Synaptotagmin-1

Overview
NameSynaptotagmin-1
Smed IDSMED30022907
Uniprot Best hitSynaptotagmin-1 OS=Aplysia californica GN=SYT1 PE=1 SV=2 (E=1.65217e-175)
Length (bp)1814
Neoblast Clusters

Zeng et. al., 2018


▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Synaptotagmin-1 (SMED30022907) t-SNE clustered cells

Violin plots show distribution of expression levels for Synaptotagmin-1 (SMED30022907) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Synaptotagmin-1 (SMED30022907) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Synaptotagmin-1 (SMED30022907) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Homology
BLAST of Synaptotagmin-1 vs. Ensembl Human
Match: SYT1 (synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509])

HSP 1 Score: 414.075 bits (1063), Expect = 5.051e-138
Identity = 213/311 (68.49%), Postives = 256/311 (82.32%), Query Frame = 3
Query:  339 VVDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
             ++MK  + LG + K++   D +      +  E  + KE+  LGKLQYSLDYDFQ  +L VG+IQA +LPA+DM GTSDPYVK++LLPDKKKKFETKVHRK LNPVFNE F FKVP++E+  KTL+  VYDFDRFSKHD IG+ KVP+  +D G V EEW++L+S E   E++ +LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV ++VTV+DYD+IG ++ IG++ +G N+TGAELRHWSDMLANPRRPIAQWHTLQ
Sbjct:  101 AINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK--EEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQ 409          
BLAST of Synaptotagmin-1 vs. Ensembl Human
Match: SYT1 (synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509])

HSP 1 Score: 414.075 bits (1063), Expect = 5.051e-138
Identity = 213/311 (68.49%), Postives = 256/311 (82.32%), Query Frame = 3
Query:  339 VVDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
             ++MK  + LG + K++   D +      +  E  + KE+  LGKLQYSLDYDFQ  +L VG+IQA +LPA+DM GTSDPYVK++LLPDKKKKFETKVHRK LNPVFNE F FKVP++E+  KTL+  VYDFDRFSKHD IG+ KVP+  +D G V EEW++L+S E   E++ +LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV ++VTV+DYD+IG ++ IG++ +G N+TGAELRHWSDMLANPRRPIAQWHTLQ
Sbjct:  101 AINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK--EEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQ 409          
BLAST of Synaptotagmin-1 vs. Ensembl Human
Match: SYT1 (synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509])

HSP 1 Score: 414.075 bits (1063), Expect = 5.051e-138
Identity = 213/311 (68.49%), Postives = 256/311 (82.32%), Query Frame = 3
Query:  339 VVDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
             ++MK  + LG + K++   D +      +  E  + KE+  LGKLQYSLDYDFQ  +L VG+IQA +LPA+DM GTSDPYVK++LLPDKKKKFETKVHRK LNPVFNE F FKVP++E+  KTL+  VYDFDRFSKHD IG+ KVP+  +D G V EEW++L+S E   E++ +LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV ++VTV+DYD+IG ++ IG++ +G N+TGAELRHWSDMLANPRRPIAQWHTLQ
Sbjct:  101 AINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK--EEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQ 409          
BLAST of Synaptotagmin-1 vs. Ensembl Human
Match: SYT1 (synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509])

HSP 1 Score: 412.149 bits (1058), Expect = 2.139e-137
Identity = 204/269 (75.84%), Postives = 237/269 (88.10%), Query Frame = 3
Query:  465 LGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            LGKLQYSLDYDFQ  +L VG+IQA +LPA+DM GTSDPYVK++LLPDKKKKFETKVHRK LNPVFNE F FKVP++E+  KTL+  VYDFDRFSKHD IG+ KVP+  +D G V EEW++L+S E   E++ +LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV ++VTV+DYD+IG ++ IG++ +G N+TGAELRHWSDMLANPRRPIAQWHTLQ
Sbjct:  140 LGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK--EEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQ 406          
BLAST of Synaptotagmin-1 vs. Ensembl Human
Match: SYT2 (synaptotagmin 2 [Source:HGNC Symbol;Acc:HGNC:11510])

HSP 1 Score: 402.134 bits (1032), Expect = 1.739e-133
Identity = 196/270 (72.59%), Postives = 236/270 (87.41%), Query Frame = 3
Query:  462 HLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            +LGKLQ+SLDYDFQ  +LTVGV+QA +LPA+DM GTSDPYVK++LLPDKKKK+ETKVHRK LNP FNETF FKVP+ E+  KTL+  +YDFDRFSKHD IG++KVP+  +DLG+ IEEW++L+  E   E+  +LGDIC SLRYVPT+GKLT+ ILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTT+KK TLNPY+NESFSFE+PFEQIQKV ++VTV+DYD++G +E IG+I +G NATG ELRHWSDMLANPRRPIAQWH+L+
Sbjct:  139 NLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEK--EEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLK 406          

HSP 2 Score: 84.7297 bits (208), Expect = 6.511e-17
Identity = 50/135 (37.04%), Postives = 84/135 (62.22%), Query Frame = 3
Query:  429 DNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKK--KFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKEL 827
            D +G +++E   LG +  SL Y    G+LTV +++A +L  MD+ G SDPYVK++L+ + K+  K +T V +K LNP FNE+F F++PF ++    ++  V D+D+  K++ IG+I V  G+   G  +  W ++
Sbjct:  259 DLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFV--GSNATGTELRHWSDM 391          
BLAST of Synaptotagmin-1 vs. Ensembl Celegans
Match: snt-1 (Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:P34693])

HSP 1 Score: 418.698 bits (1075), Expect = 5.018e-140
Identity = 226/317 (71.29%), Postives = 262/317 (82.65%), Query Frame = 3
Query:  339 VVDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVH--LGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPE 1283
            VVD K+ Q +          DLEEL   ME NE  + +E     LG++QY LDYDFQ+G+LTV VIQA DLP MDMSGTSDPYVKLYLLP+KKKK ETKVHRK LNPVFNETF+FKV FNE+ +KTL+F +YDFDRFSKHDQIGQ+ +PLG IDLG VIEEWK++  P +D E E  LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+ LM  GKR+KKKKT+IKK TLNPYYNESFSFEVPFEQIQKV+L++TV+DYD++G+++ IGR +LGCN TGAELRHW DMLA+PRRPIAQWHTL  + E
Sbjct:  124 VVDGKNIQGMAQ--------DLEELGDAMEQNEKEQAEEKEEVKLGRIQYKLDYDFQQGQLTVTVIQAEDLPGMDMSGTSDPYVKLYLLPEKKKKVETKVHRKTLNPVFNETFIFKVAFNEITAKTLVFAIYDFDRFSKHDQIGQVLIPLGKIDLGAVIEEWKDIAPPPDDKEAEKSLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIVLMQGGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKVSLMITVMDYDKLGSNDAIGRCLLGCNGTGAELRHWMDMLASPRRPIAQWHTLGPVEE 432          
BLAST of Synaptotagmin-1 vs. Ensembl Celegans
Match: snt-1 (Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:P34693])

HSP 1 Score: 389.808 bits (1000), Expect = 9.753e-129
Identity = 214/319 (67.08%), Postives = 257/319 (80.56%), Query Frame = 3
Query:  339 VVDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVH--LGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLM-LNGXXXXXXXXXXXXXXLNPYYNESFSFE-VPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPE 1283
            VVD K+ Q +          DLEEL   ME NE  + +E     LG++QY LDYDFQ+G+LTV VIQA DLP MDMSGTSDPYVKLYLLP+KKKK ETKVHRK LNPVFNETF+FKV FNE+ +KTL+F +YDFDRFSKHDQIGQ+ +PLG IDLG VIEEWK++  P +D E E  LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVKL +   + KR+KKKKT IK+ TLNPY+NESF F+ +P  +++KV+L++TV+DYD++G+++ IGR +LGCN TGAELRHW DMLA+PRRPIAQWHTL  + E
Sbjct:  124 VVDGKNIQGMAQ--------DLEELGDAMEQNEKEQAEEKEEVKLGRIQYKLDYDFQQGQLTVTVIQAEDLPGMDMSGTSDPYVKLYLLPEKKKKVETKVHRKTLNPVFNETFIFKVAFNEITAKTLVFAIYDFDRFSKHDQIGQVLIPLGKIDLGAVIEEWKDIAPPPDDKEAEKSLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKLEMFGEDRKRLKKKKTNIKRKTLNPYFNESFVFDKLPLHKMKKVSLMITVMDYDKLGSNDAIGRCLLGCNGTGAELRHWMDMLASPRRPIAQWHTLGPVEE 434          
BLAST of Synaptotagmin-1 vs. Ensembl Celegans
Match: snt-3 (SyNapTotagmin [Source:RefSeq peptide;Acc:NP_503406])

