tRNA N6-adenosine threonylcarbamoyltransferase

Overview
NametRNA N6-adenosine threonylcarbamoyltransferase
Smed IDSMED30022891
Length (bp)1817
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of tRNA N6-adenosine threonylcarbamoyltransferase (SMED30022891) t-SNE clustered cells

Violin plots show distribution of expression levels for tRNA N6-adenosine threonylcarbamoyltransferase (SMED30022891) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of tRNA N6-adenosine threonylcarbamoyltransferase (SMED30022891) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for tRNA N6-adenosine threonylcarbamoyltransferase (SMED30022891) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022891

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30022891h1SMcG0008691 SmedASXL_001466SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30022891h1SMcG0008691 SmedASXL_001466SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30022891h1SMcG0008691 dd_Smed_v4_3150_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022891h1SMcG0008691 dd_Smed_v4_3150_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022891h1SMcG0008691 Contig39018uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022891h1SMcG0008691 Contig39018newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Human
Match: OSGEP (O-sialoglycoprotein endopeptidase [Source:HGNC Symbol;Acc:HGNC:18028])

HSP 1 Score: 261.151 bits (666), Expect = 1.436e-81
Identity = 125/181 (69.06%), Postives = 143/181 (79.01%), Query Frame = 3
Query: 1269 VVVTNFDSRFARVIKLSNDPSPGYNIEVMARNGKKLAELPYIVKGMDVSFSGILTHLEEKVEEWTKSGEFNQADLCFSLQETMFAMLVEITERAMAHCNSNEVLIVGGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSGQFTTLEDSWITQSFRTDEVFVGWRN 1811
            + V N   RFARV+K+SNDPSPGYNIE MA+ GKKL ELPY VKGMDVSFSGIL+ +E+       +GE    DLCFSLQET+FAMLVEITERAMAHC S E LIVGGVGCN+RLQEMMA M +ERGA L+ATD RFCIDNGAMIA AG +MF++G  T L DS +TQ +RTDEV V WR+
Sbjct:  155 IAVGNCLDRFARVLKISNDPSPGYNIEQMAKRGKKLVELPYTVKGMDVSFSGILSFIEDVAHRMLATGECTPEDLCFSLQETVFAMLVEITERAMAHCGSQEALIVGGVGCNVRLQEMMATMCQERGARLFATDERFCIDNGAMIAQAGWEMFRAGHRTPLSDSGVTQRYRTDEVEVTWRD 335          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Human
Match: OSGEPL1 (O-sialoglycoprotein endopeptidase like 1 [Source:HGNC Symbol;Acc:HGNC:23075])

HSP 1 Score: 53.5286 bits (127), Expect = 7.692e-7
Identity = 49/173 (28.32%), Postives = 77/173 (44.51%), Query Frame = 3
Query: 1293 RFARVIKLSNDP-----SPGYNIEVMARNGKKLA---ELP-YIVKGMDVSFSGILTHLEEKVEEWTKSGEF--------NQADLCFSLQETMFAMLVEITERAMAHC-------NSNEVLIV-GGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSG 1736
            + AR + L   P     S G  IE +A+ G +     + P +  K  D SF+G L H+ +K+    +  E         + AD+  ++Q TM   LV+ T RA+  C        +N VL+  GGV  N  ++  +  +       L     R C DNG MIA  G++  ++G
Sbjct:  203 KVARRLSLIKHPECSTMSGGKAIEHLAKQGNRFHFDIKPPLHHAKNCDFSFTG-LQHVTDKIIMKKEKEEGIEKGQILSSAADIAATVQHTMACHLVKRTHRAILFCKQRDLLPQNNAVLVASGGVASNFYIRRALEILTNATQCTLLCPPPRLCTDNGIMIAWNGIERLRAG 374          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Human
Match: OSGEPL1 (O-sialoglycoprotein endopeptidase like 1 [Source:HGNC Symbol;Acc:HGNC:23075])

HSP 1 Score: 53.5286 bits (127), Expect = 7.692e-7
Identity = 49/173 (28.32%), Postives = 77/173 (44.51%), Query Frame = 3
Query: 1293 RFARVIKLSNDP-----SPGYNIEVMARNGKKLA---ELP-YIVKGMDVSFSGILTHLEEKVEEWTKSGEF--------NQADLCFSLQETMFAMLVEITERAMAHC-------NSNEVLIV-GGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSG 1736
            + AR + L   P     S G  IE +A+ G +     + P +  K  D SF+G L H+ +K+    +  E         + AD+  ++Q TM   LV+ T RA+  C        +N VL+  GGV  N  ++  +  +       L     R C DNG MIA  G++  ++G
Sbjct:  203 KVARRLSLIKHPECSTMSGGKAIEHLAKQGNRFHFDIKPPLHHAKNCDFSFTG-LQHVTDKIIMKKEKEEGIEKGQILSSAADIAATVQHTMACHLVKRTHRAILFCKQRDLLPQNNAVLVASGGVASNFYIRRALEILTNATQCTLLCPPPRLCTDNGIMIAWNGIERLRAG 374          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Celegans
Match: Y71H2AM.1 (Probable tRNA N6-adenosine threonylcarbamoyltransferase [Source:UniProtKB/TrEMBL;Acc:Q9BL28])

HSP 1 Score: 242.276 bits (617), Expect = 1.155e-74
Identity = 118/181 (65.19%), Postives = 138/181 (76.24%), Query Frame = 3
Query: 1269 VVVTNFDSRFARVIKLSNDPSPGYNIEVMARNGKKLAELPYIVKGMDVSFSGILTHLEEKVEEWTKSGEFNQADLCFSLQETMFAMLVEITERAMAHCNSNEVLIVGGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSGQFTTLEDSWITQSFRTDEVFVGWRN 1811
            + V N   RFARV+KL N PSPGYNIE +A+NGKKL ELPY VKGMDVS SGIL+ +E+K  +  +SG+F   DLCFSLQET+FAML+EITERAMAH +S E+LIVGGVGCNLRLQEM + M  ERGA L+ATD RFCIDNGAMIA AG  M  SG    L  +  TQ +RTD+V V WR+
Sbjct:  157 IAVGNCLDRFARVLKLPNAPSPGYNIEQLAKNGKKLMELPYSVKGMDVSLSGILSLIEKKAPKLIESGDFTPEDLCFSLQETVFAMLIEITERAMAHTSSKELLIVGGVGCNLRLQEMASAMCAERGAHLFATDERFCIDNGAMIARAGELMLASGMRFDLRKTTTTQRYRTDQVHVEWRD 337          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Fly
Match: Tcs3 (gene:FBgn0283681 transcript:FBtr0075381)

HSP 1 Score: 249.98 bits (637), Expect = 2.125e-77
Identity = 119/193 (61.66%), Postives = 146/193 (75.65%), Query Frame = 3
Query: 1269 VVVTNFDSRFARVIKLSNDPSPGYNIEVMARNGKKLAELPYIVKGMDVSFSGILTHLEEKVEEWTKSGE-----------FNQADLCFSLQETMFAMLVEITERAMAHCNSNEVLIVGGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSGQFTTLEDSWITQSFRTDEVFVGWRND 1814
            + V N   RFAR+IKLSNDPSPGYNIE +A++  +  +LPY+VKGMDVSFSGIL+++E+  E   +  +           ++QADLC+SLQET+FAMLVEITERAMAHC SNEVLIVGGVGCN RLQEMM  M +ERG  L+ATD R+CIDNG MIA AG +MF+SG     E+S++TQ FRTDEV V WR+D
Sbjct:  155 IAVGNCLDRFARIIKLSNDPSPGYNIEQLAKSSNRYIKLPYVVKGMDVSFSGILSYIEDLAEPGKRQNKRKKPQEEEVNNYSQADLCYSLQETIFAMLVEITERAMAHCGSNEVLIVGGVGCNERLQEMMRIMCEERGGKLFATDERYCIDNGLMIAHAGAEMFRSGTRMPFEESYVTQRFRTDEVLVSWRDD 347          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Zebrafish
Match: osgep (O-sialoglycoprotein endopeptidase [Source:NCBI gene;Acc:550447])

