Septin

Overview
NameSeptin
Smed IDSMED30022889
Length (bp)1482
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Septin (SMED30022889) t-SNE clustered cells

Violin plots show distribution of expression levels for Septin (SMED30022889) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Septin (SMED30022889) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Septin (SMED30022889) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022889

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30022889SMESG000079489.1 SMESG000049701.1 dd_Smed_v4_2586_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30022889SMESG000079489.1 SMESG000049701.1 dd_Smed_v4_2586_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30022889SMESG000079489.1 SMESG000049701.1 dd_Smed_v4_2586_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022889SMESG000079489.1 SMESG000049701.1 dd_Smed_v4_2586_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022889SMESG000079489.1 SMESG000049701.1 dd_Smed_v4_2586_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Septin vs. Ensembl Human
Match: SEPTIN7 (septin 7 [Source:HGNC Symbol;Acc:HGNC:1717])

HSP 1 Score: 222.631 bits (566), Expect = 5.493e-67
Identity = 118/307 (38.44%), Postives = 180/307 (58.63%), Query Frame = 2
Query:  200 TGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRT-----QFPQNT----KTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQN 1093
             GF+ +  Q+YRKS   GF+F LM+VG SGLGKST +NSLF T     ++P  +    KT  V ++   + E  V+L L +++ P FGD ++NS  W+ + DY++  F   LN ES++NR       D+ V  CLYFI P      LK LD+EFMK +H KV++IP+IAKAD++T  E Q  K  ++ E+  H+I  ++F   ++             +E ++V+ + +R P AVVG    +  +  +V  R YPWG  EV+N +H D   +R +L+ TH+Q+L   +++V YEN+RSR L+ +  N
Sbjct:   11 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQ---MPDNRVQCCLYFIAPSGH--GLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDE------------EENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN 300          
BLAST of Septin vs. Ensembl Human
Match: SEPTIN7 (septin 7 [Source:HGNC Symbol;Acc:HGNC:1717])

HSP 1 Score: 222.631 bits (566), Expect = 9.043e-67
Identity = 118/307 (38.44%), Postives = 180/307 (58.63%), Query Frame = 2
Query:  200 TGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRT-----QFPQNT----KTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQN 1093
             GF+ +  Q+YRKS   GF+F LM+VG SGLGKST +NSLF T     ++P  +    KT  V ++   + E  V+L L +++ P FGD ++NS  W+ + DY++  F   LN ES++NR       D+ V  CLYFI P      LK LD+EFMK +H KV++IP+IAKAD++T  E Q  K  ++ E+  H+I  ++F   ++             +E ++V+ + +R P AVVG    +  +  +V  R YPWG  EV+N +H D   +R +L+ TH+Q+L   +++V YEN+RSR L+ +  N
Sbjct:   31 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQ---MPDNRVQCCLYFIAPSGH--GLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDE------------EENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN 320          
BLAST of Septin vs. Ensembl Human
Match: SEPTIN4 (septin 4 [Source:HGNC Symbol;Acc:HGNC:9165])

HSP 1 Score: 197.978 bits (502), Expect = 1.421e-58
Identity = 108/307 (35.18%), Postives = 170/307 (55.37%), Query Frame = 2
Query:  200 TGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQFPQNTKTSGVVENTYKLIE----------NDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQ 1090
             GF+ +  Q++RKS   GF F LM+ G SGLGKST +NSLF T   ++ K  G  E   + +E            V L L +++ P FGD +NN++ WK + +Y+++ F +    ES +NR + +   D+ VH CLYFI P      L+ LD+EFMK +H +V+++PI+AKAD++T  E+   K  +       EI +F  K+ +      + +   KLQ+    Q+L E  PFAV+G    +     +V  R YPWG +EV+N  H D   +R +L+ TH+Q+L   +    YEN+R++ +  + +
Sbjct:   26 VGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQ---DNRVHCCLYFISPFGHG--LRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDHKKRKIR-----EEIEHFGIKIYQFPDCDSDEDEDFKLQD----QALKESIPFAVIGSNTVVEARGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQSMTR 318          
BLAST of Septin vs. Ensembl Human
Match: SEPTIN4 (septin 4 [Source:HGNC Symbol;Acc:HGNC:9165])