HSP 1 Score: 350.903 bits (899), Expect = 6.326e-116
Identity = 173/268 (64.55%), Postives = 215/268 (80.22%), Query Frame = 3
Query:  465 LGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTL 1268
            LG+LQY LDYDF K  LTV +IQA +LPAMD+ GTSDPYVKL+LLPDKKKK +TKV RK LNPVFNE+F FK+PFNE+  +TL+ NV+DFDRF KHDQIGQI +PLG +DL   +E    +ESP      ENRLG++C +LRYVP   KL++V++E KNLKKMDV GLSDPYVK+ LM+  KR++KKKTTIK  TLNPYYNESFSF+V  E++Q+V+L VTV DYDR+G++E IG++++G  ATG  L+ W+DMLA PRR +AQWHTL
Sbjct:   16 LGRLQYKLDYDFDKNSLTVVIIQAEELPAMDLGGTSDPYVKLFLLPDKKKKLQTKVQRKSLNPVFNESFTFKIPFNEIGGQTLVLNVFDFDRFGKHDQIGQISIPLGKVDLAATLERTDLIESPP-----ENRLGEVCLALRYVPNKNKLSVVVMECKNLKKMDVLGLSDPYVKIYLMMGTKRLEKKKTTIKMKTLNPYYNESFSFDVTSEKMQRVHLHVTVSDYDRVGSNERIGQVIIGTCATGVALKQWNDMLATPRRSVAQWHTL 278          

HSP 2 Score: 73.1738 bits (178), Expect = 4.310e-14
Identity = 46/142 (32.39%), Postives = 81/142 (57.04%), Query Frame = 3
Query:  408 ELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKK--KFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKEL 827
            +L A +E  + ++   +  LG++  +L Y   K +L+V V++  +L  MD+ G SDPYVK+YL+   K+  K +T +  K LNP +NE+F F V   ++    L   V D+DR   +++IGQ+ +  G    G  +++W ++
Sbjct:  125 DLAATLERTDLIESPPENRLGEVCLALRYVPNKNKLSVVVMECKNLKKMDVLGLSDPYVKIYLMMGTKRLEKKKTTIKMKTLNPYYNESFSFDVTSEKMQRVHLHVTVSDYDRVGSNERIGQVII--GTCATGVALKQWNDM 264          
BLAST of Synaptotagmin-1 vs. Ensembl Celegans
Match: snt-2 (SyNapTotagmin [Source:RefSeq peptide;Acc:NP_497261])

HSP 1 Score: 290.812 bits (743), Expect = 1.479e-91
Identity = 146/278 (52.52%), Postives = 200/278 (71.94%), Query Frame = 3
Query:  468 GKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGC------NATGAELRHWSDMLANPRRPIAQWHTLQEMPE 1283
            G + + ++YDF++ +L+V ++ A+DLPAMD +G SDPYVK+Y+LP++K+KFET++ R  LNP +NETF F +PFNE+ SKTL+  VYD+DR SK D++GQ+ VPL +ID G   +  + L+ PE D EKE RLGDICFS RY P +G +T+ I+EA+NLKKMDVGG SDPYVK+ L    K + KKKT+ K  TLNPYYNESF F++    I+KV+LIV+V DYD++  ++ IG + LG         T A    W++M+ + RRP+ QWHTLQE  E
Sbjct:   85 GNIHFRVEYDFEQSKLSVTIVSASDLPAMDRNGMSDPYVKVYVLPERKQKFETRIIRNTLNPTYNETFQFSIPFNELHSKTLMLVVYDYDRLSKDDKMGQLSVPLESIDFGITTDIERPLQKPEKDDEKECRLGDICFSTRYRPATGTVTLTIMEARNLKKMDVGGSSDPYVKIYLHHGRKLLSKKKTSRKYKTLNPYYNESFQFKIEPHMIEKVHLIVSVWDYDKMSKNDFIGEVTLGSKHLNLPQITHACSEQWAEMMTS-RRPVVQWHTLQERME 361          

HSP 2 Score: 84.3445 bits (207), Expect = 2.590e-17
Identity = 45/133 (33.83%), Postives = 81/133 (60.90%), Query Frame = 3
Query:  447 EKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHR--KILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVI----EEWKEL 827
            ++++  LG + +S  Y    G +T+ +++A +L  MD+ G+SDPYVK+YL   +K   + K  R  K LNP +NE+F FK+  + +    LI +V+D+D+ SK+D IG++ +    ++L ++     E+W E+
Sbjct:  211 DEKECRLGDICFSTRYRPATGTVTLTIMEARNLKKMDVGGSSDPYVKIYLHHGRKLLSKKKTSRKYKTLNPYYNESFQFKIEPHMIEKVHLIVSVWDYDKMSKNDFIGEVTLGSKHLNLPQITHACSEQWAEM 343          

HSP 3 Score: 71.2478 bits (173), Expect = 4.502e-13
Identity = 50/151 (33.11%), Postives = 80/151 (52.98%), Query Frame = 3
Query:  747 KHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKE--------NRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRI 1175
            KH  IG   VP+ +     V     +   P N+G            + G+I F + Y     KL++ I+ A +L  MD  G+SDPYVK+ ++   +R +K +T I + TLNP YNE+F F +PF ++    L++ V DYDR+   + +G++
Sbjct:   37 KHVDIGNGAVPILSSKPITVQPTNSDYYEPVNNGTLPLSSSGALIKQYGNIHFRVEYDFEQSKLSVTIVSASDLPAMDRNGMSDPYVKVYVL--PERKQKFETRIIRNTLNPTYNETFQFSIPFNELHSKTLMLVVYDYDRLSKDDKMGQL 185          
BLAST of Synaptotagmin-1 vs. Ensembl Celegans
Match: snt-6 (SyNapTotagmin [Source:RefSeq peptide;Acc:NP_001254022])

HSP 1 Score: 192.2 bits (487), Expect = 1.602e-54
Identity = 103/270 (38.15%), Postives = 171/270 (63.33%), Query Frame = 3
Query:  468 GKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFK-VPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQI--QKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTL 1268
            G++ +S+ ++ +   L V +++A DLP  D +G+SDPYV+ +LL D  +   +KVHR+ LNP FNET  F+     ++   TL+  V D+DRFS  D IG+I +PL  +        WK L+ P      ++  G+I  SL Y+PTSGK+T+ I++A++L   D     D YVK+ ++  G +++K+KT++K +T +P +NESF+F +P +Q+   +VNL++T ++YD IG++E IG +++G   +    RHWS+ + +P +P+A WH L
Sbjct:  103 GRINFSVAFEKECSTLHVHLMEAVDLPVKDFTGSSDPYVRAFLLQDPGQSERSKVHRRNLNPTFNETLSFRGHSMKKLHDMTLVLQVMDYDRFSSDDPIGEILLPLKHVKFESSPVYWKHLQRPTVS---KDACGEIMISLCYLPTSGKITVSIIKARDLHAKDRTRHYDTYVKMWMVQQGNKLEKRKTSVKPHTPSPIFNESFAFSIPVKQVLLAEVNLVLTAMEYDVIGSNEEIGHVIVGGLGSEHGQRHWSECVNHPEQPVAMWHKL 369          
BLAST of Synaptotagmin-1 vs. Ensembl Fly
Match: Syt1 (Synaptotagmin 1 [Source:FlyBase gene name;Acc:FBgn0004242])

HSP 1 Score: 456.062 bits (1172), Expect = 5.950e-154
Identity = 225/317 (70.98%), Postives = 270/317 (85.17%), Query Frame = 3
Query:  342 VDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFK-VPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN 1289
            VDMKS QLLG++YKEK+QPD+EEL  N E+ +   ++ +  LG+L + L+YDF    L V VIQA +LPA+DM GTSDPYVK+YLLPDKKKKFETKVHRK L+PVFNETF FK +P+ +  +KTL+F ++DFDRFSKHDQIG++KVPL  IDL + IEEW++L S E +G +E +LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+++M NGKR+KKKKT+IKK TLNPYYNESFSFEVPFEQIQK+ L+VTVVDYDRIGTSEPIGR +LGC  TG ELRHWSDMLA+PRRPIAQWHTL++  E +
Sbjct:  152 VDMKSVQLLGSAYKEKVQPDMEELTENAEEGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGEGGQE-KLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTLKDPEETD 467          
BLAST of Synaptotagmin-1 vs. Ensembl Fly
Match: Syt1 (Synaptotagmin 1 [Source:FlyBase gene name;Acc:FBgn0004242])