HSP 1 Score: 261.536 bits (667), Expect = 6.635e-82
Identity = 125/181 (69.06%), Postives = 142/181 (78.45%), Query Frame = 3
Query: 1269 VVVTNFDSRFARVIKLSNDPSPGYNIEVMARNGKKLAELPYIVKGMDVSFSGILTHLEEKVEEWTKSGEFNQADLCFSLQETMFAMLVEITERAMAHCNSNEVLIVGGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSGQFTTLEDSWITQSFRTDEVFVGWRN 1811
            + V N   RFARVIK+SNDPSPGYNIE MA+ G K  ELPY VKGMDVSFSGIL+++E+   +   + +    DLCFSLQET+FAMLVEITERAMAHC S EVLIVGGVGCNLRLQEMM  M KERGA ++ATD  FCIDNGAMIA AG +MF+SG  T L DSWITQ +RTDEV V WR+
Sbjct:  155 IAVGNCLDRFARVIKISNDPSPGYNIEQMAKKGNKYIELPYTVKGMDVSFSGILSYIEDAAHKMLSTDQCTPEDLCFSLQETVFAMLVEITERAMAHCGSQEVLIVGGVGCNLRLQEMMGVMCKERGARIFATDESFCIDNGAMIAQAGWEMFRSGHVTELPDSWITQRYRTDEVEVTWRD 335          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Zebrafish
Match: osgep (O-sialoglycoprotein endopeptidase [Source:NCBI gene;Acc:550447])

HSP 1 Score: 261.536 bits (667), Expect = 6.635e-82
Identity = 125/181 (69.06%), Postives = 142/181 (78.45%), Query Frame = 3
Query: 1269 VVVTNFDSRFARVIKLSNDPSPGYNIEVMARNGKKLAELPYIVKGMDVSFSGILTHLEEKVEEWTKSGEFNQADLCFSLQETMFAMLVEITERAMAHCNSNEVLIVGGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSGQFTTLEDSWITQSFRTDEVFVGWRN 1811
            + V N   RFARVIK+SNDPSPGYNIE MA+ G K  ELPY VKGMDVSFSGIL+++E+   +   + +    DLCFSLQET+FAMLVEITERAMAHC S EVLIVGGVGCNLRLQEMM  M KERGA ++ATD  FCIDNGAMIA AG +MF+SG  T L DSWITQ +RTDEV V WR+
Sbjct:  155 IAVGNCLDRFARVIKISNDPSPGYNIEQMAKKGNKYIELPYTVKGMDVSFSGILSYIEDAAHKMLSTDQCTPEDLCFSLQETVFAMLVEITERAMAHCGSQEVLIVGGVGCNLRLQEMMGVMCKERGARIFATDESFCIDNGAMIAQAGWEMFRSGHVTELPDSWITQRYRTDEVEVTWRD 335          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Zebrafish
Match: osgepl1 (O-sialoglycoprotein endopeptidase-like 1 [Source:NCBI gene;Acc:368635])

HSP 1 Score: 65.4698 bits (158), Expect = 6.578e-11
Identity = 56/191 (29.32%), Postives = 91/191 (47.64%), Query Frame = 3
Query: 1245 LIKQSLQAVVVTNFDSRFARVIKLSNDP-----SPGYNIEVMARNGKKLAELPYIVKGM------DVSFSGILTHL-----EEKVEEWTKSGEFNQA--DLCFSLQETMFAMLVEITERAMAHCNS-------NEVLIV-GGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSGQ 1739
            L+ Q+L        D + AR + L N P     S G  IE +A+ G +LA   + +  M      + SF+G+ T +     +++ EE  ++G+F     D+  + Q T+ + L + T RA+  C S       N  LIV GGV  N  +++++  +    G  L     +FC DNG MIA  G++  K G+
Sbjct:  176 LLGQTLDEAAGDTLD-KIARRLSLRNHPECGTLSGGQAIERLAKEGDRLAF--HFISPMGQNYDCNFSFAGLRTQITGAINKKEKEEGVEAGQFLSCVKDIAAASQHTVASHLAKRTHRAILFCKSKGLLPEQNPTLIVSGGVASNEYIRQILKIITDATGLHLLCPPSKFCTDNGVMIAWNGIERLKQGK 363          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Xenopus
Match: tekt2 (tektin 2 (testicular) [Source:Xenbase;Acc:XB-GENE-1003897])

HSP 1 Score: 270.781 bits (691), Expect = 3.052e-85
Identity = 129/192 (67.19%), Postives = 152/192 (79.17%), Query Frame = 3
Query: 1236 CQELIKQSLQAVVVTNFDSRFARVIKLSNDPSPGYNIEVMARNGKKLAELPYIVKGMDVSFSGILTHLEEKVEEWTKSGEFNQADLCFSLQETMFAMLVEITERAMAHCNSNEVLIVGGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSGQFTTLEDSWITQSFRTDEVFVGWRN 1811
            C  +  +++  + V N   RFARV+K+SNDPSPGYNIE MA+ GKK  ELPY VKGMDVSFSGIL+++E+   +   SGE    DLCFSLQET+F+MLVEITERAMAHC S EVLIVGGVGCN+RLQEMM  M +ERGA L+ATD RFCIDNGAMIA AG +MF+SGQ T L+DSWITQ +RTDEV V WR+
Sbjct:  145 CYRIFGETID-IAVGNCLDRFARVLKISNDPSPGYNIEQMAKKGKKFVELPYTVKGMDVSFSGILSYIEDMSHKMLSSGECTPEDLCFSLQETLFSMLVEITERAMAHCGSQEVLIVGGVGCNVRLQEMMGVMCQERGAKLFATDERFCIDNGAMIAQAGWEMFRSGQVTNLQDSWITQRYRTDEVEVTWRD 335          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Xenopus
Match: tekt2 (tektin 2 (testicular) [Source:Xenbase;Acc:XB-GENE-1003897])

HSP 1 Score: 270.781 bits (691), Expect = 3.796e-85
Identity = 129/192 (67.19%), Postives = 152/192 (79.17%), Query Frame = 3
Query: 1236 CQELIKQSLQAVVVTNFDSRFARVIKLSNDPSPGYNIEVMARNGKKLAELPYIVKGMDVSFSGILTHLEEKVEEWTKSGEFNQADLCFSLQETMFAMLVEITERAMAHCNSNEVLIVGGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSGQFTTLEDSWITQSFRTDEVFVGWRN 1811
            C  +  +++  + V N   RFARV+K+SNDPSPGYNIE MA+ GKK  ELPY VKGMDVSFSGIL+++E+   +   SGE    DLCFSLQET+F+MLVEITERAMAHC S EVLIVGGVGCN+RLQEMM  M +ERGA L+ATD RFCIDNGAMIA AG +MF+SGQ T L+DSWITQ +RTDEV V WR+
Sbjct:  153 CYRIFGETID-IAVGNCLDRFARVLKISNDPSPGYNIEQMAKKGKKFVELPYTVKGMDVSFSGILSYIEDMSHKMLSSGECTPEDLCFSLQETLFSMLVEITERAMAHCGSQEVLIVGGVGCNVRLQEMMGVMCQERGAKLFATDERFCIDNGAMIAQAGWEMFRSGQVTNLQDSWITQRYRTDEVEVTWRD 343          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Xenopus
Match: tekt2 (tektin 2 (testicular) [Source:Xenbase;Acc:XB-GENE-1003897])

HSP 1 Score: 256.529 bits (654), Expect = 3.456e-80
Identity = 120/167 (71.86%), Postives = 138/167 (82.63%), Query Frame = 3
Query: 1311 KLSNDPSPGYNIEVMARNGKKLAELPYIVKGMDVSFSGILTHLEEKVEEWTKSGEFNQADLCFSLQETMFAMLVEITERAMAHCNSNEVLIVGGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSGQFTTLEDSWITQSFRTDEVFVGWRN 1811
            ++SNDPSPGYNIE MA+ GKK  ELPY VKGMDVSFSGIL+++E+   +   SGE    DLCFSLQET+F+MLVEITERAMAHC S EVLIVGGVGCN+RLQEMM  M +ERGA L+ATD RFCIDNGAMIA AG +MF+SGQ T L+DSWITQ +RTDEV V WR+
Sbjct:  137 QISNDPSPGYNIEQMAKKGKKFVELPYTVKGMDVSFSGILSYIEDMSHKMLSSGECTPEDLCFSLQETLFSMLVEITERAMAHCGSQEVLIVGGVGCNVRLQEMMGVMCQERGAKLFATDERFCIDNGAMIAQAGWEMFRSGQVTNLQDSWITQRYRTDEVEVTWRD 303          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Xenopus
Match: tekt2 (tektin 2 (testicular) [Source:Xenbase;Acc:XB-GENE-1003897])

