+DM GTSDPYVK++LLPDKKKK+ETKVHRK LNP FNETF FKVP+ E+  KTL+  +YDFDRFSKHD IG++KVP+  +DLG+ IEEW++L+  E   E+  +LGDIC SLRYVPT+GKLT+ ILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTT+KK TLNPY+NESFSFE+PFEQIQKV ++VTV+DYD++G +E IG+I +G NATG ELRHWSDMLANPRRPIAQWH+L+
Sbjct:  139 NLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEK--EEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLK 406          

HSP 2 Score: 84.7297 bits (208), Expect = 6.634e-17
Identity = 50/135 (37.04%), Postives = 84/135 (62.22%), Query Frame = 3
Query:  429 DNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKK--KFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKEL 827
            D +G +++E   LG +  SL Y    G+LTV +++A +L  MD+ G SDPYVK++L+ + K+  K +T V +K LNP FNE+F F++PF ++    ++  V D+D+  K++ IG+I V  G+   G  +  W ++
Sbjct:  259 DLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFV--GSNATGTELRHWSDM 391          
BLAST of Synaptotagmin vs. Ensembl Celegans
Match: snt-1 (Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:P34693])

HSP 1 Score: 418.698 bits (1075), Expect = 1.113e-141
Identity = 226/317 (71.29%), Postives = 262/317 (82.65%), Query Frame = 3
Query:  339 VVDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVH--LGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPE 1283
            VVD K+ Q +          DLEEL   ME NE  + +E     LG++QY LDYDFQ+G+LTV VIQA DLP MDMSGTSDPYVKLYLLP+KKKK ETKVHRK LNPVFNETF+FKV FNE+ +KTL+F +YDFDRFSKHDQIGQ+ +PLG IDLG VIEEWK++  P +D E E  LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+ LM  GKR+KKKKT+IKK TLNPYYNESFSFEVPFEQIQKV+L++TV+DYD++G+++ IGR +LGCN TGAELRHW DMLA+PRRPIAQWHTL  + E
Sbjct:  124 VVDGKNIQGMAQ--------DLEELGDAMEQNEKEQAEEKEEVKLGRIQYKLDYDFQQGQLTVTVIQAEDLPGMDMSGTSDPYVKLYLLPEKKKKVETKVHRKTLNPVFNETFIFKVAFNEITAKTLVFAIYDFDRFSKHDQIGQVLIPLGKIDLGAVIEEWKDIAPPPDDKEAEKSLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIVLMQGGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKVSLMITVMDYDKLGSNDAIGRCLLGCNGTGAELRHWMDMLASPRRPIAQWHTLGPVEE 432          
BLAST of Synaptotagmin vs. Ensembl Celegans
Match: snt-1 (Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:P34693])

HSP 1 Score: 389.808 bits (1000), Expect = 2.454e-130
Identity = 214/319 (67.08%), Postives = 257/319 (80.56%), Query Frame = 3
Query:  339 VVDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVH--LGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLM-LNGXXXXXXXXXXXXXXLNPYYNESFSFE-VPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPE 1283
            VVD K+ Q +          DLEEL   ME NE  + +E     LG++QY LDYDFQ+G+LTV VIQA DLP MDMSGTSDPYVKLYLLP+KKKK ETKVHRK LNPVFNETF+FKV FNE+ +KTL+F +YDFDRFSKHDQIGQ+ +PLG IDLG VIEEWK++  P +D E E  LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVKL +   + KR+KKKKT IK+ TLNPY+NESF F+ +P  +++KV+L++TV+DYD++G+++ IGR +LGCN TGAELRHW DMLA+PRRPIAQWHTL  + E
Sbjct:  124 VVDGKNIQGMAQ--------DLEELGDAMEQNEKEQAEEKEEVKLGRIQYKLDYDFQQGQLTVTVIQAEDLPGMDMSGTSDPYVKLYLLPEKKKKVETKVHRKTLNPVFNETFIFKVAFNEITAKTLVFAIYDFDRFSKHDQIGQVLIPLGKIDLGAVIEEWKDIAPPPDDKEAEKSLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKLEMFGEDRKRLKKKKTNIKRKTLNPYFNESFVFDKLPLHKMKKVSLMITVMDYDKLGSNDAIGRCLLGCNGTGAELRHWMDMLASPRRPIAQWHTLGPVEE 434          
BLAST of Synaptotagmin vs. Ensembl Celegans
Match: snt-3 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5])

HSP 1 Score: 350.903 bits (899), Expect = 1.716e-117
Identity = 173/268 (64.55%), Postives = 215/268 (80.22%), Query Frame = 3
Query:  465 LGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTL 1268
            LG+LQY LDYDF K  LTV +IQA +LPAMD+ GTSDPYVKL+LLPDKKKK +TKV RK LNPVFNE+F FK+PFNE+  +TL+ NV+DFDRF KHDQIGQI +PLG +DL   +E    +ESP      ENRLG++C +LRYVP   KL++V++E KNLKKMDV GLSDPYVK+ LM+  KR++KKKTTIK  TLNPYYNESFSF+V  E++Q+V+L VTV DYDR+G++E IG++++G  ATG  L+ W+DMLA PRR +AQWHTL
Sbjct:   16 LGRLQYKLDYDFDKNSLTVVIIQAEELPAMDLGGTSDPYVKLFLLPDKKKKLQTKVQRKSLNPVFNESFTFKIPFNEIGGQTLVLNVFDFDRFGKHDQIGQISIPLGKVDLAATLERTDLIESPP-----ENRLGEVCLALRYVPNKNKLSVVVMECKNLKKMDVLGLSDPYVKIYLMMGTKRLEKKKTTIKMKTLNPYYNESFSFDVTSEKMQRVHLHVTVSDYDRVGSNERIGQVIIGTCATGVALKQWNDMLATPRRSVAQWHTL 278          

HSP 2 Score: 73.1738 bits (178), Expect = 4.682e-14
Identity = 46/142 (32.39%), Postives = 81/142 (57.04%), Query Frame = 3
Query:  408 ELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKK--KFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKEL 827
            +L A +E  + ++   +  LG++  +L Y   K +L+V V++  +L  MD+ G SDPYVK+YL+   K+  K +T +  K LNP +NE+F F V   ++    L   V D+DR   +++IGQ+ +  G    G  +++W ++
Sbjct:  125 DLAATLERTDLIESPPENRLGEVCLALRYVPNKNKLSVVVMECKNLKKMDVLGLSDPYVKIYLMMGTKRLEKKKTTIKMKTLNPYYNESFSFDVTSEKMQRVHLHVTVSDYDRVGSNERIGQVII--GTCATGVALKQWNDM 264          
BLAST of Synaptotagmin vs. Ensembl Celegans
Match: snt-3 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5])

HSP 1 Score: 350.903 bits (899), Expect = 1.716e-117
Identity = 173/268 (64.55%), Postives = 215/268 (80.22%), Query Frame = 3
Query:  465 LGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTL 1268
            LG+LQY LDYDF K  LTV +IQA +LPAMD+ GTSDPYVKL+LLPDKKKK +TKV RK LNPVFNE+F FK+PFNE+  +TL+ NV+DFDRF KHDQIGQI +PLG +DL   +E    +ESP      ENRLG++C +LRYVP   KL++V++E KNLKKMDV GLSDPYVK+ LM+  KR++KKKTTIK  TLNPYYNESFSF+V  E++Q+V+L VTV DYDR+G++E IG++++G  ATG  L+ W+DMLA PRR +AQWHTL
Sbjct:   16 LGRLQYKLDYDFDKNSLTVVIIQAEELPAMDLGGTSDPYVKLFLLPDKKKKLQTKVQRKSLNPVFNESFTFKIPFNEIGGQTLVLNVFDFDRFGKHDQIGQISIPLGKVDLAATLERTDLIESPP-----ENRLGEVCLALRYVPNKNKLSVVVMECKNLKKMDVLGLSDPYVKIYLMMGTKRLEKKKTTIKMKTLNPYYNESFSFDVTSEKMQRVHLHVTVSDYDRVGSNERIGQVIIGTCATGVALKQWNDMLATPRRSVAQWHTL 278          

HSP 2 Score: 73.1738 bits (178), Expect = 4.682e-14
Identity = 46/142 (32.39%), Postives = 81/142 (57.04%), Query Frame = 3
Query:  408 ELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKK--KFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKEL 827
            +L A +E  + ++   +  LG++  +L Y   K +L+V V++  +L  MD+ G SDPYVK+YL+   K+  K +T +  K LNP +NE+F F V   ++    L   V D+DR   +++IGQ+ +  G    G  +++W ++
Sbjct:  125 DLAATLERTDLIESPPENRLGEVCLALRYVPNKNKLSVVVMECKNLKKMDVLGLSDPYVKIYLMMGTKRLEKKKTTIKMKTLNPYYNESFSFDVTSEKMQRVHLHVTVSDYDRVGSNERIGQVII--GTCATGVALKQWNDM 264          
BLAST of Synaptotagmin vs. Ensembl Celegans
Match: snt-2 (Synaptotagmin 2 [Source:UniProtKB/Swiss-Prot;Acc:K8FE10])

HSP 1 Score: 290.812 bits (743), Expect = 6.169e-93
Identity = 146/278 (52.52%), Postives = 200/278 (71.94%), Query Frame = 3
Query:  468 GKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGC------NATGAELRHWSDMLANPRRPIAQWHTLQEMPE 1283
            G + + ++YDF++ +L+V ++ A+DLPAMD +G SDPYVK+Y+LP++K+KFET++ R  LNP +NETF F +PFNE+ SKTL+  VYD+DR SK D++GQ+ VPL +ID G   +  + L+ PE D EKE RLGDICFS RY P +G +T+ I+EA+NLKKMDVGG SDPYVK+ L    K + KKKT+ K  TLNPYYNESF F++    I+KV+LIV+V DYD++  ++ IG + LG         T A    W++M+ + RRP+ QWHTLQE  E
Sbjct:   85 GNIHFRVEYDFEQSKLSVTIVSASDLPAMDRNGMSDPYVKVYVLPERKQKFETRIIRNTLNPTYNETFQFSIPFNELHSKTLMLVVYDYDRLSKDDKMGQLSVPLESIDFGITTDIERPLQKPEKDDEKECRLGDICFSTRYRPATGTVTLTIMEARNLKKMDVGGSSDPYVKIYLHHGRKLLSKKKTSRKYKTLNPYYNESFQFKIEPHMIEKVHLIVSVWDYDKMSKNDFIGEVTLGSKHLNLPQITHACSEQWAEMMTS-RRPVVQWHTLQERME 361          

HSP 2 Score: 84.3445 bits (207), Expect = 2.816e-17
Identity = 45/133 (33.83%), Postives = 81/133 (60.90%), Query Frame = 3
Query:  447 EKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHR--KILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVI----EEWKEL 827
            ++++  LG + +S  Y    G +T+ +++A +L  MD+ G+SDPYVK+YL   +K   + K  R  K LNP +NE+F FK+  + +    LI +V+D+D+ SK+D IG++ +    ++L ++     E+W E+
Sbjct:  211 DEKECRLGDICFSTRYRPATGTVTLTIMEARNLKKMDVGGSSDPYVKIYLHHGRKLLSKKKTSRKYKTLNPYYNESFQFKIEPHMIEKVHLIVSVWDYDKMSKNDFIGEVTLGSKHLNLPQITHACSEQWAEM 343          

HSP 3 Score: 71.2478 bits (173), Expect = 4.570e-13
Identity = 50/151 (33.11%), Postives = 80/151 (52.98%), Query Frame = 3
Query:  747 KHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKE--------NRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRI 1175
            KH  IG   VP+ +     V     +   P N+G            + G+I F + Y     KL++ I+ A +L  MD  G+SDPYVK+ ++   +R +K +T I + TLNP YNE+F F +PF ++    L++ V DYDR+   + +G++
Sbjct:   37 KHVDIGNGAVPILSSKPITVQPTNSDYYEPVNNGTLPLSSSGALIKQYGNIHFRVEYDFEQSKLSVTIVSASDLPAMDRNGMSDPYVKVYVL--PERKQKFETRIIRNTLNPTYNETFQFSIPFNELHSKTLMLVVYDYDRLSKDDKMGQL 185          
BLAST of Synaptotagmin vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0077726)

HSP 1 Score: 456.062 bits (1172), Expect = 1.072e-155
Identity = 225/317 (70.98%), Postives = 270/317 (85.17%), Query Frame = 3
Query:  342 VDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFK-VPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN 1289
            VDMKS QLLG++YKEK+QPD+EEL  N E+ +   ++ +  LG+L + L+YDF    L V VIQA +LPA+DM GTSDPYVK+YLLPDKKKKFETKVHRK L+PVFNETF FK +P+ +  +KTL+F ++DFDRFSKHDQIG++KVPL  IDL + IEEW++L S E +G +E +LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+++M NGKR+KKKKT+IKK TLNPYYNESFSFEVPFEQIQK+ L+VTVVDYDRIGTSEPIGR +LGC  TG ELRHWSDMLA+PRRPIAQWHTL++  E +
Sbjct:  152 VDMKSVQLLGSAYKEKVQPDMEELTENAEEGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGEGGQE-KLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTLKDPEETD 467          
BLAST of Synaptotagmin vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0343993)