HSP 1 Score: 454.136 bits (1167), Expect = 3.388e-153
Identity = 225/317 (70.98%), Postives = 268/317 (84.54%), Query Frame = 3
Query:  342 VDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFK-VPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN 1289
            VDMKS QLLG++YKEK+QPD+EEL  N E+ +   ++ +  LG+L + L+YDF    L V VIQA +LPA+DM GTSDPYVK+YLLPDKKKKFETKVHRK L+PVFNETF FK +P+ +  +KTL+F ++DFDRFSKHDQIG++KVPL  IDL + IEEW++L S E  GE   +LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+++M NGKR+KKKKT+IKK TLNPYYNESFSFEVPFEQIQK+ L+VTVVDYDRIGTSEPIGR +LGC  TG ELRHWSDMLA+PRRPIAQWHTL++  E +
Sbjct:  152 VDMKSVQLLGSAYKEKVQPDMEELTENAEEGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVE--GEGGQKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTLKDPEETD 466          
BLAST of Synaptotagmin-1 vs. Ensembl Fly
Match: Syt1 (Synaptotagmin 1 [Source:FlyBase gene name;Acc:FBgn0004242])

HSP 1 Score: 453.751 bits (1166), Expect = 4.249e-153
Identity = 224/317 (70.66%), Postives = 268/317 (84.54%), Query Frame = 3
Query:  342 VDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFK-VPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN 1289
            VDMKS QLLG++YKEK+QPD+EEL  N E+ +   ++ +  LG+L + L+YDF    L V VIQA +LPA+DM GTSDPYVK+YLLPDKKKKFETKVHRK L+PVFNETF FK +P+ +  +KTL+F ++DFDRFSKHDQIG++KVPL  IDL + IEEW++L S E +G    +LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+++M NGKR+KKKKT+IKK TLNPYYNESFSFEVPFEQIQK+ L+VTVVDYDRIGTSEPIGR +LGC  TG ELRHWSDMLA+PRRPIAQWHTL++  E +
Sbjct:  152 VDMKSVQLLGSAYKEKVQPDMEELTENAEEGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGEG---GQLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTLKDPEETD 465          
BLAST of Synaptotagmin-1 vs. Ensembl Fly
Match: Syt1 (Synaptotagmin 1 [Source:FlyBase gene name;Acc:FBgn0004242])

HSP 1 Score: 447.973 bits (1151), Expect = 8.378e-151
Identity = 224/317 (70.66%), Postives = 268/317 (84.54%), Query Frame = 3
Query:  342 VDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFK-VPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN 1289
            VDMKS QLLG++YKEK  PD+EEL  N E+ +   ++ +  LG+L + L+YDF    L V VIQA +LPA+DM GTSDPYVK+YLLPDKKKKFETKVHRK L+PVFNETF FK +P+ +  +KTL+F ++DFDRFSKHDQIG++KVPL  IDL + IEEW++L S E +G +E +LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+++M NGKR+KKKKT+IKK TLNPYYNESFSFEVPFEQIQK+ L+VTVVDYDRIGTSEPIGR +LGC  TG ELRHWSDMLA+PRRPIAQWHTL++  E +
Sbjct:  152 VDMKSVQLLGSAYKEK--PDMEELTENAEEGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGEGGQE-KLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTLKDPEETD 465          
BLAST of Synaptotagmin-1 vs. Ensembl Fly
Match: Syt1 (Synaptotagmin 1 [Source:FlyBase gene name;Acc:FBgn0004242])

HSP 1 Score: 447.973 bits (1151), Expect = 8.378e-151
Identity = 224/317 (70.66%), Postives = 268/317 (84.54%), Query Frame = 3
Query:  342 VDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFK-VPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN 1289
            VDMKS QLLG++YKEK  PD+EEL  N E+ +   ++ +  LG+L + L+YDF    L V VIQA +LPA+DM GTSDPYVK+YLLPDKKKKFETKVHRK L+PVFNETF FK +P+ +  +KTL+F ++DFDRFSKHDQIG++KVPL  IDL + IEEW++L S E +G +E +LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+++M NGKR+KKKKT+IKK TLNPYYNESFSFEVPFEQIQK+ L+VTVVDYDRIGTSEPIGR +LGC  TG ELRHWSDMLA+PRRPIAQWHTL++  E +
Sbjct:  152 VDMKSVQLLGSAYKEK--PDMEELTENAEEGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGEGGQE-KLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTLKDPEETD 465          
BLAST of Synaptotagmin-1 vs. Ensembl Zebrafish
Match: syt1a (synaptotagmin Ia [Source:ZFIN;Acc:ZDB-GENE-040718-165])

HSP 1 Score: 402.905 bits (1034), Expect = 5.067e-134
Identity = 197/269 (73.23%), Postives = 232/269 (86.25%), Query Frame = 3
Query:  465 LGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            LGKLQYS+DY+F +  L VG+IQA +LPAMDM GTSDPYVK+YLLPDKKKKFETKVHRK LNPVFNE F FKVP+ E+  KTL+  VYDFDRFSKHD IG +KVP+  +D   V EEW++L+S E   E++ +LGDICFSLRYVPT+GKLT+V+LEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV +++TV+DYD+IG ++ IG++ +G N+TG ELRHWSDMLANPRRPIAQWH L+
Sbjct:  139 LGKLQYSMDYNFTENTLIVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYTELGGKTLVMTVYDFDRFSKHDAIGDVKVPMNKVDFSHVTEEWRDLQSAEK--EEQEKLGDICFSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVITVLDYDKIGKNDAIGKVFVGLNSTGTELRHWSDMLANPRRPIAQWHVLK 405          
BLAST of Synaptotagmin-1 vs. Ensembl Zebrafish
Match: syt1a (synaptotagmin Ia [Source:ZFIN;Acc:ZDB-GENE-040718-165])

HSP 1 Score: 402.905 bits (1034), Expect = 5.067e-134
Identity = 197/269 (73.23%), Postives = 232/269 (86.25%), Query Frame = 3
Query:  465 LGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            LGKLQYS+DY+F +  L VG+IQA +LPAMDM GTSDPYVK+YLLPDKKKKFETKVHRK LNPVFNE F FKVP+ E+  KTL+  VYDFDRFSKHD IG +KVP+  +D   V EEW++L+S E   E++ +LGDICFSLRYVPT+GKLT+V+LEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV +++TV+DYD+IG ++ IG++ +G N+TG ELRHWSDMLANPRRPIAQWH L+
Sbjct:  139 LGKLQYSMDYNFTENTLIVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYTELGGKTLVMTVYDFDRFSKHDAIGDVKVPMNKVDFSHVTEEWRDLQSAEK--EEQEKLGDICFSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVITVLDYDKIGKNDAIGKVFVGLNSTGTELRHWSDMLANPRRPIAQWHVLK 405          
BLAST of Synaptotagmin-1 vs. Ensembl Zebrafish
Match: syt2a (synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503-315])

HSP 1 Score: 376.326 bits (965), Expect = 1.493e-123
Identity = 184/269 (68.40%), Postives = 229/269 (85.13%), Query Frame = 3
Query:  465 LGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            LGKLQ+SLDYDF   +LTVG++QA DL +MD  GTSDPYVK+++LPDKKKK++TKVH+K LNPVFNETF FK+PF E+  KTL+ +VYDFDRFSKHD IG++K+P+  +DL + IE+W++L+S E   E+  +LGDIC SLRYVPT+GKLTI ILEAKNLKKMDVGGLSDPYVK+ L+ NGKR+KKKKTT+KK TLNPYYNESFSFE+P +Q+QK+  ++TV+DYD+IG ++ IG+I +G  A G ELRHWSDMLANPRRPIAQWH L+
Sbjct:  148 LGKLQFSLDYDFSASQLTVGILQAADLLSMDSGGTSDPYVKVFILPDKKKKYDTKVHKKTLNPVFNETFHFKIPFTEMGGKTLVMSVYDFDRFSKHDVIGEVKIPMNTLDLAQPIEQWRDLDSAEK--EEPEKLGDICISLRYVPTAGKLTICILEAKNLKKMDVGGLSDPYVKIHLLQNGKRLKKKKTTVKKNTLNPYYNESFSFEIPQDQMQKIQAVITVLDYDKIGKNDAIGKIWVGSKAQGTELRHWSDMLANPRRPIAQWHPLK 414          
BLAST of Synaptotagmin-1 vs. Ensembl Zebrafish
Match: syt5a (synaptotagmin Va [Source:ZFIN;Acc:ZDB-GENE-040718-110])

HSP 1 Score: 372.859 bits (956), Expect = 2.130e-122
Identity = 180/266 (67.67%), Postives = 228/266 (85.71%), Query Frame = 3
Query:  474 LQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            L+Y+LDY+F + +L VG++QA DLPAMD+ GTSDPYVK+Y+LPDKKKKFETKV RK L PVFNETF+FK+PFN++A +TL+  V+DFDRF KHD IG+IK+P+ +IDLG+ I E+K+L   E   E++ +LGDIC SLRYVPTSGKLT+ I+EAKNLKKMDVGGLSDP+VK+ L  NGKR+KKKKTT+K+ TLNPY+NESFSFE+PF QIQKV +++TV DYD++G+++PIG+  +G  A+G  LRHWSDMLANPRRP+AQWHTLQ
Sbjct:  133 LEYTLDYNFTENQLIVGILQAQDLPAMDIGGTSDPYVKVYMLPDKKKKFETKVQRKNLCPVFNETFIFKIPFNDLAGQTLVLQVFDFDRFGKHDVIGEIKIPMNSIDLGQPIHEYKDLVGGEK--EEQEKLGDICISLRYVPTSGKLTVCIMEAKNLKKMDVGGLSDPFVKIVLQHNGKRIKKKKTTVKQNTLNPYFNESFSFEIPFAQIQKVQVLITVYDYDKLGSNDPIGKCWIGFGASGVGLRHWSDMLANPRRPVAQWHTLQ 396          
BLAST of Synaptotagmin-1 vs. Ensembl Zebrafish
Match: syt5a (synaptotagmin Va [Source:ZFIN;Acc:ZDB-GENE-040718-110])