HSP 1 Score: 255.373 bits (651), Expect = 2.235e-79
Identity = 127/192 (66.15%), Postives = 148/192 (77.08%), Query Frame = 3
Query: 1236 CQELIKQSLQAVVVTNFDSRFARVIKLSNDPSPGYNIEVMARNGKKLAELPYIVKGMDVSFSGILTHLEEKVEEWTKSGEFNQADLCFSLQETMFAMLVEITERAMAHCNSNEVLIVGGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSGQFTTLEDSWITQSFRTDEVFVGWRN 1811
            C  +  +++  + V N   RFARV+K+SNDPSPGYNIE MA+ GKK  ELPY VKGMDVSFSGIL+++E  V    K G  N AD CF   ET+F+MLVEITERAMAHC S EVLIVGGVGCN+RLQEMM  M +ERGA L+ATD RFCIDNGAMIA AG +MF+SGQ T L+DSWITQ +RTDEV V WR+
Sbjct:  145 CYRIFGETID-IAVGNCLDRFARVLKISNDPSPGYNIEQMAKKGKKFVELPYTVKGMDVSFSGILSYIEVGVR---KMGSPNTADKCF---ETLFSMLVEITERAMAHCGSQEVLIVGGVGCNVRLQEMMGVMCQERGAKLFATDERFCIDNGAMIAQAGWEMFRSGQVTNLQDSWITQRYRTDEVEVTWRD 329          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Xenopus
Match: tekt2 (tektin 2 (testicular) [Source:Xenbase;Acc:XB-GENE-1003897])

HSP 1 Score: 236.498 bits (602), Expect = 1.921e-72
Identity = 118/192 (61.46%), Postives = 139/192 (72.40%), Query Frame = 3
Query: 1236 CQELIKQSLQAVVVTNFDSRFARVIKLSNDPSPGYNIEVMARNGKKLAELPYIVKGMDVSFSGILTHLEEKVEEWTKSGEFNQADLCFSLQETMFAMLVEITERAMAHCNSNEVLIVGGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSGQFTTLEDSWITQSFRTDEVFVGWRN 1811
            C  +  +++  + V N   RFARV+K+SNDPSPGYNIE MA+ GKK  ELPY VKGMDVSFSGIL+++E                       T+F+MLVEITERAMAHC S EVLIVGGVGCN+RLQEMM  M +ERGA L+ATD RFCIDNGAMIA AG +MF+SGQ T L+DSWITQ +RTDEV V WR+
Sbjct:  145 CYRIFGETID-IAVGNCLDRFARVLKISNDPSPGYNIEQMAKKGKKFVELPYTVKGMDVSFSGILSYIEVG---------------------TLFSMLVEITERAMAHCGSQEVLIVGGVGCNVRLQEMMGVMCQERGAKLFATDERFCIDNGAMIAQAGWEMFRSGQVTNLQDSWITQRYRTDEVEVTWRD 314          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Mouse
Match: Osgep (O-sialoglycoprotein endopeptidase [Source:MGI Symbol;Acc:MGI:1913496])

HSP 1 Score: 261.536 bits (667), Expect = 6.154e-83
Identity = 125/181 (69.06%), Postives = 144/181 (79.56%), Query Frame = 3
Query: 1269 VVVTNFDSRFARVIKLSNDPSPGYNIEVMARNGKKLAELPYIVKGMDVSFSGILTHLEEKVEEWTKSGEFNQADLCFSLQETMFAMLVEITERAMAHCNSNEVLIVGGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSGQFTTLEDSWITQSFRTDEVFVGWRN 1811
            + V N   RFARV+K+SNDPSPGYNIE MA+ GKKL ELPY VKGMDVSFSGIL+ +E+  +    +GE    DLCFSLQET+FAMLVEITERAMAHC S E LIVGGVGCNLRLQEMM  M +ERGA L+ATD RFC+DNGAMIA AG +MF++G  T L+DS ITQ +RTDEV V WR+
Sbjct:   74 IAVGNCLDRFARVLKISNDPSPGYNIEQMAKRGKKLVELPYTVKGMDVSFSGILSFIEDAAQRMLATGECTPEDLCFSLQETVFAMLVEITERAMAHCGSKEALIVGGVGCNLRLQEMMGTMCQERGAQLFATDERFCVDNGAMIAQAGWEMFQAGHRTPLKDSAITQRYRTDEVEVTWRD 254          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Mouse
Match: Osgep (O-sialoglycoprotein endopeptidase [Source:MGI Symbol;Acc:MGI:1913496])

HSP 1 Score: 262.307 bits (669), Expect = 4.204e-82
Identity = 125/181 (69.06%), Postives = 144/181 (79.56%), Query Frame = 3
Query: 1269 VVVTNFDSRFARVIKLSNDPSPGYNIEVMARNGKKLAELPYIVKGMDVSFSGILTHLEEKVEEWTKSGEFNQADLCFSLQETMFAMLVEITERAMAHCNSNEVLIVGGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSGQFTTLEDSWITQSFRTDEVFVGWRN 1811
            + V N   RFARV+K+SNDPSPGYNIE MA+ GKKL ELPY VKGMDVSFSGIL+ +E+  +    +GE    DLCFSLQET+FAMLVEITERAMAHC S E LIVGGVGCNLRLQEMM  M +ERGA L+ATD RFC+DNGAMIA AG +MF++G  T L+DS ITQ +RTDEV V WR+
Sbjct:  155 IAVGNCLDRFARVLKISNDPSPGYNIEQMAKRGKKLVELPYTVKGMDVSFSGILSFIEDAAQRMLATGECTPEDLCFSLQETVFAMLVEITERAMAHCGSKEALIVGGVGCNLRLQEMMGTMCQERGAQLFATDERFCVDNGAMIAQAGWEMFQAGHRTPLKDSAITQRYRTDEVEVTWRD 335          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Mouse
Match: Osgep (O-sialoglycoprotein endopeptidase [Source:MGI Symbol;Acc:MGI:1913496])

HSP 1 Score: 262.307 bits (669), Expect = 4.204e-82
Identity = 125/181 (69.06%), Postives = 144/181 (79.56%), Query Frame = 3
Query: 1269 VVVTNFDSRFARVIKLSNDPSPGYNIEVMARNGKKLAELPYIVKGMDVSFSGILTHLEEKVEEWTKSGEFNQADLCFSLQETMFAMLVEITERAMAHCNSNEVLIVGGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSGQFTTLEDSWITQSFRTDEVFVGWRN 1811
            + V N   RFARV+K+SNDPSPGYNIE MA+ GKKL ELPY VKGMDVSFSGIL+ +E+  +    +GE    DLCFSLQET+FAMLVEITERAMAHC S E LIVGGVGCNLRLQEMM  M +ERGA L+ATD RFC+DNGAMIA AG +MF++G  T L+DS ITQ +RTDEV V WR+
Sbjct:  155 IAVGNCLDRFARVLKISNDPSPGYNIEQMAKRGKKLVELPYTVKGMDVSFSGILSFIEDAAQRMLATGECTPEDLCFSLQETVFAMLVEITERAMAHCGSKEALIVGGVGCNLRLQEMMGTMCQERGAQLFATDERFCVDNGAMIAQAGWEMFQAGHRTPLKDSAITQRYRTDEVEVTWRD 335          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Mouse
Match: Osgep (O-sialoglycoprotein endopeptidase [Source:MGI Symbol;Acc:MGI:1913496])

HSP 1 Score: 114.005 bits (284), Expect = 4.790e-29
Identity = 53/83 (63.86%), Postives = 63/83 (75.90%), Query Frame = 3
Query: 1269 VVVTNFDSRFARVIKLSNDPSPGYNIEVMARNGKKLAELPYIVKGMDVSFSGILTHLEEKVEEWTKSGEFNQADLCFSLQETM 1517
            + V N   RFARV+K+SNDPSPGYNIE MA+ GKKL ELPY VKGMDVSFSGIL+ +E+  +    +GE    DLCFSLQET+
Sbjct:   74 IAVGNCLDRFARVLKISNDPSPGYNIEQMAKRGKKLVELPYTVKGMDVSFSGILSFIEDAAQRMLATGECTPEDLCFSLQETV 156          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Mouse
Match: Osgepl1 (O-sialoglycoprotein endopeptidase-like 1 [Source:MGI Symbol;Acc:MGI:1919335])

HSP 1 Score: 57.7658 bits (138), Expect = 2.270e-8
Identity = 51/173 (29.48%), Postives = 81/173 (46.82%), Query Frame = 3
Query: 1293 RFARVIKLSNDP-----SPGYNIEVMARNGKKLAEL--PYI--VKGMDVSFSGILTHLEEKV------EEWTKSGEF--NQADLCFSLQETMFAMLVEITERAMAHCN-------SNEVLIV-GGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSG 1736
            + AR + L   P     S G  IE +A++G +      P +   K  D SF+G L H+ +K+      EE  + G+   + AD+  ++Q      L + T RA+  C        +N VL+V GGV  NL +++ +  +A      L     R C DNG MIA  G++  ++G
Sbjct:  203 KVARRLSLIKHPECSTMSGGKAIEQLAKDGNRFHFTINPPMQNAKNCDFSFTG-LQHITDKLITHKEKEEGIEKGQILSSAADIAAAVQHATACHLAKRTHRAILFCKQKNLLSPANAVLVVSGGVASNLYIRKALEIVANATQCTLLCPPPRLCTDNGIMIAWNGIERLRAG 374          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. UniProt/SwissProt
Match: sp|Q7SYR1|OSGEP_XENLA (Probable tRNA N6-adenosine threonylcarbamoyltransferase OS=Xenopus laevis OX=8355 GN=osgep PE=2 SV=1)