HSP 1 Score: 198.749 bits (504), Expect = 3.249e-58
Identity = 108/306 (35.29%), Postives = 170/306 (55.56%), Query Frame = 2
Query:  203 GFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQFPQNTKTSGVVENTYKLIE----------NDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQ 1090
            GF+ +  Q++RKS   GF F LM+ G SGLGKST +NSLF T   ++ K  G  E   + +E            V L L +++ P FGD +NN++ WK + +Y+++ F +    ES +NR + +   D+ VH CLYFI P      L+ LD+EFMK +H +V+++PI+AKAD++T  E+   K  +       EI +F  K+ +      + +   KLQ+    Q+L E  PFAV+G    +     +V  R YPWG +EV+N  H D   +R +L+ TH+Q+L   +    YEN+R++ +  + +
Sbjct:   27 GFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQ---DNRVHCCLYFISPFGHG--LRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDHKKRKIR-----EEIEHFGIKIYQFPDCDSDEDEDFKLQD----QALKESIPFAVIGSNTVVEARGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQSMTR 318          
BLAST of Septin vs. Ensembl Human
Match: SEPTIN4 (septin 4 [Source:HGNC Symbol;Acc:HGNC:9165])

HSP 1 Score: 197.978 bits (502), Expect = 3.786e-57
Identity = 108/306 (35.29%), Postives = 170/306 (55.56%), Query Frame = 2
Query:  203 GFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQFPQNTKTSGVVENTYKLIE----------NDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQ 1090
            GF+ +  Q++RKS   GF F LM+ G SGLGKST +NSLF T   ++ K  G  E   + +E            V L L +++ P FGD +NN++ WK + +Y+++ F +    ES +NR + +   D+ VH CLYFI P      L+ LD+EFMK +H +V+++PI+AKAD++T  E+   K  +       EI +F  K+ +      + +   KLQ+    Q+L E  PFAV+G    +     +V  R YPWG +EV+N  H D   +R +L+ TH+Q+L   +    YEN+R++ +  + +
Sbjct:  107 GFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQ---DNRVHCCLYFISPFGHG--LRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDHKKRKIR-----EEIEHFGIKIYQFPDCDSDEDEDFKLQD----QALKESIPFAVIGSNTVVEARGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQSMTR 398          
BLAST of Septin vs. Ensembl Celegans
Match: unc-59 (pep chromosome:WBcel235:I:13629227:13633494:1 gene:WBGene00006793.1 transcript:W09C5.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-59)

HSP 1 Score: 220.705 bits (561), Expect = 3.570e-66
Identity = 133/377 (35.28%), Postives = 208/377 (55.17%), Query Frame = 2
Query:  203 GFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQFPQ-NTKTSG----------VVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKD--QVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQNLGIVTENQHHPSVYLEKYFKLLHVSLAKKINEMESGFKELV---HKRESALLNKAKDLEEQSEVMAD 1285
            GF+    Q++R++  NGF F LM+VG SGLGKSTF+N+LF  +    N K S           V E   KL+EN V L L L++ P FGD +NNSK W+ I +Y+E  F +Q   E++I+R   E   D  VH CLYFI+P      LK +D+E MK++H +V+++P+I+KAD +T  EL   K  ++ +    EI  +KF  LE+              +K  ++ L +  PFA++G   +M+ +KD  ++  R YPWG +EV+N+ H+D   +R +++ T+L ++I  + +V YEN R R +  L +N     E    P  +LE+  +     L +K N +E  F E      KR    ++  ++LE+Q++   D
Sbjct:   29 GFANFPNQVFRRAVKNGFDFTLMVVGRSGLGKSTFINTLFLAEINNLNEKESAPTHPHPSTVRVEEKLVKLVENSVSLNLTLVDTPGFGDAVNNSKCWEPIVNYVESKFFEQFCEETRIDR--GEKIVDKCVHLCLYFIEPSGH--GLKPIDIELMKHLHGRVNIVPVISKADCLTRDELLRFKKQIVKDAETAEIKLYKFPELEDP-----------YTDKVAIEKLRKALPFAIIGS--NMLKEKDGKKIRYREYPWGTVEVENMQHNDFLTLRDMIIRTNLIDMIDVTRNVHYENFRFRQMEGLPKN-----EKNRDPFTHLEEERRQKEQDLDEKRNTLEKVFTEKTSARKKRSDERMSALEELEQQNKQKID 383          
BLAST of Septin vs. Ensembl Celegans
Match: unc-61 (pep chromosome:WBcel235:V:14731095:14733877:-1 gene:WBGene00006795.1 transcript:Y50E8A.4b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-61)