HSP 1 Score: 454.136 bits (1167), Expect = 6.148e-155
Identity = 225/317 (70.98%), Postives = 268/317 (84.54%), Query Frame = 3
Query:  342 VDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFK-VPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN 1289
            VDMKS QLLG++YKEK+QPD+EEL  N E+ +   ++ +  LG+L + L+YDF    L V VIQA +LPA+DM GTSDPYVK+YLLPDKKKKFETKVHRK L+PVFNETF FK +P+ +  +KTL+F ++DFDRFSKHDQIG++KVPL  IDL + IEEW++L S E  GE   +LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+++M NGKR+KKKKT+IKK TLNPYYNESFSFEVPFEQIQK+ L+VTVVDYDRIGTSEPIGR +LGC  TG ELRHWSDMLA+PRRPIAQWHTL++  E +
Sbjct:  152 VDMKSVQLLGSAYKEKVQPDMEELTENAEEGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVE--GEGGQKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTLKDPEETD 466          
BLAST of Synaptotagmin vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0332218)

HSP 1 Score: 453.751 bits (1166), Expect = 7.713e-155
Identity = 224/317 (70.66%), Postives = 268/317 (84.54%), Query Frame = 3
Query:  342 VDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFK-VPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN 1289
            VDMKS QLLG++YKEK+QPD+EEL  N E+ +   ++ +  LG+L + L+YDF    L V VIQA +LPA+DM GTSDPYVK+YLLPDKKKKFETKVHRK L+PVFNETF FK +P+ +  +KTL+F ++DFDRFSKHDQIG++KVPL  IDL + IEEW++L S E +G    +LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+++M NGKR+KKKKT+IKK TLNPYYNESFSFEVPFEQIQK+ L+VTVVDYDRIGTSEPIGR +LGC  TG ELRHWSDMLA+PRRPIAQWHTL++  E +
Sbjct:  152 VDMKSVQLLGSAYKEKVQPDMEELTENAEEGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGEG---GQLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTLKDPEETD 465          
BLAST of Synaptotagmin vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0077728)

HSP 1 Score: 447.973 bits (1151), Expect = 1.554e-152
Identity = 224/317 (70.66%), Postives = 268/317 (84.54%), Query Frame = 3
Query:  342 VDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFK-VPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN 1289
            VDMKS QLLG++YKEK  PD+EEL  N E+ +   ++ +  LG+L + L+YDF    L V VIQA +LPA+DM GTSDPYVK+YLLPDKKKKFETKVHRK L+PVFNETF FK +P+ +  +KTL+F ++DFDRFSKHDQIG++KVPL  IDL + IEEW++L S E +G +E +LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+++M NGKR+KKKKT+IKK TLNPYYNESFSFEVPFEQIQK+ L+VTVVDYDRIGTSEPIGR +LGC  TG ELRHWSDMLA+PRRPIAQWHTL++  E +
Sbjct:  152 VDMKSVQLLGSAYKEK--PDMEELTENAEEGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGEGGQE-KLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTLKDPEETD 465          
BLAST of Synaptotagmin vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0345331)

HSP 1 Score: 447.973 bits (1151), Expect = 1.554e-152
Identity = 224/317 (70.66%), Postives = 268/317 (84.54%), Query Frame = 3
Query:  342 VDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFK-VPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN 1289
            VDMKS QLLG++YKEK  PD+EEL  N E+ +   ++ +  LG+L + L+YDF    L V VIQA +LPA+DM GTSDPYVK+YLLPDKKKKFETKVHRK L+PVFNETF FK +P+ +  +KTL+F ++DFDRFSKHDQIG++KVPL  IDL + IEEW++L S E +G +E +LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+++M NGKR+KKKKT+IKK TLNPYYNESFSFEVPFEQIQK+ L+VTVVDYDRIGTSEPIGR +LGC  TG ELRHWSDMLA+PRRPIAQWHTL++  E +
Sbjct:  152 VDMKSVQLLGSAYKEK--PDMEELTENAEEGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGEGGQE-KLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTLKDPEETD 465          
BLAST of Synaptotagmin vs. Ensembl Zebrafish
Match: syt1a (synaptotagmin Ia [Source:ZFIN;Acc:ZDB-GENE-040718-165])

HSP 1 Score: 402.905 bits (1034), Expect = 1.280e-135
Identity = 197/269 (73.23%), Postives = 232/269 (86.25%), Query Frame = 3
Query:  465 LGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            LGKLQYS+DY+F +  L VG+IQA +LPAMDM GTSDPYVK+YLLPDKKKKFETKVHRK LNPVFNE F FKVP+ E+  KTL+  VYDFDRFSKHD IG +KVP+  +D   V EEW++L+S E   E++ +LGDICFSLRYVPT+GKLT+V+LEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV +++TV+DYD+IG ++ IG++ +G N+TG ELRHWSDMLANPRRPIAQWH L+
Sbjct:  139 LGKLQYSMDYNFTENTLIVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYTELGGKTLVMTVYDFDRFSKHDAIGDVKVPMNKVDFSHVTEEWRDLQSAEK--EEQEKLGDICFSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVITVLDYDKIGKNDAIGKVFVGLNSTGTELRHWSDMLANPRRPIAQWHVLK 405          
BLAST of Synaptotagmin vs. Ensembl Zebrafish
Match: syt1a (synaptotagmin Ia [Source:ZFIN;Acc:ZDB-GENE-040718-165])

HSP 1 Score: 402.905 bits (1034), Expect = 1.280e-135
Identity = 197/269 (73.23%), Postives = 232/269 (86.25%), Query Frame = 3
Query:  465 LGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            LGKLQYS+DY+F +  L VG+IQA +LPAMDM GTSDPYVK+YLLPDKKKKFETKVHRK LNPVFNE F FKVP+ E+  KTL+  VYDFDRFSKHD IG +KVP+  +D   V EEW++L+S E   E++ +LGDICFSLRYVPT+GKLT+V+LEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV +++TV+DYD+IG ++ IG++ +G N+TG ELRHWSDMLANPRRPIAQWH L+
Sbjct:  139 LGKLQYSMDYNFTENTLIVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYTELGGKTLVMTVYDFDRFSKHDAIGDVKVPMNKVDFSHVTEEWRDLQSAEK--EEQEKLGDICFSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVITVLDYDKIGKNDAIGKVFVGLNSTGTELRHWSDMLANPRRPIAQWHVLK 405          
BLAST of Synaptotagmin vs. Ensembl Zebrafish
Match: syt2a (synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503-315])

HSP 1 Score: 376.326 bits (965), Expect = 4.286e-125
Identity = 184/269 (68.40%), Postives = 229/269 (85.13%), Query Frame = 3
Query:  465 LGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            LGKLQ+SLDYDF   +LTVG++QA DL +MD  GTSDPYVK+++LPDKKKK++TKVH+K LNPVFNETF FK+PF E+  KTL+ +VYDFDRFSKHD IG++K+P+  +DL + IE+W++L+S E   E+  +LGDIC SLRYVPT+GKLTI ILEAKNLKKMDVGGLSDPYVK+ L+ NGKR+KKKKTT+KK TLNPYYNESFSFE+P +Q+QK+  ++TV+DYD+IG ++ IG+I +G  A G ELRHWSDMLANPRRPIAQWH L+
Sbjct:  148 LGKLQFSLDYDFSASQLTVGILQAADLLSMDSGGTSDPYVKVFILPDKKKKYDTKVHKKTLNPVFNETFHFKIPFTEMGGKTLVMSVYDFDRFSKHDVIGEVKIPMNTLDLAQPIEQWRDLDSAEK--EEPEKLGDICISLRYVPTAGKLTICILEAKNLKKMDVGGLSDPYVKIHLLQNGKRLKKKKTTVKKNTLNPYYNESFSFEIPQDQMQKIQAVITVLDYDKIGKNDAIGKIWVGSKAQGTELRHWSDMLANPRRPIAQWHPLK 414          
BLAST of Synaptotagmin vs. Ensembl Zebrafish
Match: syt2a (synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503-315])

HSP 1 Score: 376.326 bits (965), Expect = 4.286e-125
Identity = 184/269 (68.40%), Postives = 229/269 (85.13%), Query Frame = 3
Query:  465 LGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            LGKLQ+SLDYDF   +LTVG++QA DL +MD  GTSDPYVK+++LPDKKKK++TKVH+K LNPVFNETF FK+PF E+  KTL+ +VYDFDRFSKHD IG++K+P+  +DL + IE+W++L+S E   E+  +LGDIC SLRYVPT+GKLTI ILEAKNLKKMDVGGLSDPYVK+ L+ NGKR+KKKKTT+KK TLNPYYNESFSFE+P +Q+QK+  ++TV+DYD+IG ++ IG+I +G  A G ELRHWSDMLANPRRPIAQWH L+
Sbjct:  148 LGKLQFSLDYDFSASQLTVGILQAADLLSMDSGGTSDPYVKVFILPDKKKKYDTKVHKKTLNPVFNETFHFKIPFTEMGGKTLVMSVYDFDRFSKHDVIGEVKIPMNTLDLAQPIEQWRDLDSAEK--EEPEKLGDICISLRYVPTAGKLTICILEAKNLKKMDVGGLSDPYVKIHLLQNGKRLKKKKTTVKKNTLNPYYNESFSFEIPQDQMQKIQAVITVLDYDKIGKNDAIGKIWVGSKAQGTELRHWSDMLANPRRPIAQWHPLK 414          
BLAST of Synaptotagmin vs. Ensembl Zebrafish
Match: syt5a (synaptotagmin Va [Source:ZFIN;Acc:ZDB-GENE-040718-110])

HSP 1 Score: 372.859 bits (956), Expect = 6.134e-124
Identity = 180/266 (67.67%), Postives = 228/266 (85.71%), Query Frame = 3
Query:  474 LQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            L+Y+LDY+F + +L VG++QA DLPAMD+ GTSDPYVK+Y+LPDKKKKFETKV RK L PVFNETF+FK+PFN++A +TL+  V+DFDRF KHD IG+IK+P+ +IDLG+ I E+K+L   E   E++ +LGDIC SLRYVPTSGKLT+ I+EAKNLKKMDVGGLSDP+VK+ L  NGKR+KKKKTT+K+ TLNPY+NESFSFE+PF QIQKV +++TV DYD++G+++PIG+  +G  A+G  LRHWSDMLANPRRP+AQWHTLQ
Sbjct:  133 LEYTLDYNFTENQLIVGILQAQDLPAMDIGGTSDPYVKVYMLPDKKKKFETKVQRKNLCPVFNETFIFKIPFNDLAGQTLVLQVFDFDRFGKHDVIGEIKIPMNSIDLGQPIHEYKDLVGGEK--EEQEKLGDICISLRYVPTSGKLTVCIMEAKNLKKMDVGGLSDPFVKIVLQHNGKRIKKKKTTVKQNTLNPYFNESFSFEIPFAQIQKVQVLITVYDYDKLGSNDPIGKCWIGFGASGVGLRHWSDMLANPRRPVAQWHTLQ 396          
BLAST of Synaptotagmin vs. Ensembl Xenopus
Match: SYT5 (synaptotagmin 5 [Source:NCBI gene;Acc:100493612])

HSP 1 Score: 441.425 bits (1134), Expect = 2.000e-150
Identity = 220/311 (70.74%), Postives = 267/311 (85.85%), Query Frame = 3
Query:  342 VDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVK-EKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            ++MK  + LG SY +K+QPD+E+LD ++ D+  VK EK    LGKLQYSLDYDFQ G+L VG+IQA DLPA+D+ GTSDPYVK+YLLPDKKKK+ETKVHRK LNP FNE+F FKVP+ E+  KTL+ +VYDFDRFSKHD IG+++V +  +DL  VIEEW++L+S E   E++ +LGDICFSLRYVPT+GKLT+++LEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV +++TV+DYD++G +E IG+I +GCNATG ELRHWSDMLANPRRPIAQWHTLQ
Sbjct:  101 INMKEVKELGKSYIDKVQPDVEDLDPSLLDD--VKDEKPQEKLGKLQYSLDYDFQTGQLVVGIIQAADLPALDIGGTSDPYVKVYLLPDKKKKYETKVHRKTLNPTFNESFTFKVPYAELGGKTLVMSVYDFDRFSKHDAIGEVRVHMNTVDLAHVIEEWQDLQSAEK--EEQEKLGDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVLTVLDYDKLGKNEAIGKIFVGCNATGTELRHWSDMLANPRRPIAQWHTLQ 407          
BLAST of Synaptotagmin vs. Ensembl Xenopus
Match: SYT5 (synaptotagmin 5 [Source:NCBI gene;Acc:100493612])

HSP 1 Score: 441.039 bits (1133), Expect = 2.005e-150
Identity = 220/311 (70.74%), Postives = 267/311 (85.85%), Query Frame = 3
Query:  342 VDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVK-EKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            ++MK  + LG SY +K+QPD+E+LD ++ D+  VK EK    LGKLQYSLDYDFQ G+L VG+IQA DLPA+D+ GTSDPYVK+YLLPDKKKK+ETKVHRK LNP FNE+F FKVP+ E+  KTL+ +VYDFDRFSKHD IG+++V +  +DL  VIEEW++L+S E   E++ +LGDICFSLRYVPT+GKLT+++LEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV +++TV+DYD++G +E IG+I +GCNATG ELRHWSDMLANPRRPIAQWHTLQ
Sbjct:   96 INMKEVKELGKSYIDKVQPDVEDLDPSLLDD--VKDEKPQEKLGKLQYSLDYDFQTGQLVVGIIQAADLPALDIGGTSDPYVKVYLLPDKKKKYETKVHRKTLNPTFNESFTFKVPYAELGGKTLVMSVYDFDRFSKHDAIGEVRVHMNTVDLAHVIEEWQDLQSAEK--EEQEKLGDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVLTVLDYDKLGKNEAIGKIFVGCNATGTELRHWSDMLANPRRPIAQWHTLQ 402          
BLAST of Synaptotagmin vs. Ensembl Xenopus
Match: e2f4 (E2F transcription factor 4 [Source:Xenbase;Acc:XB-GENE-482721])