HSP 1 Score: 268.085 bits (684), Expect = 1.586e-83
Identity = 127/192 (66.15%), Postives = 152/192 (79.17%), Query Frame = 3
Query: 1236 CQELIKQSLQAVVVTNFDSRFARVIKLSNDPSPGYNIEVMARNGKKLAELPYIVKGMDVSFSGILTHLEEKVEEWTKSGEFNQADLCFSLQETMFAMLVEITERAMAHCNSNEVLIVGGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSGQFTTLEDSWITQSFRTDEVFVGWRN 1811
            C  +  +++  + V N   RFARV+K+SNDPSPGYNIE MA+ GKK  ELPY VKGMDVSFSGIL+++E+   +   SGE    DLCFSLQET+F+MLVEITERAMAHC S EVLIVGGVGCN+RLQEMM  M +ERGA ++ATD RFCIDNGAMIA AG +MF++GQ T L+DSWITQ +RTDEV V WR+
Sbjct:  145 CYRIFGETID-IAVGNCLDRFARVLKISNDPSPGYNIEQMAKKGKKFVELPYTVKGMDVSFSGILSYIEDMSHKMLSSGECTPEDLCFSLQETLFSMLVEITERAMAHCGSQEVLIVGGVGCNVRLQEMMGVMCEERGAKIFATDERFCIDNGAMIAQAGWEMFRAGQVTNLQDSWITQRYRTDEVEVTWRD 335          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. UniProt/SwissProt
Match: sp|Q9WVS2|OSGEP_RAT (Probable tRNA N6-adenosine threonylcarbamoyltransferase OS=Rattus norvegicus OX=10116 GN=Osgep PE=2 SV=2)

HSP 1 Score: 263.462 bits (672), Expect = 8.824e-82
Identity = 126/181 (69.61%), Postives = 145/181 (80.11%), Query Frame = 3
Query: 1269 VVVTNFDSRFARVIKLSNDPSPGYNIEVMARNGKKLAELPYIVKGMDVSFSGILTHLEEKVEEWTKSGEFNQADLCFSLQETMFAMLVEITERAMAHCNSNEVLIVGGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSGQFTTLEDSWITQSFRTDEVFVGWRN 1811
            + V N   RFARV+K+SNDPSPGYNIE MA+ GKKL ELPY VKGMDVSFSGIL+ +E+  +    +GE    DLCFSLQET+FAMLVEITERAMAHC S E LIVGGVGCN+RLQEMMA M +ERGA L+ATD RFCIDNGAMIA AG +MF++G  T L+DS ITQ +RTDEV V WR+
Sbjct:  155 IAVGNCLDRFARVLKISNDPSPGYNIEQMAKRGKKLVELPYTVKGMDVSFSGILSFIEDAAQRMLATGECTPEDLCFSLQETVFAMLVEITERAMAHCGSKEALIVGGVGCNVRLQEMMATMCQERGAQLFATDERFCIDNGAMIAQAGWEMFQAGHRTPLQDSGITQRYRTDEVEVTWRD 335          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. UniProt/SwissProt
Match: sp|Q8BWU5|OSGEP_MOUSE (Probable tRNA N6-adenosine threonylcarbamoyltransferase OS=Mus musculus OX=10090 GN=Osgep PE=1 SV=2)

HSP 1 Score: 262.307 bits (669), Expect = 2.972e-81
Identity = 125/181 (69.06%), Postives = 144/181 (79.56%), Query Frame = 3
Query: 1269 VVVTNFDSRFARVIKLSNDPSPGYNIEVMARNGKKLAELPYIVKGMDVSFSGILTHLEEKVEEWTKSGEFNQADLCFSLQETMFAMLVEITERAMAHCNSNEVLIVGGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSGQFTTLEDSWITQSFRTDEVFVGWRN 1811
            + V N   RFARV+K+SNDPSPGYNIE MA+ GKKL ELPY VKGMDVSFSGIL+ +E+  +    +GE    DLCFSLQET+FAMLVEITERAMAHC S E LIVGGVGCNLRLQEMM  M +ERGA L+ATD RFC+DNGAMIA AG +MF++G  T L+DS ITQ +RTDEV V WR+
Sbjct:  155 IAVGNCLDRFARVLKISNDPSPGYNIEQMAKRGKKLVELPYTVKGMDVSFSGILSFIEDAAQRMLATGECTPEDLCFSLQETVFAMLVEITERAMAHCGSKEALIVGGVGCNLRLQEMMGTMCQERGAQLFATDERFCVDNGAMIAQAGWEMFQAGHRTPLKDSAITQRYRTDEVEVTWRD 335          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. UniProt/SwissProt
Match: sp|Q5RHZ6|OSGEP_DANRE (Probable tRNA N6-adenosine threonylcarbamoyltransferase OS=Danio rerio OX=7955 GN=osgep PE=2 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 5.009e-81
Identity = 125/181 (69.06%), Postives = 142/181 (78.45%), Query Frame = 3
Query: 1269 VVVTNFDSRFARVIKLSNDPSPGYNIEVMARNGKKLAELPYIVKGMDVSFSGILTHLEEKVEEWTKSGEFNQADLCFSLQETMFAMLVEITERAMAHCNSNEVLIVGGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSGQFTTLEDSWITQSFRTDEVFVGWRN 1811
            + V N   RFARVIK+SNDPSPGYNIE MA+ G K  ELPY VKGMDVSFSGIL+++E+   +   + +    DLCFSLQET+FAMLVEITERAMAHC S EVLIVGGVGCNLRLQEMM  M KERGA ++ATD  FCIDNGAMIA AG +MF+SG  T L DSWITQ +RTDEV V WR+
Sbjct:  155 IAVGNCLDRFARVIKISNDPSPGYNIEQMAKKGNKYIELPYTVKGMDVSFSGILSYIEDAAHKMLSTDQCTPEDLCFSLQETVFAMLVEITERAMAHCGSQEVLIVGGVGCNLRLQEMMGVMCKERGARIFATDESFCIDNGAMIAQAGWEMFRSGHVTELPDSWITQRYRTDEVEVTWRD 335          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. UniProt/SwissProt
Match: sp|Q9NPF4|OSGEP_HUMAN (Probable tRNA N6-adenosine threonylcarbamoyltransferase OS=Homo sapiens OX=9606 GN=OSGEP PE=1 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 6.894e-81
Identity = 125/181 (69.06%), Postives = 143/181 (79.01%), Query Frame = 3
Query: 1269 VVVTNFDSRFARVIKLSNDPSPGYNIEVMARNGKKLAELPYIVKGMDVSFSGILTHLEEKVEEWTKSGEFNQADLCFSLQETMFAMLVEITERAMAHCNSNEVLIVGGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSGQFTTLEDSWITQSFRTDEVFVGWRN 1811
            + V N   RFARV+K+SNDPSPGYNIE MA+ GKKL ELPY VKGMDVSFSGIL+ +E+       +GE    DLCFSLQET+FAMLVEITERAMAHC S E LIVGGVGCN+RLQEMMA M +ERGA L+ATD RFCIDNGAMIA AG +MF++G  T L DS +TQ +RTDEV V WR+
Sbjct:  155 IAVGNCLDRFARVLKISNDPSPGYNIEQMAKRGKKLVELPYTVKGMDVSFSGILSFIEDVAHRMLATGECTPEDLCFSLQETVFAMLVEITERAMAHCGSQEALIVGGVGCNVRLQEMMATMCQERGARLFATDERFCIDNGAMIAQAGWEMFRAGHRTPLSDSGVTQRYRTDEVEVTWRD 335          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. TrEMBL
Match: A0A3Q0FQG4 (probable tRNA N6-adenosine threonylcarbamoyltransferase OS=Alligator sinensis OX=38654 GN=OSGEP PE=4 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 7.538e-87
Identity = 134/181 (74.03%), Postives = 149/181 (82.32%), Query Frame = 3
Query: 1269 VVVTNFDSRFARVIKLSNDPSPGYNIEVMARNGKKLAELPYIVKGMDVSFSGILTHLEEKVEEWTKSGEFNQADLCFSLQETMFAMLVEITERAMAHCNSNEVLIVGGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSGQFTTLEDSWITQSFRTDEVFVGWRN 1811
            + V N   RFARV+K+SNDPSPGYNIE MA+ G+KL ELPY VKGMDVSFSGIL+H+EE   +   SGE    DLCFSLQET+FAMLVEITERAMAHC S EVLIVGGVGCNLRLQEMM  M +ERGA L+ATD RFCIDNGAMIA AG +MF+SGQ TTLEDSWITQ +RTDEV V WR+
Sbjct:   28 IAVGNCLDRFARVLKISNDPSPGYNIEQMAKKGQKLVELPYTVKGMDVSFSGILSHIEEVSHKMLASGECTPEDLCFSLQETVFAMLVEITERAMAHCGSQEVLIVGGVGCNLRLQEMMGIMCEERGAKLFATDERFCIDNGAMIAQAGWEMFRSGQVTTLEDSWITQRYRTDEVEVTWRD 208          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. TrEMBL
Match: A0A151M3U7 (Putative tRNA N6-adenosine threonylcarbamoyltransferase OS=Alligator mississippiensis OX=8496 GN=OSGEP PE=4 SV=1)