HSP 1 Score: 169.088 bits (427), Expect = 1.013e-46
Identity = 108/300 (36.00%), Postives = 160/300 (53.33%), Query Frame = 2
Query:  203 GFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQF---PQN--TKTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQ-VLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSEL 1084
            GF  +  Q+ +K+   GFQFNLM VG +G GK+T + SLF  +    P N   KT  +   T  + E  + + L+L+E   FGD+++  KS K I DYLE  F   L  E K  R     + D  +HACLYFI P      LK LDL  ++ +  +V++IP+IAK+D+    EL   K+ +L+EL   +I+ + F   +E+         V    K M +S+    PFAVVG  + +  +  Q V  R YPWG +EV+N  H D   +R  LL T++ E+   +H  +YEN+R   L ++
Sbjct:   81 GFDSLPHQLVKKAVEAGFQFNLMCVGETGTGKTTLIESLFNMKLDFEPCNHELKTVELRTCTKDVAEGGIRVKLRLVETAGFGDQLDKDKSAKVIVDYLESQFETYLQEELKPRRMLQYFN-DSRIHACLYFISPTGH--GLKALDLVTLRELAKRVNVIPVIAKSDTTCKDELLRFKAKILSELKSQKIDIYTFPTDDET---------VSTTNKEMNKSV----PFAVVGSIDFVKKENGQMVRARQYPWGIVEVENESHCDFVKLREALLRTNVDEMRQRTHESLYENYRRDRLRQM 364          
BLAST of Septin vs. Ensembl Celegans
Match: unc-61 (pep chromosome:WBcel235:V:14731095:14733877:-1 gene:WBGene00006795.1 transcript:Y50E8A.4c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-61)

HSP 1 Score: 169.088 bits (427), Expect = 1.060e-46
Identity = 108/300 (36.00%), Postives = 160/300 (53.33%), Query Frame = 2
Query:  203 GFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQF---PQN--TKTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQ-VLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSEL 1084
            GF  +  Q+ +K+   GFQFNLM VG +G GK+T + SLF  +    P N   KT  +   T  + E  + + L+L+E   FGD+++  KS K I DYLE  F   L  E K  R     + D  +HACLYFI P      LK LDL  ++ +  +V++IP+IAK+D+    EL   K+ +L+EL   +I+ + F   +E+         V    K M +S+    PFAVVG  + +  +  Q V  R YPWG +EV+N  H D   +R  LL T++ E+   +H  +YEN+R   L ++
Sbjct:   81 GFDSLPHQLVKKAVEAGFQFNLMCVGETGTGKTTLIESLFNMKLDFEPCNHELKTVELRTCTKDVAEGGIRVKLRLVETAGFGDQLDKDKSAKVIVDYLESQFETYLQEELKPRRMLQYFN-DSRIHACLYFISPTGH--GLKALDLVTLRELAKRVNVIPVIAKSDTTCKDELLRFKAKILSELKSQKIDIYTFPTDDET---------VSTTNKEMNKSV----PFAVVGSIDFVKKENGQMVRARQYPWGIVEVENESHCDFVKLREALLRTNVDEMRQRTHESLYENYRRDRLRQM 364          
BLAST of Septin vs. Ensembl Celegans
Match: unc-61 (pep chromosome:WBcel235:V:14731136:14734237:-1 gene:WBGene00006795.1 transcript:Y50E8A.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-61)

HSP 1 Score: 168.703 bits (426), Expect = 4.666e-46
Identity = 108/300 (36.00%), Postives = 160/300 (53.33%), Query Frame = 2
Query:  203 GFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQF---PQN--TKTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQ-VLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSEL 1084
            GF  +  Q+ +K+   GFQFNLM VG +G GK+T + SLF  +    P N   KT  +   T  + E  + + L+L+E   FGD+++  KS K I DYLE  F   L  E K  R     + D  +HACLYFI P      LK LDL  ++ +  +V++IP+IAK+D+    EL   K+ +L+EL   +I+ + F   +E+         V    K M +S+    PFAVVG  + +  +  Q V  R YPWG +EV+N  H D   +R  LL T++ E+   +H  +YEN+R   L ++
Sbjct:  150 GFDSLPHQLVKKAVEAGFQFNLMCVGETGTGKTTLIESLFNMKLDFEPCNHELKTVELRTCTKDVAEGGIRVKLRLVETAGFGDQLDKDKSAKVIVDYLESQFETYLQEELKPRRMLQYFN-DSRIHACLYFISPTGH--GLKALDLVTLRELAKRVNVIPVIAKSDTTCKDELLRFKAKILSELKSQKIDIYTFPTDDET---------VSTTNKEMNKSV----PFAVVGSIDFVKKENGQMVRARQYPWGIVEVENESHCDFVKLREALLRTNVDEMRQRTHESLYENYRRDRLRQM 433          
BLAST of Septin vs. Ensembl Fly
Match: pnut (gene:FBgn0013726 transcript:FBtr0088792)