HSP 1 Score: 414.461 bits (1064), Expect = 7.564e-140
Identity = 212/312 (67.95%), Postives = 259/312 (83.01%), Query Frame = 3
Query:  339 VVDMKSAQLLGNSYKEK-IQPDLEELDANMEDNEGVKEKEDVH-LGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTL 1268
             ++MK  + LG + K++ ++ D ++ +  + D E  ++ ++V  LGKLQYSLDYDFQ  +L VG+IQA +LPA+DM GTSDPYVKL+L+PDKKKKFETKVHRK LNPVFNE F FKVP+ E+  KTL+  VYDFDRFSKHD IG +KVP+  +D G V EEW++L S E   E++ +LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV ++VTV+DYD+IG ++ IG++ +G N+TGAELRHWSDMLANPRRPIAQWHTL
Sbjct:  102 AINMKDVKDLGKTMKDQALKDDDDDAETGLTDGEDKEQPKEVEKLGKLQYSLDYDFQNNQLMVGIIQAAELPALDMGGTSDPYVKLFLMPDKKKKFETKVHRKTLNPVFNEQFTFKVPYAELGGKTLVLTVYDFDRFSKHDVIGDVKVPMNTVDFGHVTEEWRDLVSAEK--EEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTL 411          
BLAST of Synaptotagmin vs. Ensembl Xenopus
Match: luzp2 (leucine zipper protein 2 [Source:Xenbase;Acc:XB-GENE-940667])

HSP 1 Score: 394.43 bits (1012), Expect = 4.693e-132
Identity = 189/265 (71.32%), Postives = 231/265 (87.17%), Query Frame = 3
Query:  477 QYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            Q+SLDYDFQ  ++ VG+IQAT+LPA+DM GTSDPYVK++ LPDKKKK ETKVHRK LNP+FNETF FK+P+ E+  KTL  ++YDFDRFSKHD IG++KVP+  +DLG+ IEEW++L+S E   E+  +LGDIC SLRYVPT+GKLT+ ILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTT+KK TLNPY+NESFSFE+PFEQIQKV +++TV+DYD++G +E IG+I +GCNA+G ELRHWSDMLANPRRPIAQWH L+
Sbjct:  150 QFSLDYDFQNNQMQVGIIQATELPALDMGGTSDPYVKVFFLPDKKKKHETKVHRKTLNPIFNETFTFKIPYQELGGKTLCMSIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQSAEK--EEPEKLGDICISLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVITVLDYDKLGKNEAIGKIFVGCNASGTELRHWSDMLANPRRPIAQWHPLK 412          
BLAST of Synaptotagmin vs. Ensembl Xenopus
Match: syt8 (synaptotagmin 8 [Source:NCBI gene;Acc:100037878])

HSP 1 Score: 332.798 bits (852), Expect = 1.941e-108
Identity = 174/305 (57.05%), Postives = 225/305 (73.77%), Query Frame = 3
Query:  369 GNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPE 1283
            GN     +QP       N++  E V+ +     G++QYSL+Y+FQ  ELTVGV QA  L AMD+ GTSDPY  +Y+  D +KKFETKV+RK LNPVFNE+FVFKV   EV   T +  ++DF+RF KHD IG++ +PLG ++L  VIE+WK+L  P    E E+ LGDICFSLRYVP+SGKLTI+ILEAKNLK+MD  G SDPYVK+ L LN K+ K+KKT +KK TL PY+NESF+F+V  EQ++ ++LI++V D+D++G +E IG++ LGC A+G  LRHWSDMLA+PRRPIAQWH LQE  E
Sbjct:   83 GNLTTHLVQPGA----GNLQKGEKVEYR-----GRVQYSLEYNFQTEELTVGVKQAAALKAMDLGGTSDPYAIVYVTNDTRKKFETKVNRKTLNPVFNESFVFKVTQEEVPRTTAVVQIFDFNRFLKHDVIGEMVIPLGEVNLQHVIEDWKDL-GPAGKTEHEH-LGDICFSLRYVPSSGKLTIIILEAKNLKRMDSDGFSDPYVKVHLALNRKKWKRKKTAVKKSTLKPYFNESFTFDVSLEQMKNLDLIISVWDHDKVGKNEQIGKLFLGCRASGNALRHWSDMLAHPRRPIAQWHKLQEADE 376          
BLAST of Synaptotagmin vs. Ensembl Mouse
Match: Syt1 (synaptotagmin I [Source:MGI Symbol;Acc:MGI:99667])

HSP 1 Score: 414.846 bits (1065), Expect = 4.302e-140
Identity = 213/310 (68.71%), Postives = 256/310 (82.58%), Query Frame = 3
Query:  342 VDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            ++MK  + LG + K++   D +      +  E  + KE+  LGKLQYSLDYDFQ  +L VG+IQA +LPA+DM GTSDPYVK++LLPDKKKKFETKVHRK LNPVFNE F FKVP++E+  KTL+  VYDFDRFSKHD IG+ KVP+  +D G V EEW++L+S E   E++ +LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV ++VTV+DYD+IG ++ IG++ +G N+TGAELRHWSDMLANPRRPIAQWHTLQ
Sbjct:  101 INMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK--EEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQ 408          
BLAST of Synaptotagmin vs. Ensembl Mouse
Match: Syt1 (synaptotagmin I [Source:MGI Symbol;Acc:MGI:99667])

HSP 1 Score: 414.846 bits (1065), Expect = 4.302e-140
Identity = 213/310 (68.71%), Postives = 256/310 (82.58%), Query Frame = 3
Query:  342 VDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            ++MK  + LG + K++   D +      +  E  + KE+  LGKLQYSLDYDFQ  +L VG+IQA +LPA+DM GTSDPYVK++LLPDKKKKFETKVHRK LNPVFNE F FKVP++E+  KTL+  VYDFDRFSKHD IG+ KVP+  +D G V EEW++L+S E   E++ +LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV ++VTV+DYD+IG ++ IG++ +G N+TGAELRHWSDMLANPRRPIAQWHTLQ
Sbjct:  101 INMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK--EEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQ 408          
BLAST of Synaptotagmin vs. Ensembl Mouse
Match: Syt2 (synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666])

HSP 1 Score: 402.519 bits (1033), Expect = 2.304e-135
Identity = 196/270 (72.59%), Postives = 236/270 (87.41%), Query Frame = 3
Query:  462 HLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            +LGKLQ+SLDYDFQ  +LTVGV+QA +LPA+DM GTSDPYVK++LLPDKKKK+ETKVHRK LNP FNETF FKVP+ E+  KTL+  +YDFDRFSKHD IG++KVP+  +DLG+ IEEW++L+  E   E+  +LGDIC SLRYVPT+GKLT+ ILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTT+KK TLNPY+NESFSFE+PFEQIQKV ++VTV+DYD++G +E IG+I +G NATG ELRHWSDMLANPRRPIAQWH+L+
Sbjct:  142 NLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEK--EEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLK 409          

HSP 2 Score: 85.1149 bits (209), Expect = 4.098e-17
Identity = 50/135 (37.04%), Postives = 84/135 (62.22%), Query Frame = 3
Query:  429 DNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKK--KFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKEL 827
            D +G +++E   LG +  SL Y    G+LTV +++A +L  MD+ G SDPYVK++L+ + K+  K +T V +K LNP FNE+F F++PF ++    ++  V D+D+  K++ IG+I V  G+   G  +  W ++
Sbjct:  262 DLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFV--GSNATGTELRHWSDM 394          
BLAST of Synaptotagmin vs. Ensembl Mouse
Match: Syt2 (synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666])

HSP 1 Score: 402.519 bits (1033), Expect = 2.304e-135
Identity = 196/270 (72.59%), Postives = 236/270 (87.41%), Query Frame = 3
Query:  462 HLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            +LGKLQ+SLDYDFQ  +LTVGV+QA +LPA+DM GTSDPYVK++LLPDKKKK+ETKVHRK LNP FNETF FKVP+ E+  KTL+  +YDFDRFSKHD IG++KVP+  +DLG+ IEEW++L+  E   E+  +LGDIC SLRYVPT+GKLT+ ILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTT+KK TLNPY+NESFSFE+PFEQIQKV ++VTV+DYD++G +E IG+I +G NATG ELRHWSDMLANPRRPIAQWH+L+
Sbjct:  142 NLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEK--EEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLK 409          

HSP 2 Score: 85.1149 bits (209), Expect = 4.098e-17
Identity = 50/135 (37.04%), Postives = 84/135 (62.22%), Query Frame = 3
Query:  429 DNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKK--KFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKEL 827
            D +G +++E   LG +  SL Y    G+LTV +++A +L  MD+ G SDPYVK++L+ + K+  K +T V +K LNP FNE+F F++PF ++    ++  V D+D+  K++ IG+I V  G+   G  +  W ++
Sbjct:  262 DLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFV--GSNATGTELRHWSDM 394          
BLAST of Synaptotagmin vs. Ensembl Mouse
Match: Syt5 (synaptotagmin V [Source:MGI Symbol;Acc:MGI:1926368])

HSP 1 Score: 368.622 bits (945), Expect = 1.154e-122
Identity = 186/311 (59.81%), Postives = 250/311 (80.39%), Query Frame = 3
Query:  342 VDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELE-SPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            V ++  + LG SY +K+QP++EELD +     G +  +   LG+LQYSLDYDFQ G+L VG++QA  L A+D+ G+SDPYV +YLLPDK+++ ETKVHR+ LNP F ETF FKVP+ E+  + L+  VYDFDRFS++D IG+++VP+ +++LGR ++ W+EL+ +P+ + EK   LGDICFSLRYVPT+GKLT+++LEAKNLKKMDVGGLSDPYVK+ L+  GK+V+KKKTTIKK TLNPYYNE+FSFEVP +Q+QKV + +TV+DYD++G +E IGR+ +G    GA LRHW+DMLANPRRPIAQWH+L+
Sbjct:   69 VHLQEVKELGRSYIDKVQPEIEELDRS-PSMPGQQVSDKHQLGRLQYSLDYDFQTGQLLVGILQAQGLAALDLGGSSDPYVSVYLLPDKRRRHETKVHRQTLNPHFGETFAFKVPYVELGGRVLVMAVYDFDRFSRNDAIGEVRVPMSSVNLGRPVQAWRELQVAPKEEQEK---LGDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKVHLLQGGKKVRKKKTTIKKNTLNPYYNEAFSFEVPCDQVQKVQVELTVLDYDKLGKNEAIGRVAVGAAVGGAGLRHWADMLANPRRPIAQWHSLR 375          
BLAST of Synaptotagmin vs. UniProt
Match: sp|P41823|SY65_APLCA (Synaptotagmin-1 OS=Aplysia californica OX=6500 GN=SYT1 PE=1 SV=2)

HSP 1 Score: 511.916 bits (1317), Expect = 2.452e-177
Identity = 254/318 (79.87%), Postives = 286/318 (89.94%), Query Frame = 3
Query:  339 VVDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKE-KEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN 1289
             VD+KS QLLGNSYKEK+QPDL+EL  NMEDNE  +  K +V LGKLQ+SLDYDFQKGEL+V VIQA DLP MDMSGTSDPYVK+YLLPDKKKK+ETKVHRK LNPVFNE+F FKVP+ EV SK L F VYDFDRFSKHDQIGQ++VPL +IDLGRV+E+WK+L+SP+ + EKEN+LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK++L+   KR+KKKKTTIKK TLNPY+NESF FEVPFEQIQKV LI+TVVDYDRIGTSEPIGR VLGCN++G ELRHWSDMLANPRRPIAQWHTLQE+PE N
Sbjct:  111 AVDLKSVQLLGNSYKEKVQPDLDELPVNMEDNEDAESTKSEVKLGKLQFSLDYDFQKGELSVNVIQAADLPGMDMSGTSDPYVKVYLLPDKKKKYETKVHRKTLNPVFNESFTFKVPYAEVGSKILTFAVYDFDRFSKHDQIGQVQVPLNSIDLGRVVEDWKDLQSPDTESEKENKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIALLQGTKRLKKKKTTIKKNTLNPYFNESFGFEVPFEQIQKVTLIITVVDYDRIGTSEPIGRCVLGCNSSGTELRHWSDMLANPRRPIAQWHTLQEVPEKN 428          
BLAST of Synaptotagmin vs. UniProt
Match: sp|P21521|SY65_DROME (Synaptotagmin 1 OS=Drosophila melanogaster OX=7227 GN=Syt1 PE=1 SV=3)