HSP 1 Score: 278.1 bits (710), Expect = 5.709e-86
Identity = 134/181 (74.03%), Postives = 149/181 (82.32%), Query Frame = 3
Query: 1269 VVVTNFDSRFARVIKLSNDPSPGYNIEVMARNGKKLAELPYIVKGMDVSFSGILTHLEEKVEEWTKSGEFNQADLCFSLQETMFAMLVEITERAMAHCNSNEVLIVGGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSGQFTTLEDSWITQSFRTDEVFVGWRN 1811
            + V N   RFARV+K+SNDPSPGYNIE MA+ G+KL ELPY VKGMDVSFSGIL+H+EE   +   SGE    DLCFSLQET+FAMLVEITERAMAHC S EVLIVGGVGCNLRLQEMM  M +ERGA L+ATD RFCIDNGAMIA AG +MF+SGQ TTLEDSWITQ +RTDEV V WR+
Sbjct:   74 IAVGNCLDRFARVLKISNDPSPGYNIEQMAKKGQKLVELPYTVKGMDVSFSGILSHIEEVSHKMLASGECTPEDLCFSLQETVFAMLVEITERAMAHCGSQEVLIVGGVGCNLRLQEMMGIMCEERGAKLFATDERFCIDNGAMIAQAGWEMFRSGQVTTLEDSWITQRYRTDEVEVTWRD 254          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. TrEMBL
Match: A0A0L8HEB3 (Probable tRNA N6-adenosine threonylcarbamoyltransferase OS=Octopus bimaculoides OX=37653 GN=OCBIM_22016853mg PE=3 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 8.914e-86
Identity = 130/181 (71.82%), Postives = 152/181 (83.98%), Query Frame = 3
Query: 1269 VVVTNFDSRFARVIKLSNDPSPGYNIEVMARNGKKLAELPYIVKGMDVSFSGILTHLEEKVEEWTKSGEFNQADLCFSLQETMFAMLVEITERAMAHCNSNEVLIVGGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSGQFTTLEDSWITQSFRTDEVFVGWRN 1811
            + V N   RFARV+KLSNDPSPGYNIE +A+ GKKLAELPY VKGMDVSFSG+L+++EEK  +W K+G++   DLCFSLQET+FAMLVEITERAMAHCNSNEVLIVGGVGCN  LQ+MM +MA+ERGA L+ATD RFCIDNGAMIA AGL M+K+G  T L+D+  TQ +RTDEV V WRN
Sbjct:  155 IAVGNCLDRFARVLKLSNDPSPGYNIEQLAKKGKKLAELPYTVKGMDVSFSGLLSYIEEKAPQWLKNGDYTPEDLCFSLQETVFAMLVEITERAMAHCNSNEVLIVGGVGCNEHLQKMMGQMAEERGAKLFATDERFCIDNGAMIAYAGLLMYKNGYTTPLKDTGCTQRYRTDEVLVTWRN 335          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. TrEMBL
Match: A0A1S3JUE1 (Probable tRNA N6-adenosine threonylcarbamoyltransferase OS=Lingula unguis OX=7574 GN=LOC106176207 PE=3 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 1.237e-84
Identity = 131/180 (72.78%), Postives = 150/180 (83.33%), Query Frame = 3
Query: 1269 VVVTNFDSRFARVIKLSNDPSPGYNIEVMARNGKKLAELPYIVKGMDVSFSGILTHLEEKVEEWTKSGEFNQADLCFSLQETMFAMLVEITERAMAHCNSNEVLIVGGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSGQFTTLEDSWITQSFRTDEVFVGWR 1808
            + V N   RFARV+KLSNDPSPGYNIE MA+ G K  ELPY VKGMDVSFSG+L+++EE+V +  K GE++  DLCFSLQET+FAMLVEITERAMAHC S EVLIVGGVGCN RLQEMM +MA+ERGA L+ATDMRFCIDNGAMIA AG +MFKSGQ T LE++W TQ +RTDEV V WR
Sbjct:  155 IAVGNCLDRFARVLKLSNDPSPGYNIEQMAKKGTKYFELPYTVKGMDVSFSGLLSYIEERVPQILKKGEYSPEDLCFSLQETVFAMLVEITERAMAHCGSQEVLIVGGVGCNERLQEMMGKMAEERGATLFATDMRFCIDNGAMIAQAGWEMFKSGQITPLEETWCTQRYRTDEVEVTWR 334          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. TrEMBL
Match: A0A452HZA2 (Probable tRNA N6-adenosine threonylcarbamoyltransferase OS=Gopherus agassizii OX=38772 GN=OSGEP PE=3 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 3.442e-83
Identity = 130/181 (71.82%), Postives = 146/181 (80.66%), Query Frame = 3
Query: 1269 VVVTNFDSRFARVIKLSNDPSPGYNIEVMARNGKKLAELPYIVKGMDVSFSGILTHLEEKVEEWTKSGEFNQADLCFSLQETMFAMLVEITERAMAHCNSNEVLIVGGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSGQFTTLEDSWITQSFRTDEVFVGWRN 1811
            + V N   RFARV+K+SNDPSPGYNIE MA+ G+KL ELPY VKGMDVSFSGIL+H+EE   +   SGE    DLCFSLQET+FAMLVEITERAMAHC S E LIVGGVGCN+RLQEMM  M  ERGA L+ATD RFCIDNGAMIA AG +MF++GQ T LEDSWITQ +RTDEV V WR+
Sbjct:  147 IAVGNCLDRFARVLKISNDPSPGYNIEQMAKKGQKLVELPYTVKGMDVSFSGILSHIEEVAHKMLASGECTPEDLCFSLQETLFAMLVEITERAMAHCGSQEALIVGGVGCNMRLQEMMRIMCAERGAKLFATDERFCIDNGAMIAQAGWEMFRTGQVTQLEDSWITQRYRTDEVEVTWRD 327          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Cavefish
Match: osgep (O-sialoglycoprotein endopeptidase [Source:NCBI gene;Acc:550447])

HSP 1 Score: 226.483 bits (576), Expect = 9.622e-69
Identity = 114/180 (63.33%), Postives = 131/180 (72.78%), Query Frame = 3
Query: 1269 VVVTNFDSRFARVIKLSNDPSPGYNIEVMARNGKKLAELPYIVKGMDVSFSGILTHLEEKVEEWTKSGEFNQADLCFSLQETMFAMLVEITERAMAHCNSNEVLIVGGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSGQFTTLEDSWITQSFRTDEVFVGWR 1808
            + V N   RFARVIK+SNDPSPGYNIE MA+ GK+  ELPY VKGMDVSFSGIL+ +EE   +   SG+    DLCFSLQET+F+MLVEITERAMA      + + GG  CNLRLQEMM  M +ERGA L+ATD RFCIDNGAMIA AG +MF+ GQ T L DSWITQ +RT      WR
Sbjct:  155 IAVGNCLDRFARVIKISNDPSPGYNIEQMAKKGKQYVELPYTVKGMDVSFSGILSFIEEAAHKMLSSGQCTAEDLCFSLQETLFSMLVEITERAMA-----SLWLSGGPDCNLRLQEMMGVMCEERGARLFATDERFCIDNGAMIAQAGWEMFRVGQITELPDSWITQRYRTT-----WR 324          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Cavefish
Match: osgepl1 (O-sialoglycoprotein endopeptidase like 1 [Source:NCBI gene;Acc:103026550])

HSP 1 Score: 51.6026 bits (122), Expect = 1.729e-6
Identity = 50/190 (26.32%), Postives = 86/190 (45.26%), Query Frame = 3
Query: 1245 LIKQSLQAVVVTNFDSRFARVIKLSNDP-----SPGYNIEVMARNGKKLA---ELPYIVKGMDVSFS--GILTH-----LEEKVEEWTKSGEFNQA--DLCFSLQETMFAMLVEITERAMAHC--------NSNEVLIVGGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSGQ 1739
            L+ Q+L        D + AR + L   P     S G  IE++A+ G +     + P + K  D +FS  G+        ++++ EE  + G+      D+  + Q T+ +   + T RA+  C        NS  +++ GGV  N  ++E++  +    G  L     +FC DNG MIA  G++  K G+
Sbjct:  183 LLGQTLDEAPGDTLD-KIARRLSLIKHPKCSSLSGGQAIELLAKEGDRQQFQFKTP-MGKQYDCNFSYAGLRNQVTMAIIKKEKEEGIQQGQLLSCVEDIAAATQHTVASHTAKRTHRAILFCKAKGLLPENSPTLVVSGGVASNQYIREVLRVVTDATGLQLLCPPSKFCTDNGVMIAWNGVERLKEGK 370          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Sea Lamprey
Match: osgep (O-sialoglycoprotein endopeptidase [Source:NCBI gene;Acc:550447])