HSP 1 Score: 224.557 bits (571), Expect = 8.895e-67
Identity = 141/403 (34.99%), Postives = 215/403 (53.35%), Query Frame = 2
Query:  125 KESSKQNMNNLEKILMNYKLKPI---AATGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRT------QFP----QNTKTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKM-LEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQNLGIVTENQHHPSVYLEKYFKLLHVSLAKKINEMESGF----KELVHKRESALLNKAKDLEEQSEVM 1279
            +E   Q     +K  +  + KP+      GF+ +  Q+YRK+   GF+F LM+VG SGLGKST +NS+F +      Q+P    +  KT  V      L EN V LTL +++ P FGD ++NS  W  I +Y++  + + L  ES++ R +    +D  VH CLYFI P      L  LD+  M+++  KV+L+P+IAKAD+MT  E+ + K  +L E+  H+I  + F   LE++            +E +  Q+L  R PFAVVG    +  D  +V  R YPWG +EV+NL H D  A+R +++ THLQ+L   +++V YEN+R R LSEL    G    +  +P   +E+  +     + K   EME  F    KE + K   + L  A+  EE+ + +
Sbjct:   95 QEKEHQQAQKPQKPPLPVRQKPMEIAGYVGFANLPNQVYRKAVKRGFEFTLMVVGASGLGKSTLINSMFLSDIYNAEQYPGPSLRKKKTVAVEATKVMLKENGVNLTLTVVDTPGFGDAVDNSNCWVPILEYVDSKYEEYLTAESRVYRKT---ISDSRVHCCLYFIAPSGH--GLLPLDIACMQSLSDKVNLVPVIAKADTMTPDEVHLFKKQILNEIAQHKIKIYDFPATLEDAA-----------EEAKTTQNLRSRVPFAVVGANTIIEQDGKKVRGRRYPWGLVEVENLTHCDFIALRNMVIRTHLQDLKDVTNNVHYENYRCRKLSELGLVDGKARLSNKNPLTQMEEEKREHEQKMKKMEAEMEQVFDMKVKEKMQKLRDSELELARRHEERKKAL 481          
BLAST of Septin vs. Ensembl Fly
Match: pnut (gene:FBgn0013726 transcript:FBtr0088793)

HSP 1 Score: 224.557 bits (571), Expect = 8.895e-67
Identity = 141/403 (34.99%), Postives = 215/403 (53.35%), Query Frame = 2
Query:  125 KESSKQNMNNLEKILMNYKLKPI---AATGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRT------QFP----QNTKTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKM-LEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQNLGIVTENQHHPSVYLEKYFKLLHVSLAKKINEMESGF----KELVHKRESALLNKAKDLEEQSEVM 1279
            +E   Q     +K  +  + KP+      GF+ +  Q+YRK+   GF+F LM+VG SGLGKST +NS+F +      Q+P    +  KT  V      L EN V LTL +++ P FGD ++NS  W  I +Y++  + + L  ES++ R +    +D  VH CLYFI P      L  LD+  M+++  KV+L+P+IAKAD+MT  E+ + K  +L E+  H+I  + F   LE++            +E +  Q+L  R PFAVVG    +  D  +V  R YPWG +EV+NL H D  A+R +++ THLQ+L   +++V YEN+R R LSEL    G    +  +P   +E+  +     + K   EME  F    KE + K   + L  A+  EE+ + +
Sbjct:   95 QEKEHQQAQKPQKPPLPVRQKPMEIAGYVGFANLPNQVYRKAVKRGFEFTLMVVGASGLGKSTLINSMFLSDIYNAEQYPGPSLRKKKTVAVEATKVMLKENGVNLTLTVVDTPGFGDAVDNSNCWVPILEYVDSKYEEYLTAESRVYRKT---ISDSRVHCCLYFIAPSGH--GLLPLDIACMQSLSDKVNLVPVIAKADTMTPDEVHLFKKQILNEIAQHKIKIYDFPATLEDAA-----------EEAKTTQNLRSRVPFAVVGANTIIEQDGKKVRGRRYPWGLVEVENLTHCDFIALRNMVIRTHLQDLKDVTNNVHYENYRCRKLSELGLVDGKARLSNKNPLTQMEEEKREHEQKMKKMEAEMEQVFDMKVKEKMQKLRDSELELARRHEERKKAL 481          
BLAST of Septin vs. Ensembl Fly
Match: Sep1 (gene:FBgn0011710 transcript:FBtr0077198)