HSP 1 Score: 456.062 bits (1172), Expect = 1.075e-154
Identity = 225/317 (70.98%), Postives = 270/317 (85.17%), Query Frame = 3
Query:  342 VDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFK-VPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN 1289
            VDMKS QLLG++YKEK+QPD+EEL  N E+ +   ++ +  LG+L + L+YDF    L V VIQA +LPA+DM GTSDPYVK+YLLPDKKKKFETKVHRK L+PVFNETF FK +P+ +  +KTL+F ++DFDRFSKHDQIG++KVPL  IDL + IEEW++L S E +G +E +LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+++M NGKR+KKKKT+IKK TLNPYYNESFSFEVPFEQIQK+ L+VTVVDYDRIGTSEPIGR +LGC  TG ELRHWSDMLA+PRRPIAQWHTL++  E +
Sbjct:  152 VDMKSVQLLGSAYKEKVQPDMEELTENAEEGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGEGGQE-KLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTLKDPEETD 467          
BLAST of Synaptotagmin vs. UniProt
Match: sp|P34693|SYT1_CAEEL (Synaptotagmin-1 OS=Caenorhabditis elegans OX=6239 GN=snt-1 PE=2 SV=1)

HSP 1 Score: 418.698 bits (1075), Expect = 1.416e-140
Identity = 226/317 (71.29%), Postives = 262/317 (82.65%), Query Frame = 3
Query:  339 VVDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVH--LGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPE 1283
            VVD K+ Q +          DLEEL   ME NE  + +E     LG++QY LDYDFQ+G+LTV VIQA DLP MDMSGTSDPYVKLYLLP+KKKK ETKVHRK LNPVFNETF+FKV FNE+ +KTL+F +YDFDRFSKHDQIGQ+ +PLG IDLG VIEEWK++  P +D E E  LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+ LM  GKR+KKKKT+IKK TLNPYYNESFSFEVPFEQIQKV+L++TV+DYD++G+++ IGR +LGCN TGAELRHW DMLA+PRRPIAQWHTL  + E
Sbjct:  124 VVDGKNIQGMAQ--------DLEELGDAMEQNEKEQAEEKEEVKLGRIQYKLDYDFQQGQLTVTVIQAEDLPGMDMSGTSDPYVKLYLLPEKKKKVETKVHRKTLNPVFNETFIFKVAFNEITAKTLVFAIYDFDRFSKHDQIGQVLIPLGKIDLGAVIEEWKDIAPPPDDKEAEKSLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIVLMQGGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKVSLMITVMDYDKLGSNDAIGRCLLGCNGTGAELRHWMDMLASPRRPIAQWHTLGPVEE 432          
BLAST of Synaptotagmin vs. UniProt
Match: sp|P46096|SYT1_MOUSE (Synaptotagmin-1 OS=Mus musculus OX=10090 GN=Syt1 PE=1 SV=1)

HSP 1 Score: 414.846 bits (1065), Expect = 3.010e-139
Identity = 213/310 (68.71%), Postives = 256/310 (82.58%), Query Frame = 3
Query:  342 VDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            ++MK  + LG + K++   D +      +  E  + KE+  LGKLQYSLDYDFQ  +L VG+IQA +LPA+DM GTSDPYVK++LLPDKKKKFETKVHRK LNPVFNE F FKVP++E+  KTL+  VYDFDRFSKHD IG+ KVP+  +D G V EEW++L+S E   E++ +LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV ++VTV+DYD+IG ++ IG++ +G N+TGAELRHWSDMLANPRRPIAQWHTLQ
Sbjct:  101 INMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK--EEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQ 408          
BLAST of Synaptotagmin vs. UniProt
Match: sp|P21707|SYT1_RAT (Synaptotagmin-1 OS=Rattus norvegicus OX=10116 GN=Syt1 PE=1 SV=3)

HSP 1 Score: 414.461 bits (1064), Expect = 3.391e-139
Identity = 213/310 (68.71%), Postives = 256/310 (82.58%), Query Frame = 3
Query:  342 VDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            ++MK  + LG + K++   D +      +  E  + KE+  LGKLQYSLDYDFQ  +L VG+IQA +LPA+DM GTSDPYVK++LLPDKKKKFETKVHRK LNPVFNE F FKVP++E+  KTL+  VYDFDRFSKHD IG+ KVP+  +D G V EEW++L+S E   E++ +LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV ++VTV+DYD+IG ++ IG++ +G N+TGAELRHWSDMLANPRRPIAQWHTLQ
Sbjct:  101 INMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK--EEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQ 408          
BLAST of Synaptotagmin vs. TrEMBL
Match: gnl|BL_ORD_ID|19629942 (tr|Q9U8R6|Q9U8R6_DUGJA Djsyt protein OS=Dugesia japonica OX=6161 GN=Djsyt PE=2 SV=1)

HSP 1 Score: 662.144 bits (1707), Expect = 0.000e+0
Identity = 379/395 (95.95%), Postives = 389/395 (98.48%), Query Frame = 3
Query:  105 MKNSTHGSDHSASKASMKTNVEKFWHDLGKKLHMDPKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN 1289
            MKN THG+DH+ SK+ MK NV+KFW+DLGKKLHMDP+ALIGVT+GLGILFLLFLYCLCKKCVFKRRKKKE  KKGAKGVVDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKL+LLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTL+FNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESP+NDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN
Sbjct:    1 MKNVTHGTDHTVSKSDMKNNVQKFWNDLGKKLHMDPRALIGVTVGLGILFLLFLYCLCKKCVFKRRKKKEAGKKGAKGVVDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLFLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLVFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPDNDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN 395          
BLAST of Synaptotagmin vs. TrEMBL
Match: gnl|BL_ORD_ID|18245045 (tr|A0A267E333|A0A267E333_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031935g3 PE=4 SV=1)

HSP 1 Score: 542.347 bits (1396), Expect = 0.000e+0
Identity = 269/316 (85.13%), Postives = 294/316 (93.04%), Query Frame = 3
Query:  342 VDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN 1289
            VDMKS QLLGN YKEK+QPD+EEL   MEDNEG +EKE   LGKLQYSLDYDFQKGEL+VGVIQA+DLPAMDM GTSDPYVK+Y++P+KKKKFETKVHRK LNPVFNETF+FKVP+ +V SKTL+F VYDFDRFSKHDQIG IK+PLGAIDL R+IEEWK+++ PE++ +K NRLGDICFSLRYVPT+GKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV+LIVTVVDYDRIGTSEPIGRIVLGC ATGAELRHWSDMLANPRRPIAQWHTLQEMPE +
Sbjct:  116 VDMKSVQLLGNEYKEKVQPDMEELVETMEDNEGAQEKEVEKLGKLQYSLDYDFQKGELSVGVIQASDLPAMDMGGTSDPYVKVYIMPEKKKKFETKVHRKTLNPVFNETFIFKVPYADVPSKTLVFAVYDFDRFSKHDQIGLIKLPLGAIDLARLIEEWKDIDPPESEDDKSNRLGDICFSLRYVPTAGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRIKKKKTTIKKCTLNPYYNESFSFEVPFEQIQKVSLIVTVVDYDRIGTSEPIGRIVLGCTATGAELRHWSDMLANPRRPIAQWHTLQEMPEKS 431          
BLAST of Synaptotagmin vs. TrEMBL
Match: gnl|BL_ORD_ID|18190269 (tr|A0A267GS86|A0A267GS86_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031935g1 PE=4 SV=1)

HSP 1 Score: 541.576 bits (1394), Expect = 0.000e+0
Identity = 269/316 (85.13%), Postives = 294/316 (93.04%), Query Frame = 3
Query:  342 VDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN 1289
            VDMKS QLLGN YKEK+QPD+EEL   MEDNEG +EKE   LGKLQYSLDYDFQKGEL+VGVIQA+DLPAMDM GTSDPYVK+Y++P+KKKKFETKVHRK LNPVFNETF+FKVP+ +V SKTL+F VYDFDRFSKHDQIG IK+PLGAIDL R+IEEWK+++ PE++ +K NRLGDICFSLRYVPT+GKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV+LIVTVVDYDRIGTSEPIGRIVLGC ATGAELRHWSDMLANPRRPIAQWHTLQEMPE +
Sbjct:  116 VDMKSVQLLGNEYKEKVQPDMEELVETMEDNEGAQEKEVEKLGKLQYSLDYDFQKGELSVGVIQASDLPAMDMGGTSDPYVKVYIMPEKKKKFETKVHRKTLNPVFNETFIFKVPYADVPSKTLVFAVYDFDRFSKHDQIGLIKLPLGAIDLARLIEEWKDIDPPESEDDKSNRLGDICFSLRYVPTAGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRIKKKKTTIKKCTLNPYYNESFSFEVPFEQIQKVSLIVTVVDYDRIGTSEPIGRIVLGCTATGAELRHWSDMLANPRRPIAQWHTLQEMPEKS 431          
BLAST of Synaptotagmin vs. TrEMBL
Match: gnl|BL_ORD_ID|18341618 (tr|A0A267E6V1|A0A267E6V1_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031935g2 PE=4 SV=1)

HSP 1 Score: 541.191 bits (1393), Expect = 0.000e+0
Identity = 270/316 (85.44%), Postives = 294/316 (93.04%), Query Frame = 3
Query:  342 VDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN 1289
            VDMKS QLLGN YKEK+QPD+EEL   MEDNEG +EKE   LGKLQYSLDYDFQKGEL+VGVIQA+DLPAMDM GTSDPYVK+Y+LP+KKKKFETKVHRK LNPVFNETF+FKVP+ +V SKTL+F VYDFDRFSKHDQIG IK+PLGAIDL R+IEEWK+++ PE++ +K NRLGDICFSLRYVPT+GKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV+LIVTVVDYDRIGTSEPIGRIVLGC ATGAELRHWSDMLANPRRPIAQWHTLQEMPE +
Sbjct:  116 VDMKSVQLLGNEYKEKVQPDMEELVETMEDNEGNQEKEVEKLGKLQYSLDYDFQKGELSVGVIQASDLPAMDMGGTSDPYVKVYILPEKKKKFETKVHRKTLNPVFNETFIFKVPYADVPSKTLVFAVYDFDRFSKHDQIGLIKLPLGAIDLARLIEEWKDIDPPESEDDKSNRLGDICFSLRYVPTAGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRIKKKKTTIKKCTLNPYYNESFSFEVPFEQIQKVSLIVTVVDYDRIGTSEPIGRIVLGCTATGAELRHWSDMLANPRRPIAQWHTLQEMPEKS 431          
BLAST of Synaptotagmin vs. TrEMBL
Match: gnl|BL_ORD_ID|15737168 (tr|R7U5Y9|R7U5Y9_CAPTE Synaptotagmin 1 variant OS=Capitella teleta OX=283909 GN=Syt1 PE=4 SV=1)

HSP 1 Score: 528.094 bits (1359), Expect = 0.000e+0
Identity = 261/316 (82.59%), Postives = 290/316 (91.77%), Query Frame = 3
Query:  339 VVDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKE-KEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPE 1283
             VD+ S ++LGNSYKEK+QPDLEEL+ NMEDNE  +  K +V LGKLQ+SLDYDFQKGEL VGVIQ  DLP MDMSGTSDPYVK+YLLP+KKKK ETKVHRK LNPVFNETF FKVP+ E+ SKTL+F VYDFDRFSKHDQIGQ+KVPL ++DLGRV+EEW++L SPE+D EKEN+LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVKLSLMLNGKR+KKKKTTIKK TLNPYYNESF+FEVPFEQIQKV +I+TVVDYDRIGTSEPIGR+VLGCN+TG ELRHWSDMLANPRRPIAQWHTLQEMPE
Sbjct:  121 AVDLGSVKILGNSYKEKVQPDLEELEVNMEDNEDAESTKSEVKLGKLQFSLDYDFQKGELAVGVIQGADLPGMDMSGTSDPYVKVYLLPEKKKKHETKVHRKTLNPVFNETFNFKVPYAEMGSKTLVFAVYDFDRFSKHDQIGQVKVPLNSVDLGRVVEEWRDLTSPESDSEKENKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRIKKKKTTIKKCTLNPYYNESFTFEVPFEQIQKVTMIITVVDYDRIGTSEPIGRVVLGCNSTGTELRHWSDMLANPRRPIAQWHTLQEMPE 436          
BLAST of Synaptotagmin vs. Ensembl Cavefish
Match: syt1a (synaptotagmin 1 [Source:NCBI gene;Acc:103044539])

HSP 1 Score: 406.757 bits (1044), Expect = 4.113e-137
Identity = 203/292 (69.52%), Postives = 242/292 (82.88%), Query Frame = 3
Query:  399 DLEELDANMEDNEGVKE-KEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            D +E++  + +NE   E KE   LGKLQYSLDY+F +  L VG+IQA +LPAMDM GTSDPYVK+YLLPDKKKKFETKVHRK LNP FNE F FKVP+ E+  KTL+  VYDFDRFSKHD IG +KVP+  +D   V EEW++L+S E   E++ +LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPY K+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV +++TV+DYD+IG ++ IG++ +G N++G ELRHWSDMLANPRRPIAQWH L+
Sbjct:  116 DEDEVETGLTENEKEAEPKEQEKLGKLQYSLDYNFTENTLIVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPTFNEQFTFKVPYTELGGKTLVMTVYDFDRFSKHDAIGDVKVPMNKVDFSHVTEEWRDLQSAEK--EEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYAKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQIVITVLDYDKIGKNDAIGKVFVGLNSSGTELRHWSDMLANPRRPIAQWHVLK 405          
BLAST of Synaptotagmin vs. Ensembl Cavefish
Match: syt1a (synaptotagmin 1 [Source:NCBI gene;Acc:103044539])