HSP 1 Score: 257.299 bits (656), Expect = 5.326e-81
Identity = 126/181 (69.61%), Postives = 143/181 (79.01%), Query Frame = 3
Query: 1269 VVVTNFDSRFARVIKLSNDPSPGYNIEVMARNGKKLAELPYIVKGMDVSFSGILTHLEEKVEEWTKSGEFNQADLCFSLQETMFAMLVEITERAMAHCNSNEVLIVGGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSGQFTTLEDSWITQSFRTDEVFVGWRN 1811
            + V N   RFARV+K+SNDPSPGYNIE MA+ G    ELPY VKGMDVSFSGIL+++EE  +    SGE    DLCFSLQET+FAMLVEITERAMAHC   EVLIVGGVGCNLRLQEMM  M KERGA L+ATD RFCIDNGAMIA AG +MF+SG  T ++DSWITQ FRTD++ V WR+
Sbjct:  155 IAVGNCLDRFARVLKISNDPSPGYNIEQMAKRGS-FVELPYTVKGMDVSFSGILSYIEEAAQRMLASGECTAEDLCFSLQETVFAMLVEITERAMAHCGVREVLIVGGVGCNLRLQEMMEVMCKERGAKLFATDERFCIDNGAMIAQAGWEMFRSGLTTEIKDSWITQRFRTDDMEVTWRD 334          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Sea Lamprey
Match: osgepl1 (O-sialoglycoprotein endopeptidase-like 1 [Source:NCBI gene;Acc:368635])

HSP 1 Score: 49.2914 bits (116), Expect = 1.783e-6
Identity = 46/174 (26.44%), Postives = 82/174 (47.13%), Query Frame = 3
Query: 1284 FDSRFARVIKLSNDP-----SPGYNIEVMARNGKKLA---ELPY-IVKGMDVSFSGILTHL-----EEKVEEWTKSGEFNQ--ADLCFSLQETMFAMLVEITERAMAHC-------NSNEVLIV-GGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKS 1733
            FD + AR + L N       S G  +E ++++G ++A   + P    +  + SFSG+ T +     ++++EE  K G+  +  + +  + Q T+ A + + T RAM  C         N  L+V GGV  N  ++E +  +A   G  +       C DNG MI   G++  ++
Sbjct:  174 FD-KVARRLSLHNISELSAMSGGQAVEHISKDGNRMAFHFKHPLEKYRDCNFSFSGLRTQVSQTIKQKELEEGIKEGQVLECASSIAAATQYTVAAHIAKRTHRAMVFCLQNSLIPTDNPTLVVSGGVASNSVIKEALGHVATAVGFTVICPPPHLCTDNGIMIGWNGVERLRA 346          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Yeast
Match: KAE1 (Highly conserved ATPase of HSP70/DnaK family; essential functional component of the EKC/KEOPS complex, with Bud32p, Cgi121p, Pcc1p, and Gon7p; EKC/KEOPS complex is required for t6A tRNA modification and telomeric TG1-3 recombination; may have role in transcription [Source:SGD;Acc:S000001746])

HSP 1 Score: 202.986 bits (515), Expect = 5.396e-60
Identity = 104/200 (52.00%), Postives = 134/200 (67.00%), Query Frame = 3
Query: 1269 VVVTNFDSRFARVIKLSNDPSPGYNIEVMARNG---KKLAELPYIVKGMDVSFSGILTHLEEKVEEWTKSGEFNQ--------------ADLCFSLQETMFAMLVEITERAMAHCNSNEVLIVGGVGCNLRLQEMMAEMAKERG-AILYATDMRFCIDNGAMIAVAGLQMFKSGQFTT-LEDSWITQSFRTDEVFVGWRN 1811
            + + N   RFAR +K+ N+PSPGYNIE +A+     + L ELPY VKGMD+S SGIL  ++   ++  K  + N+               DLC+SLQE +FAMLVEITERAMAH NSN+VLIVGGVGCN+RLQEMMA+M K+R    ++ATD RFCIDNG MIA AGL  ++ G       ++ +TQ FRTDEV+  WR+
Sbjct:  187 IAIGNCLDRFARTLKIPNEPSPGYNIEQLAKKAPHKENLVELPYTVKGMDLSMSGILASIDLLAKDLFKGNKKNKILFDKTTGEQKVTVEDLCYSLQENLFAMLVEITERAMAHVNSNQVLIVGGVGCNVRLQEMMAQMCKDRANGQVHATDNRFCIDNGVMIAQAGLLEYRMGGIVKDFSETVVTQKFRTDEVYAAWRD 386          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Nematostella
Match: OSGEP (Probable tRNA N6-adenosine threonylcarbamoyltransferase [Source:UniProtKB/Swiss-Prot;Acc:A7SXZ6])

HSP 1 Score: 259.61 bits (662), Expect = 1.152e-81
Identity = 129/181 (71.27%), Postives = 142/181 (78.45%), Query Frame = 3
Query: 1269 VVVTNFDSRFARVIKLSNDPSPGYNIEVMARNGKKLAELPYIVKGMDVSFSGILTHLEEKVEEWTKSGEFNQADLCFSLQETMFAMLVEITERAMAHCNSNEVLIVGGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSGQFTTLEDSWITQSFRTDEVFVGWRN 1811
            + V N   RFARV+KLSNDPSPGYNIE MA+ GKKL ELPY VKGMDVSFSGIL+++E    +   S E    DLCFSLQET+FAMLVE TERAMAHC SNEVLIVGGVGCN RLQEMM  MAKERGA LYATD RFCIDNGAMIA AG +MF++G  T LE +  TQ FRTDEV V WR+
Sbjct:  155 IAVGNCLDRFARVLKLSNDPSPGYNIEQMAKKGKKLIELPYTVKGMDVSFSGILSYIECMAHKLLSSEECTPEDLCFSLQETVFAMLVETTERAMAHCGSNEVLIVGGVGCNKRLQEMMDVMAKERGAKLYATDERFCIDNGAMIAQAGWEMFQTGSVTPLEQTTCTQRFRTDEVEVTWRD 335          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Nematostella
Match: EDO26875 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAU2])

HSP 1 Score: 73.9442 bits (180), Expect = 1.635e-14
Identity = 61/183 (33.33%), Postives = 90/183 (49.18%), Query Frame = 3
Query: 1230 ICCQELIKQSLQAVVVTNFDSRFARVIKLSNDPSPGYNIEVMARNGKKLA-ELPYIV---KGMDVSFSGILTHLEEKVEEWTKSGEFN---QADLCFSLQETMFAMLVEITERAMAHCNSNEVLIVGGVGCNLRLQEMMAEMA-KERGAILYATDMRFCIDNGAMIAVAGLQMFKSGQFTTLE 1754
            I   EL+ +SL       FD + A+++ L  D   G  I  +A  G +     P  +    G+D SFSG+ T     V E T  G  +   +AD+  + +E +   LV    RA+      +++I GGV  N  L+E +  M  KER  + YA + RFC DNGAMIA AG Q   +G+ + L+
Sbjct:  105 IGAYELLGESLDDAAGEAFD-KAAKMLGL--DYPGGPLIAKLAMQGDRTRFRFPRPMTDRPGLDFSFSGLKTFTLNTVYEHTVDGSVDAQTKADIAAAFEEAVVDTLVIKCRRAIQQTGLKQLVIAGGVSANQCLREKLGAMVEKERAGLFYARN-RFCTDNGAMIAYAGCQRLLAGEASDLK 283          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Medaka
Match: osgep (O-sialoglycoprotein endopeptidase [Source:NCBI gene;Acc:101172120])