HSP 1 Score: 190.66 bits (483), Expect = 8.939e-56
Identity = 112/303 (36.96%), Postives = 171/303 (56.44%), Query Frame = 2
Query:  200 TGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQ-FPQNT---------KTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLS 1078
             GF+ +  Q++RKS   GF+F LM+VG SGLGKST +NSLF T  +P+           +T  +  +T ++ E  V+L L +++ P FGD I+NS S+  I +Y+++ + + L  ES +NR +     D+ +H C YFI P      LK LD+EFMK +H KV+++P+IAKAD +T  E+   K  ++ E+  H I  +    L +     + ++      K  V+ L E  PFAV G    +     +V  R YPWG +EV+N DH D   +R +L+ TH+Q+L   +  V YEN+RS  L+
Sbjct:   16 VGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLVNSLFLTDLYPERIIPDAIEKQKQTVKLEASTVEIEERGVKLRLTVVDTPGFGDAIDNSNSFGAILEYIDEQYERFLRDESGLNRRN---IVDNRIHCCFYFISPFGHG--LKPLDVEFMKKLHSKVNIVPVIAKADCLTKKEILRLKCRIMQEIESHGIKIYP---LPDCDSDEDEDY------KEQVKQLKEAVPFAVCGANTLLEVKGKKVRGRLYPWGVVEVENPDHCDFIKLRTMLI-THMQDLQEVTQEVHYENYRSDRLA 303          
BLAST of Septin vs. Ensembl Fly
Match: Sep4 (gene:FBgn0259923 transcript:FBtr0074371)

HSP 1 Score: 187.963 bits (476), Expect = 1.396e-54
Identity = 107/307 (34.85%), Postives = 173/307 (56.35%), Query Frame = 2
Query:  203 GFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQFPQNT----------KTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQN 1093
            GF+ + +Q++RKS   GF+F LM+VG SGLGKST +NSLF     +N           KT+ V + T  + E  V L L +++ P FGD IN   SW+    Y+++ F +    ES +NR + +   D+ VH CLYF+ P      L+ +DL+ ++ +H KV+++ +I KAD +   E++  K  +L +L  + I  ++F   +      E + F K Q++ +  S+    PFAVVG    +     +V  R YPWG + V++ +HSD   +R  L+STH+Q+L  T+  V YEN R++ +S++ Q+
Sbjct:   15 GFATLPEQVHRKSVKRGFEFTLMVVGESGLGKSTLINSLFLGDLYKNRQMPNVEERIEKTTKVEKKTMDIEERGVRLRLTVVDTPGFGDAINCEDSWRVCTQYIDEQFRQYFTDESGLNRRNIQ---DNRVHCCLYFVPPWGHS--LRQMDLDLIRRLHRKVNIVLVIGKADCLNKQEVRKLKERILQDLEDNHIQLYQFPECDSD----EDDDF-KQQDRELKASI----PFAVVGSNTILEVAGKKVRGRQYPWGVVNVEDPEHSDFIKLRTFLISTHMQDLKDTTQDVHYENFRAQCISQISQH 307          
BLAST of Septin vs. Ensembl Fly
Match: Sep4 (gene:FBgn0259923 transcript:FBtr0074368)