HSP 1 Score: 364.77 bits (935), Expect = 2.369e-119
Identity = 179/268 (66.79%), Postives = 227/268 (84.70%), Query Frame = 3
Query:  474 LQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSD--PYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            L+Y+LDY+F + +L VG++QA DLPAMD+ GTSDPYVK+Y+LPDKKKKFETKV RK L PVFNETF+FK+PFN++A +TL+  V+DFDRF KHD IG+IK+P+ +IDLG+ I E+K+L   E   E++ +LGDIC SLRYVPTSGKLT+ I+EAKNLKKMDVGGLS   P+VK+ L  NGKR+KKKKTT+K+ TLNPY+NESFSFE+PF QIQKV +++TV DYD++G+++PIG+  +G  A+G  LRHWSDMLANPRRP+AQWHTLQ
Sbjct:  128 LEYTLDYNFTENQLIVGILQAQDLPAMDIGGTSDPYVKVYMLPDKKKKFETKVQRKNLCPVFNETFIFKIPFNDLAGQTLVLQVFDFDRFGKHDVIGEIKIPMNSIDLGQPIHEYKDLVGGEK--EEQEKLGDICISLRYVPTSGKLTVCIMEAKNLKKMDVGGLSGKYPFVKIVLQHNGKRIKKKKTTVKQNTLNPYFNESFSFEIPFAQIQKVQVLITVYDYDKLGSNDPIGKCWIGFGASGVGLRHWSDMLANPRRPVAQWHTLQ 393          
BLAST of Synaptotagmin-1 vs. Ensembl Xenopus
Match: syt5 (synaptotagmin V [Source:Xenbase;Acc:XB-GENE-991349])

HSP 1 Score: 441.425 bits (1134), Expect = 3.040e-149
Identity = 220/311 (70.74%), Postives = 267/311 (85.85%), Query Frame = 3
Query:  342 VDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVK-EKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            ++MK  + LG SY +K+QPD+E+LD ++ D+  VK EK    LGKLQYSLDYDFQ G+L VG+IQA DLPA+D+ GTSDPYVK+YLLPDKKKK+ETKVHRK LNP FNE+F FKVP+ E+  KTL+ +VYDFDRFSKHD IG+++V +  +DL  VIEEW++L+S E   E++ +LGDICFSLRYVPT+GKLT+++LEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV +++TV+DYD++G +E IG+I +GCNATG ELRHWSDMLANPRRPIAQWHTLQ
Sbjct:   98 INMKEVKELGKSYIDKVQPDVEDLDPSLLDD--VKDEKPQEKLGKLQYSLDYDFQTGQLVVGIIQAADLPALDIGGTSDPYVKVYLLPDKKKKYETKVHRKTLNPTFNESFTFKVPYAELGGKTLVMSVYDFDRFSKHDAIGEVRVHMNTVDLAHVIEEWQDLQSAEK--EEQEKLGDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVLTVLDYDKLGKNEAIGKIFVGCNATGTELRHWSDMLANPRRPIAQWHTLQ 404          
BLAST of Synaptotagmin-1 vs. Ensembl Xenopus
Match: syt1 (synaptotagmin 1 [Source:Xenbase;Acc:XB-GENE-5752629])

HSP 1 Score: 414.075 bits (1063), Expect = 1.565e-138
Identity = 212/312 (67.95%), Postives = 259/312 (83.01%), Query Frame = 3
Query:  339 VVDMKSAQLLGNSYKEK-IQPDLEELDANMEDNEGVKEKEDVH-LGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTL 1268
             ++MK  + LG + K++ ++ D ++ +  + D E  ++ ++V  LGKLQYSLDYDFQ  +L VG+IQA +LPA+DM GTSDPYVKL+L+PDKKKKFETKVHRK LNPVFNE F FKVP+ E+  KTL+  VYDFDRFSKHD IG +KVP+  +D G V EEW++L S E   E++ +LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV ++VTV+DYD+IG ++ IG++ +G N+TGAELRHWSDMLANPRRPIAQWHTL
Sbjct:  103 AINMKDVKDLGKTMKDQALKDDDDDAETGLTDGEDKEQPKEVEKLGKLQYSLDYDFQNNQLMVGIIQAAELPALDMGGTSDPYVKLFLMPDKKKKFETKVHRKTLNPVFNEQFTFKVPYAELGGKTLVLTVYDFDRFSKHDVIGDVKVPMNTVDFGHVTEEWRDLVSAEK--EEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTL 412          
BLAST of Synaptotagmin-1 vs. Ensembl Xenopus
Match: syt2 (synaptotagmin II [Source:Xenbase;Acc:XB-GENE-981211])

HSP 1 Score: 400.593 bits (1028), Expect = 2.559e-133
Identity = 192/269 (71.38%), Postives = 235/269 (87.36%), Query Frame = 3
Query:  465 LGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            +GKLQ+SLDYDFQ  ++ VG+IQAT+LPA+DM GTSDPYVK++ LPDKKKK ETKVHRK LNP+FNETF FK+P+ E+  KTL  ++YDFDRFSKHD IG++KVP+  +DLG+ IEEW++L+S E   E+  +LGDIC SLRYVPT+GKLT+ ILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTT+KK TLNPY+NESFSFE+PFEQIQKV +++TV+DYD++G +E IG+I +GCNA+G ELRHWSDMLANPRRPIAQWH L+
Sbjct:  136 IGKLQFSLDYDFQNNQMQVGIIQATELPALDMGGTSDPYVKVFFLPDKKKKHETKVHRKTLNPIFNETFTFKIPYQELGGKTLCMSIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQSAEK--EEPEKLGDICISLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVITVLDYDKLGKNEAIGKIFVGCNASGTELRHWSDMLANPRRPIAQWHPLK 402          

HSP 2 Score: 84.3445 bits (207), Expect = 3.371e-17
Identity = 51/145 (35.17%), Postives = 85/145 (58.62%), Query Frame = 3
Query:  399 DLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKK--KFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKEL 827
            DL +      D +  +++E   LG +  SL Y    G+LTV +++A +L  MD+ G SDPYVK++L+ + K+  K +T V +K LNP FNE+F F++PF ++    ++  V D+D+  K++ IG+I V  G    G  +  W ++
Sbjct:  245 DLGQPIEEWRDLQSAEKEEPEKLGDICISLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVITVLDYDKLGKNEAIGKIFV--GCNASGTELRHWSDM 387          
BLAST of Synaptotagmin-1 vs. Ensembl Xenopus
Match: syt8 (synaptotagmin VIII [Source:Xenbase;Acc:XB-GENE-978920])

HSP 1 Score: 332.798 bits (852), Expect = 2.081e-107
Identity = 174/305 (57.05%), Postives = 225/305 (73.77%), Query Frame = 3
Query:  369 GNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPE 1283
            GN     +QP       N++  E V+ +     G++QYSL+Y+FQ  ELTVGV QA  L AMD+ GTSDPY  +Y+  D +KKFETKV+RK LNPVFNE+FVFKV   EV   T +  ++DF+RF KHD IG++ +PLG ++L  VIE+WK+L  P    E E+ LGDICFSLRYVP+SGKLTI+ILEAKNLK+MD  G SDPYVK+ L LN K+ K+KKT +KK TL PY+NESF+F+V  EQ++ ++LI++V D+D++G +E IG++ LGC A+G  LRHWSDMLA+PRRPIAQWH LQE  E
Sbjct:   83 GNLTTHLVQPGA----GNLQKGEKVEYR-----GRVQYSLEYNFQTEELTVGVKQAAALKAMDLGGTSDPYAIVYVTNDTRKKFETKVNRKTLNPVFNESFVFKVTQEEVPRTTAVVQIFDFNRFLKHDVIGEMVIPLGEVNLQHVIEDWKDL-GPAGKTEHEH-LGDICFSLRYVPSSGKLTIIILEAKNLKRMDSDGFSDPYVKVHLALNRKKWKRKKTAVKKSTLKPYFNESFTFDVSLEQMKNLDLIISVWDHDKVGKNEQIGKLFLGCRASGNALRHWSDMLAHPRRPIAQWHKLQEADE 376          
BLAST of Synaptotagmin-1 vs. Ensembl Xenopus
Match: syt6 (synaptotagmin VI [Source:Xenbase;Acc:XB-GENE-953252])