HSP 1 Score: 266.544 bits (680), Expect = 5.871e-85
Identity = 127/181 (70.17%), Postives = 146/181 (80.66%), Query Frame = 3
Query: 1269 VVVTNFDSRFARVIKLSNDPSPGYNIEVMARNGKKLAELPYIVKGMDVSFSGILTHLEEKVEEWTKSGEFNQADLCFSLQETMFAMLVEITERAMAHCNSNEVLIVGGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSGQFTTLEDSWITQSFRTDEVFVGWRN 1811
            + V N   RFARVIK+SNDPSPGYNIE +A+ GK+  ELPY VKGMDVSFSGIL+++EE   +   + +    DLCFSLQET+FAMLVEITERAMAHC S EVLIVGGVGCNLRLQEMM  M +ERGA L+AT+ RFCIDNGAMIA AG +MF+SGQ T LEDSWITQ +RTDEV V WR+
Sbjct:   74 IAVGNCLDRFARVIKISNDPSPGYNIEQLAKRGKRYVELPYTVKGMDVSFSGILSYIEEAANKMLSADQCTPEDLCFSLQETVFAMLVEITERAMAHCGSQEVLIVGGVGCNLRLQEMMGVMCQERGAKLFATNERFCIDNGAMIAQAGWEMFRSGQVTQLEDSWITQRYRTDEVEVTWRD 254          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Medaka
Match: osgepl1 (O-sialoglycoprotein endopeptidase like 1 [Source:NCBI gene;Acc:101160772])

HSP 1 Score: 56.6102 bits (135), Expect = 3.831e-8
Identity = 49/176 (27.84%), Postives = 81/176 (46.02%), Query Frame = 3
Query: 1293 RFARVIKLSNDP-----SPGYNIEVMARNGKKLAELPYIVKGMDV-----SFSGILTHL---------EEKVEEWTKSGEFNQADLCFSLQETMFAMLVEITERAMAHC-------NSNEVLIV-GGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSGQ 1739
            + AR + L+  P     S G  IE++AR+G +  + P+      +     SF+G+ + +         EE +E+ T     N  D+    Q T+   L + T RA+  C       + N +L+V GGV  N  + + +  + ++ G  L     RFC DNG MIA  G++  K G+
Sbjct:  198 KVARRLSLTKHPDCSTLSGGQAIELLARSGDR-RKFPFRTPMGRIYDCCFSFAGLRSQITMSIIKKEAEEGIEQGTLLSCVN--DIAAGTQHTVAVHLAKRTHRAILFCKENGLLPSDNPILVVSGGVASNQYICKALTVITEKTGLRLLCPPPRFCTDNGVMIAWNGIERLKEGR 370          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Medaka
Match: osgepl1 (O-sialoglycoprotein endopeptidase like 1 [Source:NCBI gene;Acc:101160772])

HSP 1 Score: 56.225 bits (134), Expect = 4.482e-8
Identity = 49/176 (27.84%), Postives = 81/176 (46.02%), Query Frame = 3
Query: 1293 RFARVIKLSNDP-----SPGYNIEVMARNGKKLAELPYIVKGMDV-----SFSGILTHL---------EEKVEEWTKSGEFNQADLCFSLQETMFAMLVEITERAMAHC-------NSNEVLIV-GGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSGQ 1739
            + AR + L+  P     S G  IE++AR+G +  + P+      +     SF+G+ + +         EE +E+ T     N  D+    Q T+   L + T RA+  C       + N +L+V GGV  N  + + +  + ++ G  L     RFC DNG MIA  G++  K G+
Sbjct:  153 KVARRLSLTKHPDCSTLSGGQAIELLARSGDR-RKFPFRTPMGRIYDCCFSFAGLRSQITMSIIKKEAEEGIEQGTLLSCVN--DIAAGTQHTVAVHLAKRTHRAILFCKENGLLPSDNPILVVSGGVASNQYICKALTVITEKTGLRLLCPPPRFCTDNGVMIAWNGIERLKEGR 325          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Planmine SMEST
Match: SMESG000003633.1 (SMESG000003633.1)

HSP 1 Score: 367.851 bits (943), Expect = 3.055e-123
Identity = 175/182 (96.15%), Postives = 177/182 (97.25%), Query Frame = 3
Query: 1269 VVVTNFDSRFARVIKLSNDPSPGYNIEVMARNGKKLAELPYIVKGMDVSFSGILTHLEEKVEEWTKSGEFNQADLCFSLQETMFAMLVEITERAMAHCNSNEVLIVGGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSGQFTTLEDSWITQSFRTDEVFVGWRND 1814
            + + N   RFARVIKLSNDPSPGYNIEVMARNGKKLAELPYIVKGMDVSFSGILTHLEEKVEEWTKSGEFNQADLCFSLQETMFAMLVEITERAMAHCNSNEVLIVGGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSGQFTTLEDSWITQSFRTDEVFVGWRND
Sbjct:  155 IAIGNCLDRFARVIKLSNDPSPGYNIEVMARNGKKLAELPYIVKGMDVSFSGILTHLEEKVEEWTKSGEFNQADLCFSLQETMFAMLVEITERAMAHCNSNEVLIVGGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFKSGQFTTLEDSWITQSFRTDEVFVGWRND 336          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Planmine SMEST
Match: SMESG000043109.1 (SMESG000043109.1)

HSP 1 Score: 55.4546 bits (132), Expect = 7.486e-8
Identity = 40/143 (27.97%), Postives = 67/143 (46.85%), Query Frame = 3
Query: 1335 GYNIEVMAR-NGKKLAELPYIV---KGMDVSFSGILTHLEEKVEEWTKSGE-FNQADLCFSLQETMFAMLVEITERAMAHCN------SNEVLIVGGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFK 1730
            G +IE+ A  N   L   P      K  D SFSG+   +   +E   ++G   N   LC S+  +M   +    +RAM +C+       N +++ GGV  N  L+     +  +    L   D+++C DNGAM+A  G ++++
Sbjct:  212 GRSIEIFAEENTDDLIAFPNFRSQEKDCDFSFSGLEGSVFAHLESCRENGSVLNVPKLCASVLYSMAFQMCRRLQRAMMYCHRYMQPPPNILVVSGGVASNNFLRASFQRVCDQFDYQLVCPDIKYCTDNGAMVAWNGFELYR 354          
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Planmine SMEST
Match: SMESG000043109.1 (SMESG000043109.1)