HSP 1 Score: 187.963 bits (476), Expect = 5.585e-54
Identity = 107/307 (34.85%), Postives = 173/307 (56.35%), Query Frame = 2
Query:  203 GFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQFPQNT----------KTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQN 1093
            GF+ + +Q++RKS   GF+F LM+VG SGLGKST +NSLF     +N           KT+ V + T  + E  V L L +++ P FGD IN   SW+    Y+++ F +    ES +NR + +   D+ VH CLYF+ P      L+ +DL+ ++ +H KV+++ +I KAD +   E++  K  +L +L  + I  ++F   +      E + F K Q++ +  S+    PFAVVG    +     +V  R YPWG + V++ +HSD   +R  L+STH+Q+L  T+  V YEN R++ +S++ Q+
Sbjct:   67 GFATLPEQVHRKSVKRGFEFTLMVVGESGLGKSTLINSLFLGDLYKNRQMPNVEERIEKTTKVEKKTMDIEERGVRLRLTVVDTPGFGDAINCEDSWRVCTQYIDEQFRQYFTDESGLNRRNIQ---DNRVHCCLYFVPPWGHS--LRQMDLDLIRRLHRKVNIVLVIGKADCLNKQEVRKLKERILQDLEDNHIQLYQFPECDSD----EDDDF-KQQDRELKASI----PFAVVGSNTILEVAGKKVRGRQYPWGVVNVEDPEHSDFIKLRTFLISTHMQDLKDTTQDVHYENFRAQCISQISQH 359          
BLAST of Septin vs. Ensembl Zebrafish
Match: sept15 (septin 15 [Source:ZFIN;Acc:ZDB-GENE-061103-265])

HSP 1 Score: 232.646 bits (592), Expect = 6.573e-71
Identity = 140/401 (34.91%), Postives = 221/401 (55.11%), Query Frame = 2
Query:  200 TGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQ-----FP---QNTKTSGVVENTYKLI-ENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQNLGIVTENQHH----PSVYLEKYFKLLHVSLAKKINEMESGFKELVHKRESALLNKAKDLEEQSEVMADELNQALCEFDRDFTKFIAVKTEWDCE 1363
             GF+ +  Q+YRKS   GF+F LM+VG SGLGKST +NSLF T      +P   Q  K +  VE +  LI E  V+LTL +++ P FGD ++NS  W+ + +Y++  F   LN ES++NR       D+ VH CLYFI P      LK LD+EFMK +H KV++IP+IAKAD++T  E Q+ K  ++ E+  H+I  ++F   E+             ++ ++++ + E+ P AVVG    +  +  +V  R YPWG  EV+N +H D   +R +L+ TH+Q+L   +++V YEN+RS+ L+ +  N    T+N+      P   +E+  +   + + K   EME  F+  V +++  L +   +LE + E M   L     E +    +F   K  W+ +
Sbjct:   20 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSKDYPGPSQRIKKTVQVEQSKVLIKEGGVQLTLTIVDTPGFGDAVDNSNCWQPVINYIDSKFEDFLNAESRVNRRQ---MPDNRVHCCLYFIAPSGH--GLKPLDIEFMKRLHDKVNVIPLIAKADTLTPEECQLFKKQIMKEIQEHKIKIYEFPDTEDD------------EDSKLIRKIKEKMPLAVVGSNVVIEVNGRKVRGRQYPWGVAEVENGEHCDFTVLRNMLIRTHMQDLKDVTNNVHYENYRSKKLAAVTCNGVDATKNKGQLTKSPLAQMEEERREHVMKMKKMETEMEQVFEMKVKEKKQKLKDSEAELERRHEQMKKNLEAQYKELEEKRRQFEDEKANWEAQ 403          
BLAST of Septin vs. Ensembl Zebrafish
Match: sept15 (septin 15 [Source:ZFIN;Acc:ZDB-GENE-061103-265])

HSP 1 Score: 232.646 bits (592), Expect = 7.586e-71
Identity = 140/401 (34.91%), Postives = 221/401 (55.11%), Query Frame = 2
Query:  200 TGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQ-----FP---QNTKTSGVVENTYKLI-ENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQNLGIVTENQHH----PSVYLEKYFKLLHVSLAKKINEMESGFKELVHKRESALLNKAKDLEEQSEVMADELNQALCEFDRDFTKFIAVKTEWDCE 1363
             GF+ +  Q+YRKS   GF+F LM+VG SGLGKST +NSLF T      +P   Q  K +  VE +  LI E  V+LTL +++ P FGD ++NS  W+ + +Y++  F   LN ES++NR       D+ VH CLYFI P      LK LD+EFMK +H KV++IP+IAKAD++T  E Q+ K  ++ E+  H+I  ++F   E+             ++ ++++ + E+ P AVVG    +  +  +V  R YPWG  EV+N +H D   +R +L+ TH+Q+L   +++V YEN+RS+ L+ +  N    T+N+      P   +E+  +   + + K   EME  F+  V +++  L +   +LE + E M   L     E +    +F   K  W+ +
Sbjct:   21 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSKDYPGPSQRIKKTVQVEQSKVLIKEGGVQLTLTIVDTPGFGDAVDNSNCWQPVINYIDSKFEDFLNAESRVNRRQ---MPDNRVHCCLYFIAPSGH--GLKPLDIEFMKRLHDKVNVIPLIAKADTLTPEECQLFKKQIMKEIQEHKIKIYEFPDTEDD------------EDSKLIRKIKEKMPLAVVGSNVVIEVNGRKVRGRQYPWGVAEVENGEHCDFTVLRNMLIRTHMQDLKDVTNNVHYENYRSKKLAAVTCNGVDATKNKGQLTKSPLAQMEEERREHVMKMKKMETEMEQVFEMKVKEKKQKLKDSEAELERRHEQMKKNLEAQYKELEEKRRQFEDEKANWEAQ 404          
BLAST of Septin vs. Ensembl Zebrafish
Match: sept7a (septin 7a [Source:ZFIN;Acc:ZDB-GENE-040426-1008])