HSP 1 Score: 264.233 bits (674), Expect = 3.107e-80
Identity = 141/310 (45.48%), Postives = 216/310 (69.68%), Query Frame = 3
Query:  387 KIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVP--LGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN**CSFDA 1310
            +I+P+L +  +   D+E +K+ +    GK+ ++L YD++   L V +++A DLPA D  G+SDPYVK+YLLPD+K+KF+T+VHRK LNP F+E+F F VP++++ ++ L  +V+DFDRFS+HD IG++ +       DL R    WK+++    +      LG+I FSL Y+PT+G+LT+ +++ +NLK MD+ G SDPYVK+SL+ +G+R+KKKKTTIKK TLNP YNE+  F++P E + +V+L+++V+DYDR+G +E IG   +G +  G    HW++MLA PR+PI  WH L E   +    SFD+
Sbjct:  155 RIKPELYKQKS--VDSEDIKKDDAKTCGKINFTLKYDYEIETLIVRILKAFDLPAKDFCGSSDPYVKIYLLPDRKRKFQTRVHRKTLNPTFDESFHFPVPYDDLPNRKLHLSVFDFDRFSRHDMIGEVILENLFEESDLSRESSIWKDIQYATTESVD---LGEIMFSLCYLPTAGRLTLTVIKCRNLKAMDITGYSDPYVKVSLLCDGRRLKKKKTTIKKNTLNPTYNEAIIFDIPPENMDQVSLLISVMDYDRVGHNEIIGVCRVGNSTEGLGRDHWNEMLAYPRKPITHWHPLVEWQSHA--ASFDS 457          
BLAST of Synaptotagmin-1 vs. Ensembl Mouse
Match: Syt1 (synaptotagmin I [Source:MGI Symbol;Acc:MGI:99667])

HSP 1 Score: 414.846 bits (1065), Expect = 1.860e-138
Identity = 213/310 (68.71%), Postives = 256/310 (82.58%), Query Frame = 3
Query:  342 VDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            ++MK  + LG + K++   D +      +  E  + KE+  LGKLQYSLDYDFQ  +L VG+IQA +LPA+DM GTSDPYVK++LLPDKKKKFETKVHRK LNPVFNE F FKVP++E+  KTL+  VYDFDRFSKHD IG+ KVP+  +D G V EEW++L+S E   E++ +LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV ++VTV+DYD+IG ++ IG++ +G N+TGAELRHWSDMLANPRRPIAQWHTLQ
Sbjct:  101 INMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK--EEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQ 408          
BLAST of Synaptotagmin-1 vs. Ensembl Mouse
Match: Syt1 (synaptotagmin I [Source:MGI Symbol;Acc:MGI:99667])

HSP 1 Score: 414.846 bits (1065), Expect = 1.860e-138
Identity = 213/310 (68.71%), Postives = 256/310 (82.58%), Query Frame = 3
Query:  342 VDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            ++MK  + LG + K++   D +      +  E  + KE+  LGKLQYSLDYDFQ  +L VG+IQA +LPA+DM GTSDPYVK++LLPDKKKKFETKVHRK LNPVFNE F FKVP++E+  KTL+  VYDFDRFSKHD IG+ KVP+  +D G V EEW++L+S E   E++ +LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV ++VTV+DYD+IG ++ IG++ +G N+TGAELRHWSDMLANPRRPIAQWHTLQ
Sbjct:  101 INMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK--EEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQ 408          
BLAST of Synaptotagmin-1 vs. Ensembl Mouse
Match: Syt2 (synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666])

HSP 1 Score: 402.519 bits (1033), Expect = 9.460e-134
Identity = 196/270 (72.59%), Postives = 236/270 (87.41%), Query Frame = 3
Query:  462 HLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            +LGKLQ+SLDYDFQ  +LTVGV+QA +LPA+DM GTSDPYVK++LLPDKKKK+ETKVHRK LNP FNETF FKVP+ E+  KTL+  +YDFDRFSKHD IG++KVP+  +DLG+ IEEW++L+  E   E+  +LGDIC SLRYVPT+GKLT+ ILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTT+KK TLNPY+NESFSFE+PFEQIQKV ++VTV+DYD++G +E IG+I +G NATG ELRHWSDMLANPRRPIAQWH+L+
Sbjct:  142 NLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEK--EEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLK 409          

HSP 2 Score: 85.1149 bits (209), Expect = 3.873e-17
Identity = 50/135 (37.04%), Postives = 84/135 (62.22%), Query Frame = 3
Query:  429 DNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKK--KFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKEL 827
            D +G +++E   LG +  SL Y    G+LTV +++A +L  MD+ G SDPYVK++L+ + K+  K +T V +K LNP FNE+F F++PF ++    ++  V D+D+  K++ IG+I V  G+   G  +  W ++
Sbjct:  262 DLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFV--GSNATGTELRHWSDM 394          
BLAST of Synaptotagmin-1 vs. Ensembl Mouse
Match: Syt2 (synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666])

HSP 1 Score: 402.519 bits (1033), Expect = 9.460e-134
Identity = 196/270 (72.59%), Postives = 236/270 (87.41%), Query Frame = 3
Query:  462 HLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            +LGKLQ+SLDYDFQ  +LTVGV+QA +LPA+DM GTSDPYVK++LLPDKKKK+ETKVHRK LNP FNETF FKVP+ E+  KTL+  +YDFDRFSKHD IG++KVP+  +DLG+ IEEW++L+  E   E+  +LGDIC SLRYVPT+GKLT+ ILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTT+KK TLNPY+NESFSFE+PFEQIQKV ++VTV+DYD++G +E IG+I +G NATG ELRHWSDMLANPRRPIAQWH+L+
Sbjct:  142 NLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEK--EEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLK 409          

HSP 2 Score: 85.1149 bits (209), Expect = 3.873e-17
Identity = 50/135 (37.04%), Postives = 84/135 (62.22%), Query Frame = 3
Query:  429 DNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKK--KFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKEL 827
            D +G +++E   LG +  SL Y    G+LTV +++A +L  MD+ G SDPYVK++L+ + K+  K +T V +K LNP FNE+F F++PF ++    ++  V D+D+  K++ IG+I V  G+   G  +  W ++
Sbjct:  262 DLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFV--GSNATGTELRHWSDM 394          
BLAST of Synaptotagmin-1 vs. Ensembl Mouse
Match: Syt5 (synaptotagmin V [Source:MGI Symbol;Acc:MGI:1926368])

HSP 1 Score: 368.622 bits (945), Expect = 4.159e-121
Identity = 186/311 (59.81%), Postives = 250/311 (80.39%), Query Frame = 3
Query:  342 VDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELE-SPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            V ++  + LG SY +K+QP++EELD +     G +  +   LG+LQYSLDYDFQ G+L VG++QA  L A+D+ G+SDPYV +YLLPDK+++ ETKVHR+ LNP F ETF FKVP+ E+  + L+  VYDFDRFS++D IG+++VP+ +++LGR ++ W+EL+ +P+ + EK   LGDICFSLRYVPT+GKLT+++LEAKNLKKMDVGGLSDPYVK+ L+  GK+V+KKKTTIKK TLNPYYNE+FSFEVP +Q+QKV + +TV+DYD++G +E IGR+ +G    GA LRHW+DMLANPRRPIAQWH+L+
Sbjct:   69 VHLQEVKELGRSYIDKVQPEIEELDRS-PSMPGQQVSDKHQLGRLQYSLDYDFQTGQLLVGILQAQGLAALDLGGSSDPYVSVYLLPDKRRRHETKVHRQTLNPHFGETFAFKVPYVELGGRVLVMAVYDFDRFSRNDAIGEVRVPMSSVNLGRPVQAWRELQVAPKEEQEK---LGDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKVHLLQGGKKVRKKKTTIKKNTLNPYYNEAFSFEVPCDQVQKVQVELTVLDYDKLGKNEAIGRVAVGAAVGGAGLRHWADMLANPRRPIAQWHSLR 375          
BLAST of Synaptotagmin-1 vs. UniProt
Match: sp|P41823|SY65_APLCA (Synaptotagmin-1 OS=Aplysia californica GN=SYT1 PE=1 SV=2)