HSP 1 Score: 55.0694 bits (131), Expect = 8.199e-8
Identity = 40/143 (27.97%), Postives = 67/143 (46.85%), Query Frame = 3
Query: 1335 GYNIEVMAR-NGKKLAELPYIV---KGMDVSFSGILTHLEEKVEEWTKSGE-FNQADLCFSLQETMFAMLVEITERAMAHCN------SNEVLIVGGVGCNLRLQEMMAEMAKERGAILYATDMRFCIDNGAMIAVAGLQMFK 1730
            G +IE+ A  N   L   P      K  D SFSG+   +   +E   ++G   N   LC S+  +M   +    +RAM +C+       N +++ GGV  N  L+     +  +    L   D+++C DNGAM+A  G ++++
Sbjct:  210 GRSIEIFAEENTDDLIAFPNFRSQEKDCDFSFSGLEGSVFAHLESCRENGSVLNVPKLCASVLYSMAFQMCRRLQRAMMYCHRYMQPPPNILVVSGGVASNNFLRASFQRVCDQFDYQLVCPDIKYCTDNGAMVAWNGFELYR 352          
The following BLAST results are available for this feature:
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
OSGEP1.436e-8169.06O-sialoglycoprotein endopeptidase [Source:HGNC Sym... [more]
OSGEPL17.692e-728.32O-sialoglycoprotein endopeptidase like 1 [Source:H... [more]
OSGEPL17.692e-728.32O-sialoglycoprotein endopeptidase like 1 [Source:H... [more]
back to top
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Y71H2AM.11.155e-7465.19Probable tRNA N6-adenosine threonylcarbamoyltransf... [more]
back to top
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Tcs32.125e-7761.66gene:FBgn0283681 transcript:FBtr0075381[more]
back to top
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
osgep6.635e-8269.06O-sialoglycoprotein endopeptidase [Source:NCBI gen... [more]
osgep6.635e-8269.06O-sialoglycoprotein endopeptidase [Source:NCBI gen... [more]
osgepl16.578e-1129.32O-sialoglycoprotein endopeptidase-like 1 [Source:N... [more]
back to top
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tekt23.052e-8567.19tektin 2 (testicular) [Source:Xenbase;Acc:XB-GENE-... [more]
tekt23.796e-8567.19tektin 2 (testicular) [Source:Xenbase;Acc:XB-GENE-... [more]
tekt23.456e-8071.86tektin 2 (testicular) [Source:Xenbase;Acc:XB-GENE-... [more]
tekt22.235e-7966.15tektin 2 (testicular) [Source:Xenbase;Acc:XB-GENE-... [more]
tekt21.921e-7261.46tektin 2 (testicular) [Source:Xenbase;Acc:XB-GENE-... [more]
back to top
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Osgep6.154e-8369.06O-sialoglycoprotein endopeptidase [Source:MGI Symb... [more]
Osgep4.204e-8269.06O-sialoglycoprotein endopeptidase [Source:MGI Symb... [more]
Osgep4.204e-8269.06O-sialoglycoprotein endopeptidase [Source:MGI Symb... [more]
Osgep4.790e-2963.86O-sialoglycoprotein endopeptidase [Source:MGI Symb... [more]
Osgepl12.270e-829.48O-sialoglycoprotein endopeptidase-like 1 [Source:M... [more]
back to top
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7SYR1|OSGEP_XENLA1.586e-8366.15Probable tRNA N6-adenosine threonylcarbamoyltransf... [more]
sp|Q9WVS2|OSGEP_RAT8.824e-8269.61Probable tRNA N6-adenosine threonylcarbamoyltransf... [more]
sp|Q8BWU5|OSGEP_MOUSE2.972e-8169.06Probable tRNA N6-adenosine threonylcarbamoyltransf... [more]
sp|Q5RHZ6|OSGEP_DANRE5.009e-8169.06Probable tRNA N6-adenosine threonylcarbamoyltransf... [more]
sp|Q9NPF4|OSGEP_HUMAN6.894e-8169.06Probable tRNA N6-adenosine threonylcarbamoyltransf... [more]
back to top
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0FQG47.538e-8774.03probable tRNA N6-adenosine threonylcarbamoyltransf... [more]
A0A151M3U75.709e-8674.03Putative tRNA N6-adenosine threonylcarbamoyltransf... [more]
A0A0L8HEB38.914e-8671.82Probable tRNA N6-adenosine threonylcarbamoyltransf... [more]
A0A1S3JUE11.237e-8472.78Probable tRNA N6-adenosine threonylcarbamoyltransf... [more]
A0A452HZA23.442e-8371.82Probable tRNA N6-adenosine threonylcarbamoyltransf... [more]
back to top
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
osgep9.622e-6963.33O-sialoglycoprotein endopeptidase [Source:NCBI gen... [more]
osgepl11.729e-626.32O-sialoglycoprotein endopeptidase like 1 [Source:N... [more]
back to top
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
osgep5.326e-8169.61O-sialoglycoprotein endopeptidase [Source:NCBI gen... [more]
osgepl11.783e-626.44O-sialoglycoprotein endopeptidase-like 1 [Source:N... [more]
back to top
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
KAE15.396e-6052.00Highly conserved ATPase of HSP70/DnaK family; esse... [more]
back to top
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
OSGEP1.152e-8171.27Probable tRNA N6-adenosine threonylcarbamoyltransf... [more]
EDO268751.635e-1433.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
osgep5.871e-8570.17O-sialoglycoprotein endopeptidase [Source:NCBI gen... [more]
osgepl13.831e-827.84O-sialoglycoprotein endopeptidase like 1 [Source:N... [more]
osgepl14.482e-827.84O-sialoglycoprotein endopeptidase like 1 [Source:N... [more]
back to top
BLAST of tRNA N6-adenosine threonylcarbamoyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000003633.13.055e-12396.15SMESG000003633.1[more]
SMESG000043109.17.486e-827.97SMESG000043109.1[more]
SMESG000043109.18.199e-827.97SMESG000043109.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022891 ID=SMED30022891|Name=tRNA N6-adenosine threonylcarbamoyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1817bp
TGGAGCAATAAGTCATCGCGTGAAGAGGAATCTGATGAGACTTTTTTGCT
AATTGAAAACTTTTACCAATACCCCGCTTTAAGTTAGCTACATATAGTTT
CAACATTTAAAATTTTCCTAAAAATCAATAATTATTTTAAAAATATGAAA
TTGGTTACATTCGTTGAAATTTTTACAGATATGGGAACTTTATCGACCTC
AAAGACTATTTACAGATAAATTTTCTTGTTTTACAAGCTTATGTAAAATA
TCTCTTTATTGATTTCGGCCATTTTCAATCACCATCTTATTTTTTTATGA
TCTTAGAACATTCTAAAATCATTTTAAGAGCTTGAAATTTTTAAACGAAG
CAACTTGATGACTGAATTATGCATATTTTTGACTGAATATATTGATTTCA
TTTTTACGATTTTACTCATAAAACAAAAATATTTTCAATATTCATATATT
TCCAACCTATATTTTGAAGTGATACTTTTGCAGTATCTGTTTTCGTTAAA
AATTAATTCAGACATTTTTTCATCCTTAATCGTAATCAAAAATATTACTT
TTTACCTTTATACGAAGACCTAAAATTAGACAGCACCTACATGTCTAATT
AAATTAAAGTGTATTTAATTGATCATTGTGACTTCATGTATTTTGTTCGT
CTTTCGTGCGTGTTTCAAAGTTTATTTTCTAGTAGGTTGAATGGTTGGAT
TTCGCTTTTATTTTTTTAATTGTAACTTGAGTTGGTTTCGGTTACGCTCT
GAACCCGATCCGTTCCGACACTGTTAATATTATATCTATAAAAATCAAAA
AATCTTACTAAGCCGTATCTTACTAAGCTACGAATTTTAAAGCTCATCAT
ATATCAATTTCAAAATATAACTATAAGATTACCACATCCCATGGGAGGGA
TATTGCAAATTGTAACAGATTCTTTAATTATTATTTTGTAACATTCTAAA
AGCACGAAAAAATTATAATTTTTTCAAAAACGATTTCCGCAAAGGAAAAC
GTCGACTTGACAAAAAGAAATTCTGAAGATAAAAAAATGTTATTGCTAAG
TTTTGAGGTCGGAACTATAGAATTGCTAGGGGTTTTAGGCGAAAAAATTT
TTTTGCACCCCATTTGAAATTCTGGCCACGCCACTGGATACTTGTAAACA
TTAAGTCCACAAAAAGCCCCACTTTTCGACACTAAATCAAATGTTGTCAA
TCTGAAATGATATGAGAAAAGGTCCTTTAATTTGTTGTCAAGAGTTAATT
AAACAGTCACTTCAGGCAGTTGTTGTAACAAATTTCGATTCTAGGTTTGC
TCGGGTAATCAAACTGTCTAATGACCCGAGTCCAGGCTATAATATTGAAG
TAATGGCAAGAAATGGTAAGAAACTGGCCGAACTACCCTACATAGTCAAA
GGAATGGATGTATCGTTTTCGGGAATTTTGACACATTTAGAAGAGAAAGT
CGAAGAATGGACGAAATCAGGGGAGTTCAATCAAGCCGACCTTTGTTTCA
GTTTGCAAGAGACTATGTTTGCAATGTTGGTCGAGATTACCGAGAGAGCG
ATGGCACATTGTAACTCTAATGAGGTGCTGATTGTCGGAGGAGTCGGTTG
TAATTTGCGGCTCCAAGAAATGATGGCAGAAATGGCTAAAGAAAGAGGAG
CAATTTTGTACGCGACAGATATGCGGTTTTGCATCGATAACGGGGCCATG
ATTGCAGTTGCCGGGTTGCAGATGTTTAAAAGTGGTCAGTTTACCACTCT
AGAGGATTCTTGGATTACACAATCTTTTCGAACTGATGAAGTATTTGTTG
GATGGCGAAATGATTGA
back to top

protein sequence of SMED30022891-orf-1

>SMED30022891-orf-1 ID=SMED30022891-orf-1|Name=SMED30022891-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=202bp
MRKGPLICCQELIKQSLQAVVVTNFDSRFARVIKLSNDPSPGYNIEVMAR
NGKKLAELPYIVKGMDVSFSGILTHLEEKVEEWTKSGEFNQADLCFSLQE
TMFAMLVEITERAMAHCNSNEVLIVGGVGCNLRLQEMMAEMAKERGAILY
ATDMRFCIDNGAMIAVAGLQMFKSGQFTTLEDSWITQSFRTDEVFVGWRN
D*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0000408EKC/KEOPS complex
GO:0005634nucleus
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0002949tRNA threonylcarbamoyladenosine modification
GO:0008033tRNA processing
Vocabulary: molecular function
TermDefinition
GO:0016746transferase activity, transferring acyl groups
GO:0016747transferase activity, transferring acyl groups other than amino-acyl groups
GO:0046872metal ion binding
GO:0061711N(6)-L-threonylcarbamoyladenine synthase
GO:0016740transferase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR034680Kae1/OSGEP
IPR043129ATPase_NBD
IPR000905Gcp-like_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 10..152
e-value: 1.9E-31
score: 111.0
IPR000905Gcp-like domainPFAMPF00814Peptidase_M22coord: 12..165
e-value: 2.5E-34
score: 119.2
IPR000905Gcp-like domainPANTHERPTHR11735O-SIALOGLYCOPROTEIN ENDOPEPTIDASEcoord: 20..200
IPR034680tRNA N6-adenosine threonylcarbamoyltransferase Kae1/OSGEPPANTHERPTHR11735:SF14TRNA N6-ADENOSINE THREONYLCARBAMOYLTRANSFERASE-RELATEDcoord: 20..200
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 23..170