HSP 1 Score: 222.631 bits (566), Expect = 5.701e-67
Identity = 118/307 (38.44%), Postives = 180/307 (58.63%), Query Frame = 2
Query:  200 TGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRT-----QFPQNT----KTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQN 1093
             GF+ +  Q+YRKS   GF+F LM+VG SGLGKST +NSLF T     ++P  +    KT  V ++   + E  V+L L +++ P FGD ++NS  W+ + D+++  F   LN ES++NR       D  VH CLYFI P      LK LD+EFMK +H KV++IP+IAKAD++T  E Q  K  ++ E+  H+I  ++F   ++             +E ++V+ + +R P AVVG    +  +  +V  R YPWG  EV+N +H D   +R +L+ TH+Q+L   +++V YEN+RSR L+ +  N
Sbjct:   28 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSSEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDHIDSKFEDYLNAESRVNRRQ---MPDSRVHCCLYFIAPSGH--GLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMREIQEHKIKIYEFPETDDE------------EESKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN 317          
BLAST of Septin vs. Ensembl Zebrafish
Match: sept7a (septin 7a [Source:ZFIN;Acc:ZDB-GENE-040426-1008])

HSP 1 Score: 223.016 bits (567), Expect = 5.844e-67
Identity = 118/307 (38.44%), Postives = 180/307 (58.63%), Query Frame = 2
Query:  200 TGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRT-----QFPQNT----KTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQN 1093
             GF+ +  Q+YRKS   GF+F LM+VG SGLGKST +NSLF T     ++P  +    KT  V ++   + E  V+L L +++ P FGD ++NS  W+ + D+++  F   LN ES++NR       D  VH CLYFI P      LK LD+EFMK +H KV++IP+IAKAD++T  E Q  K  ++ E+  H+I  ++F   ++             +E ++V+ + +R P AVVG    +  +  +V  R YPWG  EV+N +H D   +R +L+ TH+Q+L   +++V YEN+RSR L+ +  N
Sbjct:   29 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSSEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDHIDSKFEDYLNAESRVNRRQ---MPDSRVHCCLYFIAPSGH--GLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMREIQEHKIKIYEFPETDDE------------EESKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN 318          
BLAST of Septin vs. Ensembl Zebrafish
Match: sept4a (septin 4a [Source:ZFIN;Acc:ZDB-GENE-051120-87])

HSP 1 Score: 200.29 bits (508), Expect = 5.178e-58
Identity = 110/306 (35.95%), Postives = 177/306 (57.84%), Query Frame = 2
Query:  203 GFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQFPQNTK----------TSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQ 1090
            GF+ +  Q++RKS   GF F LM+ G SGLGKST +NSLF T   ++ K          T  + ++T  + E  V+L L +++ P FGD +NN++SW+ I DY+++ F +    ES +NR + +   D+ VH CLYFI P      L+ +D+EFMK +H KV+++P++AK DS+T  E++  K  +  E+   +I  ++F   E      E + F KLQ+    Q L +  PFAV+G    + +   +   R YPWG +EV+N +HSD   +R +L+ TH+Q+L   +    YEN+R++ +  + +
Sbjct:  118 GFATLPNQVHRKSVKKGFAFTLMVAGESGLGKSTLVNSLFLTDLYKDRKMPNAEERIAQTVEITKHTVAIEEKGVKLRLTIVDTPGFGDAVNNTESWRAIVDYIDQQFEQYFRDESGLNRKNIQ---DNRVHCCLYFISPFGHG--LRPIDVEFMKILHEKVNIVPVLAKTDSLTPEEVRKMKMKIREEIERFDIMIYQFPECESD----EEDEF-KLQQ----QELKDSVPFAVIGSNVQVESQGRRFRGRQYPWGLVEVENPEHSDFLKLRNMLVRTHMQDLKDVTRETHYENYRAQCIQNMTR 409          
BLAST of Septin vs. Ensembl Xenopus
Match: SEPTIN7 (septin 7 [Source:NCBI gene;Acc:100216295])