HSP 1 Score: 511.916 bits (1317), Expect = 1.652e-175
Identity = 254/318 (79.87%), Postives = 286/318 (89.94%), Query Frame = 3
Query:  339 VVDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKE-KEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN 1289
             VD+KS QLLGNSYKEK+QPDL+EL  NMEDNE  +  K +V LGKLQ+SLDYDFQKGEL+V VIQA DLP MDMSGTSDPYVK+YLLPDKKKK+ETKVHRK LNPVFNE+F FKVP+ EV SK L F VYDFDRFSKHDQIGQ++VPL +IDLGRV+E+WK+L+SP+ + EKEN+LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK++L+   KR+KKKKTTIKK TLNPY+NESF FEVPFEQIQKV LI+TVVDYDRIGTSEPIGR VLGCN++G ELRHWSDMLANPRRPIAQWHTLQE+PE N
Sbjct:  111 AVDLKSVQLLGNSYKEKVQPDLDELPVNMEDNEDAESTKSEVKLGKLQFSLDYDFQKGELSVNVIQAADLPGMDMSGTSDPYVKVYLLPDKKKKYETKVHRKTLNPVFNESFTFKVPYAEVGSKILTFAVYDFDRFSKHDQIGQVQVPLNSIDLGRVVEDWKDLQSPDTESEKENKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIALLQGTKRLKKKKTTIKKNTLNPYFNESFGFEVPFEQIQKVTLIITVVDYDRIGTSEPIGRCVLGCNSSGTELRHWSDMLANPRRPIAQWHTLQEVPEKN 428          
BLAST of Synaptotagmin-1 vs. UniProt
Match: sp|P21521|SY65_DROME (Synaptotagmin 1 OS=Drosophila melanogaster GN=Syt1 PE=1 SV=3)

HSP 1 Score: 456.062 bits (1172), Expect = 5.881e-153
Identity = 225/317 (70.98%), Postives = 270/317 (85.17%), Query Frame = 3
Query:  342 VDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFK-VPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN 1289
            VDMKS QLLG++YKEK+QPD+EEL  N E+ +   ++ +  LG+L + L+YDF    L V VIQA +LPA+DM GTSDPYVK+YLLPDKKKKFETKVHRK L+PVFNETF FK +P+ +  +KTL+F ++DFDRFSKHDQIG++KVPL  IDL + IEEW++L S E +G +E +LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+++M NGKR+KKKKT+IKK TLNPYYNESFSFEVPFEQIQK+ L+VTVVDYDRIGTSEPIGR +LGC  TG ELRHWSDMLA+PRRPIAQWHTL++  E +
Sbjct:  152 VDMKSVQLLGSAYKEKVQPDMEELTENAEEGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGEGGQE-KLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTLKDPEETD 467          
BLAST of Synaptotagmin-1 vs. UniProt
Match: sp|P34693|SYT1_CAEEL (Synaptotagmin-1 OS=Caenorhabditis elegans GN=snt-1 PE=2 SV=1)

HSP 1 Score: 418.698 bits (1075), Expect = 6.844e-139
Identity = 226/317 (71.29%), Postives = 262/317 (82.65%), Query Frame = 3
Query:  339 VVDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVH--LGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPE 1283
            VVD K+ Q +          DLEEL   ME NE  + +E     LG++QY LDYDFQ+G+LTV VIQA DLP MDMSGTSDPYVKLYLLP+KKKK ETKVHRK LNPVFNETF+FKV FNE+ +KTL+F +YDFDRFSKHDQIGQ+ +PLG IDLG VIEEWK++  P +D E E  LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+ LM  GKR+KKKKT+IKK TLNPYYNESFSFEVPFEQIQKV+L++TV+DYD++G+++ IGR +LGCN TGAELRHW DMLA+PRRPIAQWHTL  + E
Sbjct:  124 VVDGKNIQGMAQ--------DLEELGDAMEQNEKEQAEEKEEVKLGRIQYKLDYDFQQGQLTVTVIQAEDLPGMDMSGTSDPYVKLYLLPEKKKKVETKVHRKTLNPVFNETFIFKVAFNEITAKTLVFAIYDFDRFSKHDQIGQVLIPLGKIDLGAVIEEWKDIAPPPDDKEAEKSLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIVLMQGGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKVSLMITVMDYDKLGSNDAIGRCLLGCNGTGAELRHWMDMLASPRRPIAQWHTLGPVEE 432          
BLAST of Synaptotagmin-1 vs. UniProt
Match: sp|P46096|SYT1_MOUSE (Synaptotagmin-1 OS=Mus musculus GN=Syt1 PE=1 SV=1)

HSP 1 Score: 414.846 bits (1065), Expect = 1.448e-137
Identity = 213/310 (68.71%), Postives = 256/310 (82.58%), Query Frame = 3
Query:  342 VDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            ++MK  + LG + K++   D +      +  E  + KE+  LGKLQYSLDYDFQ  +L VG+IQA +LPA+DM GTSDPYVK++LLPDKKKKFETKVHRK LNPVFNE F FKVP++E+  KTL+  VYDFDRFSKHD IG+ KVP+  +D G V EEW++L+S E   E++ +LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV ++VTV+DYD+IG ++ IG++ +G N+TGAELRHWSDMLANPRRPIAQWHTLQ
Sbjct:  101 INMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK--EEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQ 408          
BLAST of Synaptotagmin-1 vs. UniProt
Match: sp|P21707|SYT1_RAT (Synaptotagmin-1 OS=Rattus norvegicus GN=Syt1 PE=1 SV=3)

HSP 1 Score: 414.461 bits (1064), Expect = 1.631e-137
Identity = 213/310 (68.71%), Postives = 256/310 (82.58%), Query Frame = 3
Query:  342 VDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQ 1271
            ++MK  + LG + K++   D +      +  E  + KE+  LGKLQYSLDYDFQ  +L VG+IQA +LPA+DM GTSDPYVK++LLPDKKKKFETKVHRK LNPVFNE F FKVP++E+  KTL+  VYDFDRFSKHD IG+ KVP+  +D G V EEW++L+S E   E++ +LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+ LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQKV ++VTV+DYD+IG ++ IG++ +G N+TGAELRHWSDMLANPRRPIAQWHTLQ
Sbjct:  101 INMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK--EEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQ 408          
BLAST of Synaptotagmin-1 vs. TrEMBL
Match: tr|Q9U8R6|Q9U8R6_DUGJA (Djsyt protein OS=Dugesia japonica GN=Djsyt PE=2 SV=1)

HSP 1 Score: 662.144 bits (1707), Expect = 0.000e+0
Identity = 379/395 (95.95%), Postives = 389/395 (98.48%), Query Frame = 3
Query:  105 MKNSTHGSDHSASKASMKTNVEKFWHDLGKKLHMDPKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN 1289
            MKN THG+DH+ SK+ MK NV+KFW+DLGKKLHMDP+ALIGVT+GLGILFLLFLYCLCKKCVFKRRKKKE  KKGAKGVVDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKL+LLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTL+FNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESP+NDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN
Sbjct:    1 MKNVTHGTDHTVSKSDMKNNVQKFWNDLGKKLHMDPRALIGVTVGLGILFLLFLYCLCKKCVFKRRKKKEAGKKGAKGVVDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLFLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLVFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPDNDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN 395          
BLAST of Synaptotagmin-1 vs. TrEMBL
Match: tr|R7U5Y9|R7U5Y9_CAPTE (Synaptotagmin 1 variant OS=Capitella teleta GN=Syt1 PE=4 SV=1)

HSP 1 Score: 528.094 bits (1359), Expect = 1.328e-179
Identity = 261/316 (82.59%), Postives = 290/316 (91.77%), Query Frame = 3
Query:  339 VVDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKE-KEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPE 1283
             VD+ S ++LGNSYKEK+QPDLEEL+ NMEDNE  +  K +V LGKLQ+SLDYDFQKGEL VGVIQ  DLP MDMSGTSDPYVK+YLLP+KKKK ETKVHRK LNPVFNETF FKVP+ E+ SKTL+F VYDFDRFSKHDQIGQ+KVPL ++DLGRV+EEW++L SPE+D EKEN+LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVKLSLMLNGKR+KKKKTTIKK TLNPYYNESF+FEVPFEQIQKV +I+TVVDYDRIGTSEPIGR+VLGCN+TG ELRHWSDMLANPRRPIAQWHTLQEMPE
Sbjct:  121 AVDLGSVKILGNSYKEKVQPDLEELEVNMEDNEDAESTKSEVKLGKLQFSLDYDFQKGELAVGVIQGADLPGMDMSGTSDPYVKVYLLPEKKKKHETKVHRKTLNPVFNETFNFKVPYAEMGSKTLVFAVYDFDRFSKHDQIGQVKVPLNSVDLGRVVEEWRDLTSPESDSEKENKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRIKKKKTTIKKCTLNPYYNESFTFEVPFEQIQKVTMIITVVDYDRIGTSEPIGRVVLGCNSTGTELRHWSDMLANPRRPIAQWHTLQEMPE 436          
BLAST of Synaptotagmin-1 vs. TrEMBL
Match: tr|Q869G5|Q869G5_LYMST (Synaptotagmin I OS=Lymnaea stagnalis PE=2 SV=1)