HSP 1 Score: 406.371 bits (1043), Expect = 4.375e-137
Identity = 203/292 (69.52%), Postives = 242/292 (82.88%), Query Frame = 3
Query:  399 DLEELDANMEDNEGVKE-KEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            D +E++  + +NE   E KE   LGKLQYSLDY+F +  L VG+IQA +LPAMDM GTSDPYVK+YLLPDKKKKFETKVHRK LNP FNE F FKVP+ E+  KTL+  VYDFDRFSKHD IG +KVP+  +D   V EEW++L+S E   E++ +LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPY K+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV +++TV+DYD+IG ++ IG++ +G N++G ELRHWSDMLANPRRPIAQWH L+
Sbjct:  113 DEDEVETGLTENEKEAEPKEQEKLGKLQYSLDYNFTENTLIVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPTFNEQFTFKVPYTELGGKTLVMTVYDFDRFSKHDAIGDVKVPMNKVDFSHVTEEWRDLQSAEK--EEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYAKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQIVITVLDYDKIGKNDAIGKVFVGLNSSGTELRHWSDMLANPRRPIAQWHVLK 402          
BLAST of Synaptotagmin vs. Ensembl Cavefish
Match: syt1b (synaptotagmin Ib [Source:ZFIN;Acc:ZDB-GENE-060503-166])

HSP 1 Score: 389.037 bits (998), Expect = 3.101e-130
Identity = 193/274 (70.44%), Postives = 230/274 (83.94%), Query Frame = 3
Query:  450 KEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            KE+  LGKLQ+SLDY F  G L VG+IQA DL AMDMSGTSDPYVKLYLLPDKKKKFETKVHRK LNP FNE F FKVP++E+  KTL+  VYDFDRFSKHD IG ++V +  +D  +V EEW+ L+  E   E++ +LGDIC SLRYVPT+GKLT+V+LEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK+TLNPYYNESFSFEVP EQIQKV ++VTV+DYD+IG ++ IG++ +G +++G E RHW+DMLANPRRPIAQWH L+
Sbjct:  133 KEEQKLGKLQFSLDYHFTDGSLIVGIIQAEDLAAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKTLNPTFNEHFTFKVPYSELGGKTLVMTVYDFDRFSKHDAIGDVRVQMNKVDFSQVTEEWRVLQKAEK--EEQEKLGDICLSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKHTLNPYYNESFSFEVPSEQIQKVQVVVTVLDYDKIGKNDAIGKVFMGLHSSGTEQRHWADMLANPRRPIAQWHALK 404          
BLAST of Synaptotagmin vs. Ensembl Cavefish
Match: syt1b (synaptotagmin Ib [Source:ZFIN;Acc:ZDB-GENE-060503-166])

HSP 1 Score: 389.037 bits (998), Expect = 3.317e-130
Identity = 193/274 (70.44%), Postives = 230/274 (83.94%), Query Frame = 3
Query:  450 KEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            KE+  LGKLQ+SLDY F  G L VG+IQA DL AMDMSGTSDPYVKLYLLPDKKKKFETKVHRK LNP FNE F FKVP++E+  KTL+  VYDFDRFSKHD IG ++V +  +D  +V EEW+ L+  E   E++ +LGDIC SLRYVPT+GKLT+V+LEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK+TLNPYYNESFSFEVP EQIQKV ++VTV+DYD+IG ++ IG++ +G +++G E RHW+DMLANPRRPIAQWH L+
Sbjct:  136 KEEQKLGKLQFSLDYHFTDGSLIVGIIQAEDLAAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKTLNPTFNEHFTFKVPYSELGGKTLVMTVYDFDRFSKHDAIGDVRVQMNKVDFSQVTEEWRVLQKAEK--EEQEKLGDICLSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKHTLNPYYNESFSFEVPSEQIQKVQVVVTVLDYDKIGKNDAIGKVFMGLHSSGTEQRHWADMLANPRRPIAQWHALK 407          
BLAST of Synaptotagmin vs. Ensembl Cavefish
Match: syt5b (synaptotagmin-1-like [Source:NCBI gene;Acc:103029888])

HSP 1 Score: 380.178 bits (975), Expect = 2.267e-126
Identity = 186/274 (67.88%), Postives = 233/274 (85.04%), Query Frame = 3
Query:  462 HLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPE 1283
            HLGKL++SLDY+F + +L VG++QA DL AMD+ GTSDPYVK++LLPDKKKKFETKV RK L PVFNETF+FK+P+ E+  K L+  VYDFDRF KHD IGQIK+P+  +DLG+ + +W++LES E   E++ +LGD+C SLRYVPT+GKLT+ I+EAKNLKKMDVGGLSDP+VK+ L  NGKR+KKKKTT+KK TLNPY+NESFSFE+PFEQIQKV L++TV DYD++G+++PIG+I +G  ATG  LRHWSDMLANPRRP+AQWHTL  +PE
Sbjct:  162 HLGKLEFSLDYNFTEAQLIVGILQAQDLAAMDIGGTSDPYVKVFLLPDKKKKFETKVQRKNLCPVFNETFIFKIPYAELGGKILVLLVYDFDRFGKHDVIGQIKIPMNCVDLGQPLHQWRDLESAEK--EEQEKLGDVCISLRYVPTAGKLTVNIMEAKNLKKMDVGGLSDPFVKIVLQHNGKRLKKKKTTVKKNTLNPYFNESFSFEIPFEQIQKVQLLITVYDYDKLGSNDPIGKIFIGYGATGVGLRHWSDMLANPRRPVAQWHTL--LPE 431          
BLAST of Synaptotagmin vs. Ensembl Sea Lamprey
Match: syt2a (synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503-315])

HSP 1 Score: 203.371 bits (516), Expect = 3.859e-62
Identity = 99/157 (63.06%), Postives = 126/157 (80.25%), Query Frame = 3
Query:  399 DLEELDANMEDNE-GVKEKEDVH-------LGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPEND 845
            D++++D + ED E G+ E ++         LGKLQ+S+DYDFQ  +LTVGVIQA +LPA+DM GTSDPYVKL+L+PDKKKK+ETKVHRK LNPVFNE+FVFKVP++E+  KTL+  VYDFDRFSKHD IG++KVP+  IDLG VIEEW++L S E +
Sbjct:   50 DVKDMDNDKEDLETGLTEGDEKEEEKEEEKLGKLQFSIDYDFQNNQLTVGVIQAAELPALDMGGTSDPYVKLFLMPDKKKKYETKVHRKTLNPVFNESFVFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEVKVPMNTIDLGHVIEEWRDLVSAEKE 206          

HSP 2 Score: 77.0258 bits (188), Expect = 2.025e-16
Identity = 46/125 (36.80%), Postives = 76/125 (60.80%), Query Frame = 3
Query:  864 LGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNAT--GAELRHWSDMLA 1232
            LG + FS+ Y   + +LT+ +++A  L  +D+GG SDPYVKL LM +  + KK +T + + TLNP +NESF F+VP+ ++    L++ V D+DR    + IG + +  N    G  +  W D+++
Sbjct:   80 LGKLQFSIDYDFQNNQLTVGVIQAAELPALDMGGTSDPYVKLFLMPD--KKKKYETKVHRKTLNPVFNESFVFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEVKVPMNTIDLGHVIEEWRDLVS 202          
BLAST of Synaptotagmin vs. Ensembl Sea Lamprey
Match: syt2a (synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503-315])

HSP 1 Score: 204.142 bits (518), Expect = 4.034e-62
Identity = 103/169 (60.95%), Postives = 134/169 (79.29%), Query Frame = 3
Query:  342 VDMKSAQLLGNSYKEKIQPDLEELDANM-EDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPEND 845
            ++MK  + + N  K +   + E+L+  + E +E  +EKE+  LGKLQ+S+DYDFQ  +LTVGVIQA +LPA+DM GTSDPYVKL+L+PDKKKK+ETKVHRK LNPVFNE+FVFKVP++E+  KTL+  VYDFDRFSKHD IG++KVP+  IDLG VIEEW++L S E +
Sbjct:   56 INMKDVKDMDNDKKNQAHSE-EDLETGLTEGDEKEEEKEEEKLGKLQFSIDYDFQNNQLTVGVIQAAELPALDMGGTSDPYVKLFLMPDKKKKYETKVHRKTLNPVFNESFVFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEVKVPMNTIDLGHVIEEWRDLVSAEKE 223          

HSP 2 Score: 79.337 bits (194), Expect = 5.767e-17
Identity = 47/137 (34.31%), Postives = 81/137 (59.12%), Query Frame = 3
Query:  864 LGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNAT--GAELRHWSDMLANPRRPIAQWHTL 1268
            LG + FS+ Y   + +LT+ +++A  L  +D+GG SDPYVKL LM +  + KK +T + + TLNP +NESF F+VP+ ++    L++ V D+DR    + IG + +  N    G  +  W D+++  +  +++   L
Sbjct:   97 LGKLQFSIDYDFQNNQLTVGVIQAAELPALDMGGTSDPYVKLFLMPD--KKKKYETKVHRKTLNPVFNESFVFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEVKVPMNTIDLGHVIEEWRDLVSAEKEEVSRARRL 231          
BLAST of Synaptotagmin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006908.1 (pep scaffold:Pmarinus_7.0:GL476344:649897:653668:1 gene:ENSPMAG00000006246.1 transcript:ENSPMAT00000006908.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 187.578 bits (475), Expect = 4.862e-57
Identity = 91/139 (65.47%), Postives = 116/139 (83.45%), Query Frame = 3
Query:  852 KENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTL 1268
            +++RLGDICFSLRY+P++GKLTIVILEA NLK MDV G SDPYVK+ +M  G R+KKKKTT+KK  LNPY+NE+FSF++PFE I+K+ L+ +V+DYD +  ++ IG++ +GC A GA  RHWSDMLANPRRPI QWHTL
Sbjct:    6 QQDRLGDICFSLRYIPSTGKLTIVILEATNLKVMDVSGASDPYVKIQVMEGGIRLKKKKTTVKKKALNPYFNEAFSFDIPFENIEKIQLVFSVMDYDSLSRNDAIGKVYVGCGAAGAGHRHWSDMLANPRRPITQWHTL 144          

HSP 2 Score: 88.1965 bits (217), Expect = 6.587e-21
Identity = 50/123 (40.65%), Postives = 76/123 (61.79%), Query Frame = 3
Query:  465 LGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPD--KKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKEL 827
            LG + +SL Y    G+LT+ +++AT+L  MD+SG SDPYVK+ ++    + KK +T V +K LNP FNE F F +PF  +    L+F+V D+D  S++D IG++ V  GA   G     W ++
Sbjct:   10 LGDICFSLRYIPSTGKLTIVILEATNLKVMDVSGASDPYVKIQVMEGGIRLKKKKTTVKKKALNPYFNEAFSFDIPFENIEKIQLVFSVMDYDSLSRNDAIGKVYVGCGAAGAGH--RHWSDM 130          
BLAST of Synaptotagmin vs. Ensembl Sea Lamprey
Match: SYT5 (synaptotagmin 5 [Source:HGNC Symbol;Acc:HGNC:11513])

HSP 1 Score: 185.267 bits (469), Expect = 2.441e-55
Identity = 84/160 (52.50%), Postives = 115/160 (71.88%), Query Frame = 3
Query:  378 YKEKIQPDLEELDANMEDNEGVKEKEDVH----LGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPEND 845
            +K K+QPDLE++D            ED++    LG+LQ+SLDY+ +  + TVG++QATDL AMD+ G SDPYV++YLLP KKKKFET VHRK LNP+F E F F VPF E+  + L+  VYDFDRFS+HD IG++++PL ++DL   +EEW++L+  E D
Sbjct:   54 FKNKVQPDLEDIDPGF--------IEDIYKENTLGRLQFSLDYNLKTSQFTVGILQATDLAAMDIGGMSDPYVRVYLLPHKKKKFETSVHRKTLNPIFEEKFTFTVPFEELVERVLVMVVYDFDRFSRHDIIGELRIPLSSVDLSHSVEEWRDLQKTEKD 205          

HSP 2 Score: 83.9593 bits (206), Expect = 7.549e-19
Identity = 51/130 (39.23%), Postives = 79/130 (60.77%), Query Frame = 3
Query:  843 DGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIG--RIVLGCNATGAELRHWSDM 1226
            D  KEN LG + FSL Y   + + T+ IL+A +L  MD+GG+SDPYV++ L+ +  + KK +T++ + TLNP + E F+F VPFE++ +  L++ V D+DR    + IG  RI L        +  W D+
Sbjct:   72 DIYKENTLGRLQFSLDYNLKTSQFTVGILQATDLAAMDIGGMSDPYVRVYLLPH--KKKKFETSVHRKTLNPIFEEKFTFTVPFEELVERVLVMVVYDFDRFSRHDIIGELRIPLSSVDLSHSVEEWRDL 199          
BLAST of Synaptotagmin vs. Ensembl Sea Lamprey
Match: SYT6 (synaptotagmin 6 [Source:HGNC Symbol;Acc:HGNC:18638])

HSP 1 Score: 147.902 bits (372), Expect = 5.048e-41
Identity = 69/123 (56.10%), Postives = 91/123 (73.98%), Query Frame = 3
Query:  468 GKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVP--LGAIDLGRVIEEWKELE 830
            GKL ++L YD++  +L V V +A +LPA D SGTSDPYVK+YLLPD+K+K++TKVHRK LNPVF ETF F VP+ E+ ++ L F+VYDFDRFS+HD IGQ+ V       DL R    W+++E
Sbjct:  114 GKLNFALHYDYEMEQLLVRVCRAAELPAKDFSGTSDPYVKIYLLPDRKRKYQTKVHRKTLNPVFEETFQFFVPYAELPARRLHFSVYDFDRFSRHDTIGQVVVDNLFEESDLSRETSLWRDIE 236          

HSP 2 Score: 59.3066 bits (142), Expect = 3.611e-10
Identity = 43/142 (30.28%), Postives = 71/142 (50.00%), Query Frame = 3
Query:  789 IDLGRVIEEWKELESPEND-----------GEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVL 1181
            +D+GR+  E  +  S E D            +     G + F+L Y     +L + +  A  L   D  G SDPYVK+ L+ +  R +K +T + + TLNP + E+F F VP+ ++    L  +V D+DR    + IG++V+
Sbjct:   77 LDIGRIKPELYKQRSVEGDDADGGCGTTAANDGRTLAGKLNFALHYDYEMEQLLVRVCRAAELPAKDFSGTSDPYVKIYLLPD--RKRKYQTKVHRKTLNPVFEETFQFFVPYAELPARRLHFSVYDFDRFSRHDTIGQVVV 216          
BLAST of Synaptotagmin vs. Ensembl Yeast
Match: TCB3 (Cortical ER protein involved in ER-plasma membrane tethering; one of 6 proteins (Ist2p, Scs2p, Scs22p, Tcb1p, Tcb2p, Tcb3p) that connect ER to the plasma membrane (PM) and regulate PM phosphatidylinositol-4-phosphate (PI4P) levels by controlling access of Sac1p phosphatase to its substrate PI4P in the PM; localized to the bud via specific mRNA transport; non-tagged protein detected in a phosphorylated state in mitochondria; C-termini of Tcb1p, Tcb2p and Tcb3p interact [Source:SGD;Acc:S000004537])

HSP 1 Score: 62.7734 bits (151), Expect = 1.284e-10
Identity = 32/100 (32.00%), Postives = 60/100 (60.00%), Query Frame = 3
Query:  507 GELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRV 806
            G L + +I    L + D +G SDP+V +++  + KK F++ + +K L+PV+NE    K+P    +   +IFNV D+DR   +D +GQ  + + ++++G+ 
Sbjct: 1134 GYLNIKLISGHGLKSADRNGYSDPFVHIFV--NDKKVFKSNIKKKTLDPVWNEDA--KIPILSRSKNQVIFNVLDWDRAGDNDDLGQASLDVSSLEVGKT 1229          
BLAST of Synaptotagmin vs. Ensembl Yeast
Match: TCB1 (Lipid-binding ER protein involved in ER-plasma membrane tethering; one of 6 proteins (Ist2p, Scs2p, Scs22p, Tcb1p, Tcb2p, Tcb3p) that connect ER to plasma membrane and regulate PI4P levels by controlling access of Sac1p phosphatase to its substrate PI4P in PM; contains 3 calcium and lipid binding domains; non-tagged protein also localizes to mitochondria; C-termini of Tcb1p, Tcb2p and Tcb3p interact; TCB1 has a paralog, TCB2, that arose from the whole genome duplication [Source:SGD;Acc:S000005612])

HSP 1 Score: 61.6178 bits (148), Expect = 2.782e-10
Identity = 41/128 (32.03%), Postives = 67/128 (52.34%), Query Frame = 3
Query:  507 GELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLR 890
            G+LT+    A +L A D++G SDPY+K Y+  ++   ++TKV +K LNP +N+    ++  N   +  L   V D+D  S  D IG  ++PL  + +    E    +E  EN G+    L  + FS +
Sbjct:  992 GDLTIMSRSAENLIASDLNGYSDPYLKYYINNEEDCAYKTKVVKKTLNPKWNDEGTIQI--NNRLNDVLRIKVMDWDSTSADDTIGTAEIPLNKVKVEGTTELDVPVEGLENAGQDGGML-HLAFSFK 1116          
BLAST of Synaptotagmin vs. Ensembl Yeast
Match: TCB2 (ER protein involved in ER-plasma membrane tethering; one of 6 proteins (Ist2p, Scs2p, Scs22p, Tcb1p, Tcb2p, Tcb3p) that connect ER to plasma membrane (PM) and regulate PM phosphatidylinositol-4-phosphate (PI4P) levels by controlling access of Sac1p phosphatase to its substrate PI4P in the PM; contains 3 calcium and lipid binding domains; mRNA is targeted to bud; TCB2 has a paralog, TCB1, that arose from the whole genome duplication [Source:SGD;Acc:S000005031])

HSP 1 Score: 52.373 bits (124), Expect = 2.075e-7
Identity = 34/97 (35.05%), Postives = 53/97 (54.64%), Query Frame = 3
Query:  507 GELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKK-FETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAID 794
            G+L +    A +L  ++ +G SDPYV+ +L        F+T V +K LNP +NE+   +V  N V +  L  NV D++  + +  IG+  VPL  ID
Sbjct:  983 GDLKITAKSAENLIGVNKNGYSDPYVEFFLNEKSTSPFFKTAVQKKTLNPTWNESKTIEVS-NRV-NDYLTINVKDYESTNSNRSIGKAVVPLSTID 1077          
BLAST of Synaptotagmin vs. Ensembl Nematostella
Match: EDO31746 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX17])

HSP 1 Score: 355.91 bits (912), Expect = 1.250e-118
Identity = 178/314 (56.69%), Postives = 242/314 (77.07%), Query Frame = 3
Query:  342 VDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFK-VPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDG---EKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            VD ++ Q+ G SY+EK+QP ++ELD N ED         V +G++ ++LDY F    LTVG+I+A D+PA D SG+SDPYVK+ LLPDKKKK+ETKVHRK LNPVFNE FVFK +P++E+ ++ L+  ++DFDRFS+HD IG+ ++PL  +DL   I EW+ L  P   G     ++ LGDICFSLRYVP+SGKL I I+EAK+LK MD+ G SDPYVK++L+  G+++KKKKTT+KK TLNPYYNE+F+F V FE+I++ +LI++V+DYDR+G SE IG+ V+G  ++GA+LRHW+DMLA+PRR +AQWHTL 
Sbjct:   45 VDFRAVQI-GASYQEKVQPSMDELDYNSEDYHS-DLSSGVKIGRINFTLDYSFTDNTLTVGIIRAEDIPAKDFSGSSDPYVKIMLLPDKKKKYETKVHRKTLNPVFNEQFVFKNIPYSEITNRILLMELFDFDRFSRHDLIGEARLPLIDVDLASNINEWRVLTPPSGSGGAGHSKSDLGDICFSLRYVPSSGKLQITIVEAKSLKSMDLTGYSDPYVKIALVQEGRKIKKKKTTVKKRTLNPYYNETFTFTVAFEKIEQTSLIISVLDYDRVGKSEMIGKCVVGELSSGADLRHWADMLASPRRSVAQWHTLH 356          
BLAST of Synaptotagmin vs. Ensembl Nematostella
Match: EDO43704 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXY7])

HSP 1 Score: 246.128 bits (627), Expect = 2.374e-77
Identity = 134/274 (48.91%), Postives = 191/274 (69.71%), Query Frame = 3
Query:  462 HLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFK-VPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENR--LGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQE 1274
             LGK+ +SL Y      LT+ V++A  LPA D SGTSDP+VK+ LLPDKK K ET+V RK LNPV+NE F F+  P N++  KTL   V D+DRFS++D IG++++PL  IDLG V   + +   P     K++R  LGD+  SL Y PT+ ++ +V+++A  LK MD+ G SDPYVK+ +M   +R+ KKKTTIK+ T +P +NESF F+VP ++I+ +  +  V+DYDRI  +E IG+++LG   TG+ LRHW++M+ NPR+P+AQWH LQ+
Sbjct:    2 QLGKIFFSLTYYSSDSVLTLKVLKAQGLPAKDFSGTSDPFVKIMLLPDKKHKLETRVKRKNLNPVWNEVFTFEGFPHNKLMGKTLYMQVLDYDRFSRNDPIGEVEIPLENIDLGPVTLTFTKDLLPC----KKDRVPLGDLLVSLMYQPTNNRIIVVVMKANKLKAMDLTGSSDPYVKMYIMHKDRRLDKKKTTIKRRTRDPVWNESFIFDVPLDKIRDLTFVFNVMDYDRITQNELIGQVILGYRTTGSSLRHWTEMMNNPRKPVAQWHRLQD 271          

HSP 2 Score: 98.2117 bits (243), Expect = 7.575e-23
Identity = 54/145 (37.24%), Postives = 88/145 (60.69%), Query Frame = 3
Query:  447 EKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKK--KFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKE-LESPENDGEKENRLGD 872
            +K+ V LG L  SL Y      + V V++A  L AMD++G+SDPYVK+Y++   ++  K +T + R+  +PV+NE+F+F VP +++   T +FNV D+DR ++++ IGQ  V LG    G  +  W E + +P     + +RL D
Sbjct:  129 KKDRVPLGDLLVSLMYQPTNNRIIVVVMKANKLKAMDLTGSSDPYVKMYIMHKDRRLDKKKTTIKRRTRDPVWNESFIFDVPLDKIRDLTFVFNVMDYDRITQNELIGQ--VILGYRTTGSSLRHWTEMMNNPRKPVAQWHRLQD 271          
BLAST of Synaptotagmin vs. Ensembl Nematostella
Match: EDO50013 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF18])

HSP 1 Score: 175.252 bits (443), Expect = 2.520e-50
Identity = 109/288 (37.85%), Postives = 177/288 (61.46%), Query Frame = 3
Query:  423 MEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQI----KVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAK-NLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNA-TGAELRHWSDMLANPRRPIAQWHTL 1268
            M D  G   ++ +  GKL++S+ YD     L V V++A +L   + +     YV+++LLPDK +K++T V  K  NPVFNETF F V F+E+  +TL F + D+D +S+H  +G++     V +   +   VI E           E + R G++  SL Y+PTSG+LT V+L+A+ +++ +    LSDP+VK+SLM++G+++KK KT++   TL P YNE+F F++P E++  V+L+V ++  D     + I + V+G ++ T   L HW+ M+ +PR+PIAQWH L
Sbjct:    1 MSDCNGNPFEQSLGCGKLEFSIMYDTTCECLRVRVLKANNLSVPEATT----YVEVFLLPDKIEKYQTNVKYKNSNPVFNETFEFDVAFSELPERTLQFCINDYDGYSRHQALGEVFHSFDVNVNMQEDTVVIYEKDIRRDIFTFRENQVRKGEVLLSLCYLPTSGRLTFVVLKARLSMRLLFRYSLSDPFVKVSLMVSGRQIKKTKTSVMHGTLRPVYNEAFVFDIPVERLSDVSLLVRMLHSDG-KRCQTIAKTVVGPDSQTSIGLHHWNCMMTSPRKPIAQWHPL 283          
BLAST of Synaptotagmin vs. Ensembl Nematostella
Match: EDO41933 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S352])

HSP 1 Score: 166.007 bits (419), Expect = 9.644e-47
Identity = 106/292 (36.30%), Postives = 159/292 (54.45%), Query Frame = 3
Query:  423 MEDNEGVKEKEDVHL----GKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLP--DKKKKFETKVHRKILNPVFNETFVF-KVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEM 1277
            M   +G+ + +  HL    G L+++L Y      L V +  A  L  MD  GTSDPYVKL+LLP   K  K  +    K LNPVFNET  +  +   E++SKTL   V+D D   ++D IG+  + L  ++     + +K    P+      + LG I  +L+Y    G L + ++    L  MD  G SDPYVK  L  + ++  K++T I+K TLNP +NE F +++   ++ K +L VTV DYD   +++ IG ++L  NA G+ L+HW DML  P +   QWHTL+ +
Sbjct:    1 MSLEKGLCQSKTAHLCLGLGLLEFTLRYQKLDSRLDVVLHDAKGLKPMDHGGTSDPYVKLHLLPGASKSNKLRSHTKYKTLNPVFNETLTYYGITEEEISSKTLRLQVFDEDTIGRNDFIGETSINLKLLN-SNPTQTFKRSLIPKALDSPHSPLGRIQLALKYNTQRGMLFVTVMRCSGLASMDANGYSDPYVKCYLKPDPQKKSKRRTNIRKKTLNPEFNEEFVYDIAHHELAKKSLEVTVWDYDVGKSNDFIGGVILNINAEGSALKHWYDMLKGPNQLHTQWHTLENV 291          
BLAST of Synaptotagmin vs. Ensembl Nematostella
Match: EDO47762 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKX9])