HSP 1 Score: 526.168 bits (1354), Expect = 3.841e-179
Identity = 261/318 (82.08%), Postives = 290/318 (91.19%), Query Frame = 3
Query:  339 VVDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKE-KEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN 1289
             VD+KS QLLGNSYKEK+QPDL+EL  NMEDNE  +  K +V LGKLQ+SLDYDFQKGEL+V VIQA DLP MDMSGTSDPYVK+YLLPDKKKK+ETKVHRK LNPVFNE+F FKVP+ EV SK L F VYDFDRFSKHDQIGQ++VPL +IDLGRV+EEW++L+SP+ + EKEN+LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+SLMLNGKRVKKKKTTIKK TLNPYYNESF+FEVPFEQIQKV LIVTVVDYDRIGTSEPIGR VLGCN++G ELRHWSDMLANPRRPIAQWHTLQE+PE +
Sbjct:  101 AVDLKSVQLLGNSYKEKVQPDLDELPVNMEDNEDAESTKSEVKLGKLQFSLDYDFQKGELSVNVIQAADLPGMDMSGTSDPYVKVYLLPDKKKKYETKVHRKTLNPVFNESFTFKVPYAEVGSKILTFAVYDFDRFSKHDQIGQVQVPLNSIDLGRVVEEWRDLQSPDTESEKENKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKISLMLNGKRVKKKKTTIKKCTLNPYYNESFTFEVPFEQIQKVTLIVTVVDYDRIGTSEPIGRCVLGCNSSGTELRHWSDMLANPRRPIAQWHTLQEVPEKS 418          
BLAST of Synaptotagmin-1 vs. TrEMBL
Match: tr|V4B4W6|V4B4W6_LOTGI (Synaptotagmin 1 variant OS=Lottia gigantea GN=Syt1 PE=4 SV=1)

HSP 1 Score: 525.398 bits (1352), Expect = 1.287e-178
Identity = 256/318 (80.50%), Postives = 291/318 (91.51%), Query Frame = 3
Query:  339 VVDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKE-KEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN 1289
             VD+KS QLLGN+YKEK+QPDL+EL  NMEDNE  +  K +V LGKLQ+SLDYDFQK EL+VGV+QA DLP MDMSGTSDPYVK+YLLPDKKKK+ETKVHRK LNPVFNETF FKVP+ E+ +KTL+F VYDFDRFSKHDQIGQ+K+PL +IDLG+V EEW++L SP+N+ EKEN+LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+S+ LNGKR+KKKKTTIKK TLNPYYNESF+FEVPFEQIQKV LI+TVVDYDRIGTSEPIGR++LGCN+TG ELRHWSDMLANPRRPIAQWHTLQE+PE N
Sbjct:  107 AVDLKSVQLLGNAYKEKVQPDLDELQVNMEDNEDAESTKSEVKLGKLQFSLDYDFQKAELSVGVVQAADLPGMDMSGTSDPYVKVYLLPDKKKKYETKVHRKTLNPVFNETFTFKVPYAEIGAKTLVFAVYDFDRFSKHDQIGQVKIPLNSIDLGKVTEEWQDLSSPDNEAEKENKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKISMNLNGKRIKKKKTTIKKCTLNPYYNESFTFEVPFEQIQKVQLIITVVDYDRIGTSEPIGRVLLGCNSTGTELRHWSDMLANPRRPIAQWHTLQEVPEKN 424          
BLAST of Synaptotagmin-1 vs. TrEMBL
Match: tr|A0A0B6ZLE5|A0A0B6ZLE5_9EUPU (Uncharacterized protein (Fragment) OS=Arion vulgaris GN=ORF66707 PE=4 SV=1)

HSP 1 Score: 523.087 bits (1346), Expect = 4.021e-178
Identity = 260/318 (81.76%), Postives = 290/318 (91.19%), Query Frame = 3
Query:  339 VVDMKSAQLLGNSYKEKIQPDLEELDANMEDNEGVKE-KEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGXXXXXXXXXXXXXXLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN 1289
             VD+KS QLLGNSYKEK+QPDL+EL  NMEDNE  +  K +V LGKLQ+SLDYDFQKGEL+V VIQA DLP MDMSGTSDPYVK+YLLPDKKKK+ETKVHRK LNPVFNE+F FKVP+ EV SK L F VYDFDRFSKHDQIGQ++VPL +IDLGRV+EEW++L+SP+ + EKEN+LGDICFSLRYVPT+GKLT+VILEAKNLKKMDVGGLSDPYVK+SLMLNGKRVKKKKTTIKK TLNPYYNESF+FEVPFEQIQKV LI+TVVDYDRIGTSEPIGR VLGCN++G ELRHWSDMLANPRRPIAQWHTLQE+PE +
Sbjct:   89 AVDLKSVQLLGNSYKEKVQPDLDELPVNMEDNEDAESTKSEVKLGKLQFSLDYDFQKGELSVNVIQAADLPGMDMSGTSDPYVKVYLLPDKKKKYETKVHRKTLNPVFNESFTFKVPYAEVGSKILTFAVYDFDRFSKHDQIGQVQVPLNSIDLGRVVEEWRDLQSPDMESEKENKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKISLMLNGKRVKKKKTTIKKCTLNPYYNESFTFEVPFEQIQKVTLIITVVDYDRIGTSEPIGRCVLGCNSSGTELRHWSDMLANPRRPIAQWHTLQEVPEKS 406          
The following BLAST results are available for this feature:
BLAST of Synaptotagmin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 5
Match NameE-valueIdentityDescription
SYT15.051e-13868.49synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509... [more]
SYT15.051e-13868.49synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509... [more]
SYT15.051e-13868.49synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509... [more]
SYT12.139e-13775.84synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509... [more]
SYT21.739e-13372.59synaptotagmin 2 [Source:HGNC Symbol;Acc:HGNC:11510... [more]
back to top
BLAST of Synaptotagmin-1 vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 5
Match NameE-valueIdentityDescription
snt-15.018e-14071.29Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
snt-19.753e-12967.08Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
snt-36.326e-11664.55SyNapTotagmin [Source:RefSeq peptide;Acc:NP_50340... [more]
snt-21.479e-9152.52SyNapTotagmin [Source:RefSeq peptide;Acc:NP_49726... [more]
snt-61.602e-5438.15SyNapTotagmin [Source:RefSeq peptide;Acc:NP_00125... [more]
back to top
BLAST of Synaptotagmin-1 vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 5
Match NameE-valueIdentityDescription
Syt15.950e-15470.98Synaptotagmin 1 [Source:FlyBase gene name;Acc:FBgn... [more]
Syt13.388e-15370.98Synaptotagmin 1 [Source:FlyBase gene name;Acc:FBgn... [more]
Syt14.249e-15370.66Synaptotagmin 1 [Source:FlyBase gene name;Acc:FBgn... [more]
Syt18.378e-15170.66Synaptotagmin 1 [Source:FlyBase gene name;Acc:FBgn... [more]
Syt18.378e-15170.66Synaptotagmin 1 [Source:FlyBase gene name;Acc:FBgn... [more]
back to top
BLAST of Synaptotagmin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 5
Match NameE-valueIdentityDescription
syt1a5.067e-13473.23synaptotagmin Ia [Source:ZFIN;Acc:ZDB-GENE-040718-... [more]
syt1a5.067e-13473.23synaptotagmin Ia [Source:ZFIN;Acc:ZDB-GENE-040718-... [more]
syt2a1.493e-12368.40synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
syt5a2.130e-12267.67synaptotagmin Va [Source:ZFIN;Acc:ZDB-GENE-040718-... [more]
syt5a2.369e-11966.79synaptotagmin Va [Source:ZFIN;Acc:ZDB-GENE-040718-... [more]
back to top
BLAST of Synaptotagmin-1 vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 5
Match NameE-valueIdentityDescription
syt53.040e-14970.74synaptotagmin V [Source:Xenbase;Acc:XB-GENE-991349... [more]
syt11.565e-13867.95synaptotagmin 1 [Source:Xenbase;Acc:XB-GENE-575262... [more]
syt22.559e-13371.38synaptotagmin II [Source:Xenbase;Acc:XB-GENE-98121... [more]
syt82.081e-10757.05synaptotagmin VIII [Source:Xenbase;Acc:XB-GENE-978... [more]
syt63.107e-8045.48synaptotagmin VI [Source:Xenbase;Acc:XB-GENE-95325... [more]
back to top
BLAST of Synaptotagmin-1 vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 5
Match NameE-valueIdentityDescription
Syt11.860e-13868.71synaptotagmin I [Source:MGI Symbol;Acc:MGI:99667][more]
Syt11.860e-13868.71synaptotagmin I [Source:MGI Symbol;Acc:MGI:99667][more]
Syt29.460e-13472.59synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666][more]
Syt29.460e-13472.59synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666][more]
Syt54.159e-12159.81synaptotagmin V [Source:MGI Symbol;Acc:MGI:1926368... [more]
back to top
BLAST of Synaptotagmin-1 vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P41823|SY65_APLCA1.652e-17579.87Synaptotagmin-1 OS=Aplysia californica GN=SYT1 PE=... [more]
sp|P21521|SY65_DROME5.881e-15370.98Synaptotagmin 1 OS=Drosophila melanogaster GN=Syt1... [more]
sp|P34693|SYT1_CAEEL6.844e-13971.29Synaptotagmin-1 OS=Caenorhabditis elegans GN=snt-1... [more]
sp|P46096|SYT1_MOUSE1.448e-13768.71Synaptotagmin-1 OS=Mus musculus GN=Syt1 PE=1 SV=1[more]
sp|P21707|SYT1_RAT1.631e-13768.71Synaptotagmin-1 OS=Rattus norvegicus GN=Syt1 PE=1 ... [more]
back to top
BLAST of Synaptotagmin-1 vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|Q9U8R6|Q9U8R6_DUGJA0.000e+095.95Djsyt protein OS=Dugesia japonica GN=Djsyt PE=2 SV... [more]
tr|R7U5Y9|R7U5Y9_CAPTE1.328e-17982.59Synaptotagmin 1 variant OS=Capitella teleta GN=Syt... [more]
tr|Q869G5|Q869G5_LYMST3.841e-17982.08Synaptotagmin I OS=Lymnaea stagnalis PE=2 SV=1[more]
tr|V4B4W6|V4B4W6_LOTGI1.287e-17880.50Synaptotagmin 1 variant OS=Lottia gigantea GN=Syt1... [more]
tr|A0A0B6ZLE5|A0A0B6ZLE5_9EUPU4.021e-17881.76Uncharacterized protein (Fragment) OS=Arion vulgar... [more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..16
score: 0.533
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..10
score: 0.46
NoneNo IPR availableCOILSCoilCoilcoord: 13..33
NoneNo IPR availableTMHMMTMhelixcoord: 11..30
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..22
score: 0.667
NoneNo IPR availableTMHMMTMhelixcoord: 54..73
NoneNo IPR availableTMHMMTMhelixcoord: 15..34
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
IPR000008C2 domainPRINTSPR00360C2DOMAINcoord: 168..180
score: 59.66
coord: 195..208
score: 57.48
coord: 219..227
score: 48.45
IPR000008C2 domainSMARTSM00239C2_3ccoord: 152..254
e-value: 6.0E-22
score: 88.9
coord: 285..399
e-value: 1.3E-23
score: 94.5
IPR000008C2 domainGENE3DG3DSA:2.60.40.150coord: 125..261
e-value: 1.2E-44
score: 151.2
coord: 262..408
e-value: 2.7E-46
score: 156.5
IPR000008C2 domainPFAMPF00168C2coord: 284..388
e-value: 3.6E-23
score: 81.7
coord: 151..257
e-value: 3.4E-30
score: 104.3
IPR000008C2 domainPROSITEPS50004C2coord: 283..374
score: 20.698
IPR000008C2 domainPROSITEPS50004C2coord: 152..239
score: 20.298
IPR000008C2 domainSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 131..262
IPR000008C2 domainSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 270..405
IPR001565SynaptotagminPRINTSPR00399SYNAPTOTAGMNcoord: 140..155
score: 47.61
coord: 155..168
score: 48.53
coord: 230..240
score: 46.79
coord: 210..225
score: 36.58