HSP 1 Score: 162.155 bits (409), Expect = 2.595e-45
Identity = 102/279 (36.56%), Postives = 160/279 (57.35%), Query Frame = 3
Query:  462 HLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMS-GTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESP-ENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTV------VDYDRIGTSEPIGRIVLG--CNATGAELRHWSDMLANPRRPIAQWHTL 1268
            H+G+L +++ Y      L V +++A +LP+   +  T DP+VK+ LLP  K   +++  RK   P FNETF   +  +E+ S TL F V+D  R S+   IG+   PL  ++   + E W++LE P E    K   LGDI  SL Y PT  +LTI+IL A NL+ +   G +DP+VK++  +  K +K KKT + + T+NP +N++F++ V  + +   +L+V+V      V  D++     IGR++LG    A G E  HW++M+ NPR+ I  WH L
Sbjct:   29 HIGRLWFNIQYSTTGQNLVVTLVKARNLPSRSKTVRTCDPFVKIALLPKDKHVSQSRCKRKTKRPTFNETFYIPIAEDELDSSTLQFTVFDGYRMSQQAIIGEAMYPLIDMESTGIQELWRDLEKPIEVSQAKRKLLGDIHISLSYYPTLDRLTIIILRAANLRTIGHKG-TDPFVKIAFSIGNKVMKTKKTAVHQDTVNPMFNDAFNYTVTEDDLGTSSLLVSVWHSGGGVREDKL-----IGRVLLGGMMYARGKECEHWTEMMTNPRKMIKYWHPL 301          
BLAST of Synaptotagmin vs. Ensembl Medaka
Match: syt1a (synaptotagmin 1 [Source:NCBI gene;Acc:101166921])

HSP 1 Score: 406.757 bits (1044), Expect = 3.764e-137
Identity = 204/292 (69.86%), Postives = 242/292 (82.88%), Query Frame = 3
Query:  399 DLEELDANMEDNEGVKE-KEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            D E+ +  + + E   E KE   LGKLQYSLDY+F +  L VG+IQA +LPAMDM GTSDPYVK+YLLPDKKKKFETKVHRK LNPVFNE F FKVP+ E+  KTL+  VYDFDRFSKHD IG IKVP+  +D   V EEW++L+S E   E++ +LGDICFSLRYVPT+GKLT+V+LEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV +++TV+DYD+IG ++ IG++ +G N++G ELRHWSDMLANPRRPIAQWH L+
Sbjct:  120 DEEDAETGLTETEKEAEPKESEKLGKLQYSLDYNFTENTLMVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYVELGGKTLVMTVYDFDRFSKHDAIGDIKVPMNKVDFSHVTEEWRDLQSAEK--EEQEKLGDICFSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQIVITVLDYDKIGKNDAIGKVFVGLNSSGTELRHWSDMLANPRRPIAQWHVLK 409          
BLAST of Synaptotagmin vs. Ensembl Medaka
Match: syt1a (synaptotagmin 1 [Source:NCBI gene;Acc:101166921])

HSP 1 Score: 406.757 bits (1044), Expect = 3.764e-137
Identity = 204/292 (69.86%), Postives = 242/292 (82.88%), Query Frame = 3
Query:  399 DLEELDANMEDNEGVKE-KEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            D E+ +  + + E   E KE   LGKLQYSLDY+F +  L VG+IQA +LPAMDM GTSDPYVK+YLLPDKKKKFETKVHRK LNPVFNE F FKVP+ E+  KTL+  VYDFDRFSKHD IG IKVP+  +D   V EEW++L+S E   E++ +LGDICFSLRYVPT+GKLT+V+LEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV +++TV+DYD+IG ++ IG++ +G N++G ELRHWSDMLANPRRPIAQWH L+
Sbjct:  120 DEEDAETGLTETEKEAEPKESEKLGKLQYSLDYNFTENTLMVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYVELGGKTLVMTVYDFDRFSKHDAIGDIKVPMNKVDFSHVTEEWRDLQSAEK--EEQEKLGDICFSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQIVITVLDYDKIGKNDAIGKVFVGLNSSGTELRHWSDMLANPRRPIAQWHVLK 409          
BLAST of Synaptotagmin vs. Ensembl Medaka
Match: syt1a (synaptotagmin 1 [Source:NCBI gene;Acc:101166921])

HSP 1 Score: 406.757 bits (1044), Expect = 3.764e-137
Identity = 204/292 (69.86%), Postives = 242/292 (82.88%), Query Frame = 3
Query:  399 DLEELDANMEDNEGVKE-KEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            D E+ +  + + E   E KE   LGKLQYSLDY+F +  L VG+IQA +LPAMDM GTSDPYVK+YLLPDKKKKFETKVHRK LNPVFNE F FKVP+ E+  KTL+  VYDFDRFSKHD IG IKVP+  +D   V EEW++L+S E   E++ +LGDICFSLRYVPT+GKLT+V+LEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV +++TV+DYD+IG ++ IG++ +G N++G ELRHWSDMLANPRRPIAQWH L+
Sbjct:  120 DEEDAETGLTETEKEAEPKESEKLGKLQYSLDYNFTENTLMVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYVELGGKTLVMTVYDFDRFSKHDAIGDIKVPMNKVDFSHVTEEWRDLQSAEK--EEQEKLGDICFSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQIVITVLDYDKIGKNDAIGKVFVGLNSSGTELRHWSDMLANPRRPIAQWHVLK 409          
BLAST of Synaptotagmin vs. Ensembl Medaka
Match: syt1a (synaptotagmin 1 [Source:NCBI gene;Acc:101166921])

HSP 1 Score: 406.757 bits (1044), Expect = 1.684e-135
Identity = 204/292 (69.86%), Postives = 242/292 (82.88%), Query Frame = 3
Query:  399 DLEELDANMEDNEGVKE-KEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            D E+ +  + + E   E KE   LGKLQYSLDY+F +  L VG+IQA +LPAMDM GTSDPYVK+YLLPDKKKKFETKVHRK LNPVFNE F FKVP+ E+  KTL+  VYDFDRFSKHD IG IKVP+  +D   V EEW++L+S E   E++ +LGDICFSLRYVPT+GKLT+V+LEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV +++TV+DYD+IG ++ IG++ +G N++G ELRHWSDMLANPRRPIAQWH L+
Sbjct:  234 DEEDAETGLTETEKEAEPKESEKLGKLQYSLDYNFTENTLMVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYVELGGKTLVMTVYDFDRFSKHDAIGDIKVPMNKVDFSHVTEEWRDLQSAEK--EEQEKLGDICFSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQIVITVLDYDKIGKNDAIGKVFVGLNSSGTELRHWSDMLANPRRPIAQWHVLK 523          
BLAST of Synaptotagmin vs. Ensembl Medaka
Match: syt2a (synaptotagmin-2 [Source:NCBI gene;Acc:101161806])

HSP 1 Score: 387.111 bits (993), Expect = 3.114e-129
Identity = 194/283 (68.55%), Postives = 238/283 (84.10%), Query Frame = 3
Query:  465 LGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN**CSFDAL 1313
            LGKLQYS+DYDFQ+ +LTVG++QA DL +MD  GTSDPYVK+++LPDKKKKF+TKVH+K LNPVFNETF FK+PF E+  KTL+ +VYDFDRFSKHD IG+IK+P+  +DL + IEEW++L+S   D E+  +LGDIC SLRYVPT+GKLTI ILEAKNLKKMDVGGLSDPYVK++L+ NGKR+KKKKTT+KK TLNPYYNESFSFE+P EQ+QK+  ++TV+DYD+IG ++ IG+I +G  +TGA L+HWSDMLANPRRPIAQWH LQ  PE     S  AL
Sbjct:  150 LGKLQYSIDYDFQENKLTVGILQAADLLSMDSGGTSDPYVKVFVLPDKKKKFDTKVHKKTLNPVFNETFTFKIPFQEMGGKTLVMSVYDFDRFSKHDVIGEIKIPMNTLDLAKPIEEWRDLDSA--DQEEPEKLGDICISLRYVPTAGKLTICILEAKNLKKMDVGGLSDPYVKINLLQNGKRLKKKKTTVKKNTLNPYYNESFSFEIPLEQMQKIQAVITVLDYDKIGKNDAIGKIWVGSKSTGAGLKHWSDMLANPRRPIAQWHPLQ--PEEEVDASLAAL 428          
BLAST of Synaptotagmin vs. Planmine SMEST
Match: SMESG000025329.1 (SMESG000025329.1)

HSP 1 Score: 684.485 bits (1765), Expect = 0.000e+0
Identity = 395/395 (100.00%), Postives = 395/395 (100.00%), Query Frame = 3
Query:  105 MKNSTHGSDHSASKASMKTNVEKFWHDLGKKLHMDPKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN 1289
            MKNSTHGSDHSASKASMKTNVEKFWHDLGKKLHMDPKALIGVTIGLGILFLLFLYCLCKKCVFKRRKKKETAKKGAKGVVDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN
Sbjct:    1 MKNSTHGSDHSASKASMKTNVEKFWHDLGKKLHMDPKALIGVTIGLGILFLLFLYCLCKKCVFKRRKKKETAKKGAKGVVDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN 395          
BLAST of Synaptotagmin vs. Planmine SMEST
Match: SMESG000055143.1 (SMESG000055143.1)

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 282/316 (89.24%), Postives = 305/316 (96.52%), Query Frame = 3
Query:  342 VDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN 1289
            VDMKS QLLGN+YKEK+QPDLEELDANMEDNEG ++KE V+LGKLQYSLDYDF KGELTVGV+QATDLPAMDMSGTSDPYVK++LLPDKKKKFETKVHRKILNPVFNETFVFK+P++EV SKTL+FNV+DFDRFSKHDQIGQI++PLG++DL +VIEEWKEL  P++D EKENRLGDICFSLRYVPTSGKL IVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGR+VLGCNATGAELRHWSDMLANPRRPIAQWHTLQ+MPE +
Sbjct:  105 VDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVVQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQDMPEKS 420          
BLAST of Synaptotagmin vs. Planmine SMEST
Match: SMESG000055143.1 (SMESG000055143.1)

HSP 1 Score: 568.54 bits (1464), Expect = 0.000e+0
Identity = 282/316 (89.24%), Postives = 305/316 (96.52%), Query Frame = 3
Query:  342 VDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN 1289
            VDMKS QLLGN+YKEK+QPDLEELDANMEDNEG ++KE V+LGKLQYSLDYDF KGELTVGV+QATDLPAMDMSGTSDPYVK++LLPDKKKKFETKVHRKILNPVFNETFVFK+P++EV SKTL+FNV+DFDRFSKHDQIGQI++PLG++DL +VIEEWKEL  P++D EKENRLGDICFSLRYVPTSGKL IVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGR+VLGCNATGAELRHWSDMLANPRRPIAQWHTLQ+MPE +
Sbjct:   93 VDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVVQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQDMPEKS 408          
BLAST of Synaptotagmin vs. Planmine SMEST
Match: SMESG000055143.1 (SMESG000055143.1)

HSP 1 Score: 567.77 bits (1462), Expect = 0.000e+0
Identity = 282/314 (89.81%), Postives = 304/314 (96.82%), Query Frame = 3
Query:  342 VDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPE 1283
            VDMKS QLLGN+YKEK+QPDLEELDANMEDNEG ++KE V+LGKLQYSLDYDF KGELTVGV+QATDLPAMDMSGTSDPYVK++LLPDKKKKFETKVHRKILNPVFNETFVFK+P++EV SKTL+FNV+DFDRFSKHDQIGQI++PLG++DL +VIEEWKEL  P++D EKENRLGDICFSLRYVPTSGKL IVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGR+VLGCNATGAELRHWSDMLANPRRPIAQWHTLQ+MPE
Sbjct:   89 VDMKSVQLLGNAYKEKVQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVVQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQDMPE 402          
BLAST of Synaptotagmin vs. Planmine SMEST
Match: SMESG000021478.1 (SMESG000021478.1)

HSP 1 Score: 461.07 bits (1185), Expect = 8.638e-159
Identity = 231/311 (74.28%), Postives = 275/311 (88.42%), Query Frame = 3
Query:  351 KSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPE 1283
            K+ +++G +   K Q D E+L  + +D+   KE+E  +LGKL+Y LDYDF KGELTVG++QA +LPA+DM+GTSDPYVK++L PDKKKKFETKVHRK LNPVF+E F+FKVPF E+ SKTL  ++YDFDRFSKHDQIGQ+++PLG+IDL +V++EWKELE  ++  EKEN+LGDICFSLRYVPT+GKLT+V+LEAKNLKKMDVGGLSDPYVK+SLM+NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQ++NLIVTVVDYDRIGTSEPIGR+VLGCNA+G  LR WSDMLANPRRPIAQW TLQEMPE
Sbjct:   90 KNMKIIGGAVDNKTQSDEEDLVLDKDDDNEKKEEEKEYLGKLEYKLDYDFTKGELTVGILQAQELPALDMNGTSDPYVKVFLKPDKKKKFETKVHRKTLNPVFDEVFLFKVPFAEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGKRIKKKKTTIKKCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQEMPE 400          
The following BLAST results are available for this feature:
BLAST of Synaptotagmin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYT11.126e-13968.49synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509... [more]
SYT11.126e-13968.49synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509... [more]
SYT11.126e-13968.49synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509... [more]
SYT14.796e-13975.84synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509... [more]
SYT24.066e-13572.59synaptotagmin 2 [Source:HGNC Symbol;Acc:HGNC:11510... [more]
back to top
BLAST of Synaptotagmin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snt-11.113e-14171.29Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
snt-12.454e-13067.08Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
snt-31.716e-11764.55SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5... [more]
snt-31.716e-11764.55SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5... [more]
snt-26.169e-9352.52Synaptotagmin 2 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
back to top
BLAST of Synaptotagmin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syt11.072e-15570.98gene:FBgn0004242 transcript:FBtr0077726[more]
Syt16.148e-15570.98gene:FBgn0004242 transcript:FBtr0343993[more]
Syt17.713e-15570.66gene:FBgn0004242 transcript:FBtr0332218[more]
Syt11.554e-15270.66gene:FBgn0004242 transcript:FBtr0077728[more]
Syt11.554e-15270.66gene:FBgn0004242 transcript:FBtr0345331[more]
back to top
BLAST of Synaptotagmin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt1a1.280e-13573.23synaptotagmin Ia [Source:ZFIN;Acc:ZDB-GENE-040718-... [more]
syt1a1.280e-13573.23synaptotagmin Ia [Source:ZFIN;Acc:ZDB-GENE-040718-... [more]
syt2a4.286e-12568.40synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
syt2a4.286e-12568.40synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
syt5a6.134e-12467.67synaptotagmin Va [Source:ZFIN;Acc:ZDB-GENE-040718-... [more]
back to top
BLAST of Synaptotagmin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYT52.000e-15070.74synaptotagmin 5 [Source:NCBI gene;Acc:100493612][more]
SYT52.005e-15070.74synaptotagmin 5 [Source:NCBI gene;Acc:100493612][more]
e2f47.564e-14067.95E2F transcription factor 4 [Source:Xenbase;Acc:XB-... [more]
luzp24.693e-13271.32leucine zipper protein 2 [Source:Xenbase;Acc:XB-GE... [more]
syt81.941e-10857.05synaptotagmin 8 [Source:NCBI gene;Acc:100037878][more]
back to top
BLAST of Synaptotagmin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syt14.302e-14068.71synaptotagmin I [Source:MGI Symbol;Acc:MGI:99667][more]
Syt14.302e-14068.71synaptotagmin I [Source:MGI Symbol;Acc:MGI:99667][more]
Syt22.304e-13572.59synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666][more]
Syt22.304e-13572.59synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666][more]
Syt51.154e-12259.81synaptotagmin V [Source:MGI Symbol;Acc:MGI:1926368... [more]
back to top
BLAST of Synaptotagmin vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P41823|SY65_APLCA2.452e-17779.87Synaptotagmin-1 OS=Aplysia californica OX=6500 GN=... [more]
sp|P21521|SY65_DROME1.075e-15470.98Synaptotagmin 1 OS=Drosophila melanogaster OX=7227... [more]
sp|P34693|SYT1_CAEEL1.416e-14071.29Synaptotagmin-1 OS=Caenorhabditis elegans OX=6239 ... [more]
sp|P46096|SYT1_MOUSE3.010e-13968.71Synaptotagmin-1 OS=Mus musculus OX=10090 GN=Syt1 P... [more]
sp|P21707|SYT1_RAT3.391e-13968.71Synaptotagmin-1 OS=Rattus norvegicus OX=10116 GN=S... [more]
back to top
BLAST of Synaptotagmin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|196299420.000e+095.95tr|Q9U8R6|Q9U8R6_DUGJA Djsyt protein OS=Dugesia ja... [more]
gnl|BL_ORD_ID|182450450.000e+085.13tr|A0A267E333|A0A267E333_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|181902690.000e+085.13tr|A0A267GS86|A0A267GS86_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|183416180.000e+085.44tr|A0A267E6V1|A0A267E6V1_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|157371680.000e+082.59tr|R7U5Y9|R7U5Y9_CAPTE Synaptotagmin 1 variant OS=... [more]
back to top
BLAST of Synaptotagmin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt1a4.113e-13769.52synaptotagmin 1 [Source:NCBI gene;Acc:103044539][more]
syt1a4.375e-13769.52synaptotagmin 1 [Source:NCBI gene;Acc:103044539][more]
syt1b3.101e-13070.44synaptotagmin Ib [Source:ZFIN;Acc:ZDB-GENE-060503-... [more]
syt1b3.317e-13070.44synaptotagmin Ib [Source:ZFIN;Acc:ZDB-GENE-060503-... [more]
syt5b2.267e-12667.88synaptotagmin-1-like [Source:NCBI gene;Acc:1030298... [more]
back to top
BLAST of Synaptotagmin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt2a3.859e-6263.06synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
syt2a4.034e-6260.95synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
ENSPMAT00000006908.14.862e-5765.47pep scaffold:Pmarinus_7.0:GL476344:649897:653668:1... [more]
SYT52.441e-5552.50synaptotagmin 5 [Source:HGNC Symbol;Acc:HGNC:11513... [more]
SYT65.048e-4156.10synaptotagmin 6 [Source:HGNC Symbol;Acc:HGNC:18638... [more]
back to top
BLAST of Synaptotagmin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
TCB31.284e-1032.00Cortical ER protein involved in ER-plasma membrane... [more]
TCB12.782e-1032.03Lipid-binding ER protein involved in ER-plasma mem... [more]
TCB22.075e-735.05ER protein involved in ER-plasma membrane tetherin... [more]
back to top
BLAST of Synaptotagmin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO317461.250e-11856.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437042.374e-7748.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO500132.520e-5037.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419339.644e-4736.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477622.595e-4536.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Synaptotagmin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt1a3.764e-13769.86synaptotagmin 1 [Source:NCBI gene;Acc:101166921][more]
syt1a3.764e-13769.86synaptotagmin 1 [Source:NCBI gene;Acc:101166921][more]
syt1a3.764e-13769.86synaptotagmin 1 [Source:NCBI gene;Acc:101166921][more]
syt1a1.684e-13569.86synaptotagmin 1 [Source:NCBI gene;Acc:101166921][more]
syt2a3.114e-12968.55synaptotagmin-2 [Source:NCBI gene;Acc:101161806][more]
back to top
BLAST of Synaptotagmin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025329.10.000e+0100.00SMESG000025329.1[more]
SMESG000055143.10.000e+089.24SMESG000055143.1[more]
SMESG000055143.10.000e+089.24SMESG000055143.1[more]
SMESG000055143.10.000e+089.81SMESG000055143.1[more]
SMESG000021478.18.638e-15974.28SMESG000021478.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022907 ID=SMED30022907|Name=Synaptotagmin|organism=Schmidtea mediterranea sexual|type=transcript|length=1814bp
ATTTATTGAAAATTATTTTTTCTATTATTAGGAGAAAATTGATTATTTTT
TTTTGACAAAATAAGTTTTGGATATATTTCCCATTTGTTTGTATTCGTAA
ACCAATGAAGAATTCGACTCACGGATCGGATCATTCGGCCAGCAAGGCCA
GTATGAAAACGAATGTGGAAAAATTTTGGCATGATCTCGGAAAAAAATTG
CACATGGATCCAAAAGCATTAATAGGAGTAACAATCGGTTTGGGAATATT
GTTTTTGTTGTTCCTTTATTGCTTATGTAAAAAATGTGTTTTCAAGCGTC
GAAAAAAGAAGGAAACGGCCAAAAAAGGAGCCAAGGGAGTAGTCGATATG
AAAAGTGCCCAATTGTTGGGGAATTCATATAAAGAAAAAATTCAACCCGA
TCTTGAAGAACTTGATGCAAACATGGAAGACAATGAAGGTGTAAAAGAAA
AAGAAGATGTTCATTTAGGAAAATTACAATATTCTCTAGATTATGATTTT
CAGAAAGGAGAATTAACTGTTGGAGTTATTCAAGCAACTGATCTTCCAGC
TATGGATATGTCAGGAACATCAGATCCATATGTCAAATTATACCTTCTCC
CAGACAAGAAAAAGAAATTCGAAACAAAGGTTCATAGGAAAATTTTAAAT
CCTGTATTCAATGAAACTTTTGTTTTCAAAGTTCCTTTCAATGAAGTTGC
ATCGAAGACTTTGATTTTCAACGTTTATGACTTTGACAGATTTTCCAAAC
ACGATCAAATCGGTCAAATAAAAGTACCATTGGGAGCTATAGATTTAGGT
CGAGTTATTGAAGAATGGAAGGAACTGGAATCTCCAGAAAACGATGGGGA
AAAGGAAAACAGGTTGGGAGACATTTGTTTCTCTTTAAGATACGTACCGA
CATCTGGAAAGCTTACAATAGTCATTTTGGAAGCAAAGAATCTTAAAAAA
ATGGATGTCGGAGGATTGTCTGATCCATATGTTAAACTTTCCTTGATGCT
TAATGGTAAACGAGTGAAGAAGAAGAAAACTACCATCAAAAAGTATACAC
TAAATCCTTACTACAATGAATCATTTTCCTTTGAAGTACCATTCGAACAA
ATACAAAAAGTGAACTTGATCGTCACGGTTGTTGATTATGACAGAATCGG
AACCAGCGAACCGATAGGTAGAATTGTTCTGGGATGTAACGCAACTGGAG
CAGAATTGCGACATTGGTCGGATATGTTGGCAAATCCCCGGCGACCAATC
GCCCAGTGGCATACCCTCCAAGAGATGCCAGAGAACAATTGATAGTGTTC
GTTTGATGCTTTAAAGCGGTTTGCATAATTCGTGAAATAAGTTATCAAAA
TTTGAGAAATGTTTTTTTTTCTGAAACAAAAATGGCATGAGACAATATAC
CAGAGTTCATTAGTGTGTGGTTTCGTTGAATATTTTGGTGGTGTTGCATC
TTATCGTTTGTCCTCTAATCTAATAATGTTTTATTCTTTATATAGCTGAT
TTATTCTCGAGCGAAACATTTTTTATGTGTACCAAAATACTTATGTCATA
GCCATTGTGATTAGTCTGTAAACTATTGCGTAATAGCCCCTCTCATTGGC
TTTTTTTAAGAGTAGTGAGTTGGAAAAAAAAATACAAAAATGACTTCAAT
TGTTAAACATTACTCATATTTTATCAGTAAGTTAACTTGCATATTTGCAG
TTAATTATGGCATTTTATCTCTAAATCTCTGAAGCATGGCCTCAAGTCTT
TTGTTTGTTTTAATGTAATTATGTCTAGATGAGAATATTAAAATACTTCG
GTTTATATAAAAGA
back to top

protein sequence of SMED30022907-orf-1

>SMED30022907-orf-1 ID=SMED30022907-orf-1|Name=SMED30022907-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=396bp
MKNSTHGSDHSASKASMKTNVEKFWHDLGKKLHMDPKALIGVTIGLGILF
LLFLYCLCKKCVFKRRKKKETAKKGAKGVVDMKSAQLLGNSYKEKIQPDL
EELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAM
DMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVAS
KTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEK
ENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLN
GKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGT
SEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN*
back to top
Aliases
The feature 'Synaptotagmin' has the following synonyms
Synonym
Dj-syt
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000080peripheral nervous system
PLANA:0000418head
PLANA:0000463cholinergic neuron
PLANA:0000464GABAergic neuron
PLANA:0004519embryonic pharynx neuron
PLANA:0000025nervous system
PLANA:0000465pharynx nerve plexus
PLANA:0000099neuron
PLANA:0000044cephalic ganglia
PLANA:0000097ventral nerve cord
PLANA:0000058embryonic digestive system
PLANA:0000023embryonic pharynx
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR015428Synaptotagmin1
IPR000008C2_dom
IPR001565Synaptotagmin
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0000149SNARE binding
GO:0005509calcium ion binding
GO:0005544calcium-dependent phospholipid binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0008021synaptic vesicle
GO:0016021integral component of membrane
GO:0030054cell junction
GO:0030285integral component of synaptic vesicle membrane
GO:0030672synaptic vesicle membrane
GO:0031410cytoplasmic vesicle
GO:0045202synapse
Vocabulary: biological process
TermDefinition
GO:0007269neurotransmitter secretion
GO:0016079synaptic vesicle exocytosis
GO:0045955negative regulation of calcium ion-dependent exocytosis
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000007Stage 7
PLANA:0000004Stage 4
PLANA:0000006Stage 6
PLANA:0000008Stage 8
PLANA:0000003Stage 3
PLANA:0000005Stage 5
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001565SynaptotagminPRINTSPR00399SYNAPTOTAGMNcoord: 139..152
score: 48.53
coord: 214..224
score: 46.79
coord: 124..139
score: 47.61
coord: 194..209
score: 36.58
IPR000008C2 domainPRINTSPR00360C2DOMAINcoord: 179..192
score: 57.48
coord: 152..164
score: 59.66
coord: 203..211
score: 48.45
IPR000008C2 domainSMARTSM00239C2_3ccoord: 136..238
e-value: 6.0E-22
score: 88.9
coord: 269..383
e-value: 1.3E-23
score: 94.5
IPR000008C2 domainPFAMPF00168C2coord: 268..372
e-value: 4.2E-23
score: 81.6
coord: 135..241
e-value: 3.9E-30
score: 104.2
IPR000008C2 domainPROSITEPS50004C2coord: 267..358
score: 20.698
IPR000008C2 domainPROSITEPS50004C2coord: 136..223
score: 20.298
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 248..394
e-value: 1.7E-54
score: 185.7
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 107..247
e-value: 1.3E-48
score: 166.5
NoneNo IPR availablePANTHERPTHR10024SYNAPTOTAGMINcoord: 3..391
NoneNo IPR availableCDDcd08385C2A_Synaptotagmin-1-5-6-9-10coord: 121..243
e-value: 7.502E-86
score: 254.497
NoneNo IPR availableCDDcd08402C2B_Synaptotagmin-1coord: 254..389
e-value: 2.11899E-91
score: 269.271
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 115..246
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 254..389
NoneNo IPR availableTMHMMTMhelixcoord: 38..57
IPR015428Synaptotagmin 1PANTHERPTHR10024:SF239SYNAPTOTAGMIN-1coord: 3..391