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000008C2_dom
IPR001565Synaptotagmin
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0000149SNARE binding
GO:0005509calcium ion binding
GO:0005544calcium-dependent phospholipid binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0008021synaptic vesicle
GO:0016021integral component of membrane
GO:0030054cell junction
GO:0030285integral component of synaptic vesicle membrane
GO:0030672synaptic vesicle membrane
GO:0031410cytoplasmic vesicle
GO:0045202synapse
Vocabulary: biological process
TermDefinition
GO:0007269neurotransmitter secretion
GO:0016079synaptic vesicle exocytosis
GO:0045955negative regulation of calcium ion-dependent exocytosis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000465pharynx nerve plexus
PLANA:0000025nervous system
PLANA:0000058embryonic digestive system
PLANA:0000099neuron
PLANA:0000097ventral nerve cord
PLANA:0000023temporary embryonic pharynx
PLANA:0000044cephalic ganglia
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000003Stage 3
PLANA:0000006Stage 6
PLANA:0000005Stage 5
PLANA:0000007Stage 7
PLANA:0000004Stage 4
PLANA:0000008Stage 8
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022907 ID=SMED30022907|Name=Synaptotagmin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1814bp
ATTTATTGAAAATTATTTTTTCTATTATTAGGAGAAAATTGATTATTTTT
TTTTGACAAAATAAGTTTTGGATATATTTCCCATTTGTTTGTATTCGTAA
ACCAATGAAGAATTCGACTCACGGATCGGATCATTCGGCCAGCAAGGCCA
GTATGAAAACGAATGTGGAAAAATTTTGGCATGATCTCGGAAAAAAATTG
CACATGGATCCAAAAGCATTAATAGGAGTAACAATCGGTTTGGGAATATT
GTTTTTGTTGTTCCTTTATTGCTTATGTAAAAAATGTGTTTTCAAGCGTC
GAAAAAAGAAGGAAACGGCCAAAAAAGGAGCCAAGGGAGTAGTCGATATG
AAAAGTGCCCAATTGTTGGGGAATTCATATAAAGAAAAAATTCAACCCGA
TCTTGAAGAACTTGATGCAAACATGGAAGACAATGAAGGTGTAAAAGAAA
AAGAAGATGTTCATTTAGGAAAATTACAATATTCTCTAGATTATGATTTT
CAGAAAGGAGAATTAACTGTTGGAGTTATTCAAGCAACTGATCTTCCAGC
TATGGATATGTCAGGAACATCAGATCCATATGTCAAATTATACCTTCTCC
CAGACAAGAAAAAGAAATTCGAAACAAAGGTTCATAGGAAAATTTTAAAT
CCTGTATTCAATGAAACTTTTGTTTTCAAAGTTCCTTTCAATGAAGTTGC
ATCGAAGACTTTGATTTTCAACGTTTATGACTTTGACAGATTTTCCAAAC
ACGATCAAATCGGTCAAATAAAAGTACCATTGGGAGCTATAGATTTAGGT
CGAGTTATTGAAGAATGGAAGGAACTGGAATCTCCAGAAAACGATGGGGA
AAAGGAAAACAGGTTGGGAGACATTTGTTTCTCTTTAAGATACGTACCGA
CATCTGGAAAGCTTACAATAGTCATTTTGGAAGCAAAGAATCTTAAAAAA
ATGGATGTCGGAGGATTGTCTGATCCATATGTTAAACTTTCCTTGATGCT
TAATGGTAAACGAGTGAAGAAGAAGAAAACTACCATCAAAAAGTATACAC
TAAATCCTTACTACAATGAATCATTTTCCTTTGAAGTACCATTCGAACAA
ATACAAAAAGTGAACTTGATCGTCACGGTTGTTGATTATGACAGAATCGG
AACCAGCGAACCGATAGGTAGAATTGTTCTGGGATGTAACGCAACTGGAG
CAGAATTGCGACATTGGTCGGATATGTTGGCAAATCCCCGGCGACCAATC
GCCCAGTGGCATACCCTCCAAGAGATGCCAGAGAACAATTGATAGTGTTC
GTTTGATGCTTTAAAGCGGTTTGCATAATTCGTGAAATAAGTTATCAAAA
TTTGAGAAATGTTTTTTTTTCTGAAACAAAAATGGCATGAGACAATATAC
CAGAGTTCATTAGTGTGTGGTTTCGTTGAATATTTTGGTGGTGTTGCATC
TTATCGTTTGTCCTCTAATCTAATAATGTTTTATTCTTTATATAGCTGAT
TTATTCTCGAGCGAAACATTTTTTATGTGTACCAAAATACTTATGTCATA
GCCATTGTGATTAGTCTGTAAACTATTGCGTAATAGCCCCTCTCATTGGC
TTTTTTTAAGAGTAGTGAGTTGGAAAAAAAAATACAAAAATGACTTCAAT
TGTTAAACATTACTCATATTTTATCAGTAAGTTAACTTGCATATTTGCAG
TTAATTATGGCATTTTATCTCTAAATCTCTGAAGCATGGCCTCAAGTCTT
TTGTTTGTTTTAATGTAATTATGTCTAGATGAGAATATTAAAATACTTCG
GTTTATATAAAAGA
back to top

protein sequence of SMED30022907-orf-1

>SMED30022907-orf-1 ID=SMED30022907-orf-1|Name=SMED30022907-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=396bp
MKNSTHGSDHSASKASMKTNVEKFWHDLGKKLHMDPKALIGVTIGLGILF
LLFLYCLCKKCVFKRRKKKETAKKGAKGVVDMKSAQLLGNSYKEKIQPDL
EELDANMEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAM
DMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVAS
KTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEK
ENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLN
GKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGT
SEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPENN*
back to top
Aliases
The feature 'Synaptotagmin-1' has the following synonyms
Synonym
Dj-syt