HSP 1 Score: 224.557 bits (571), Expect = 1.387e-67
Identity = 121/319 (37.93%), Postives = 185/319 (57.99%), Query Frame = 2
Query:  164 ILMNYKLKPIAATGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQ-----FPQNT----KTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQN 1093
            IL   K+  ++  GF+ +  Q+YRKS   GF+F LM+VG SGLGKST +NSLF T      +P  +    KT  V ++   + E  V+L L +++ P FGD ++NS  W+ + DY++  F   LN ES++NR       D+ VH CLYFI P      LK LD+EFMK +H KV++IP+IAKAD++T  E Q  K  ++ E+  H+I  ++F   ++             +E ++V+ + +  P AVVG    +  +  +V  R YPWG  EV+N +H D   +R +L+ TH+Q+L   +++V YEN+RSR L+ +  N
Sbjct:    1 ILTGCKISLLSYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYAPDYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQ---MPDNRVHCCLYFIAPSGH--GLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDE------------EENKLVKKIKDGLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN 302          
BLAST of Septin vs. Ensembl Xenopus
Match: SEPTIN7 (septin 7 [Source:NCBI gene;Acc:100216295])

HSP 1 Score: 221.476 bits (563), Expect = 1.375e-66
Identity = 118/307 (38.44%), Postives = 179/307 (58.31%), Query Frame = 2
Query:  200 TGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQ-----FPQNT----KTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQN 1093
             GF+ +  Q+YRKS   GF+F LM+VG SGLGKST +NSLF T      +P  +    KT  V ++   + E  V+L L +++ P FGD ++NS  W+ + DY++  F   LN ES++NR       D+ VH CLYFI P      LK LD+EFMK +H KV++IP+IAKAD++T  E Q  K  ++ E+  H+I  ++F   ++             +E ++V+ + +  P AVVG    +  +  +V  R YPWG  EV+N +H D   +R +L+ TH+Q+L   +++V YEN+RSR L+ +  N
Sbjct:   11 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYAPDYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQ---MPDNRVHCCLYFIAPSGH--GLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDE------------EENKLVKKIKDGLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN 300          
BLAST of Septin vs. Ensembl Xenopus
Match: SEPTIN7 (septin 7 [Source:NCBI gene;Acc:100216295])

HSP 1 Score: 221.861 bits (564), Expect = 1.439e-66
Identity = 118/307 (38.44%), Postives = 179/307 (58.31%), Query Frame = 2
Query:  200 TGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQ-----FPQNT----KTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQN 1093
             GF+ +  Q+YRKS   GF+F LM+VG SGLGKST +NSLF T      +P  +    KT  V ++   + E  V+L L +++ P FGD ++NS  W+ + DY++  F   LN ES++NR       D+ VH CLYFI P      LK LD+EFMK +H KV++IP+IAKAD++T  E Q  K  ++ E+  H+I  ++F   ++             +E ++V+ + +  P AVVG    +  +  +V  R YPWG  EV+N +H D   +R +L+ TH+Q+L   +++V YEN+RSR L+ +  N
Sbjct:   11 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYAPDYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQ---MPDNRVHCCLYFIAPSGH--GLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDE------------EENKLVKKIKDGLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN 300          
BLAST of Septin vs. Ensembl Xenopus
Match: SEPTIN7 (septin 7 [Source:NCBI gene;Acc:100216295])

HSP 1 Score: 221.476 bits (563), Expect = 2.322e-66
Identity = 118/307 (38.44%), Postives = 179/307 (58.31%), Query Frame = 2
Query:  200 TGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQ-----FPQNT----KTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQN 1093
             GF+ +  Q+YRKS   GF+F LM+VG SGLGKST +NSLF T      +P  +    KT  V ++   + E  V+L L +++ P FGD ++NS  W+ + DY++  F   LN ES++NR       D+ VH CLYFI P      LK LD+EFMK +H KV++IP+IAKAD++T  E Q  K  ++ E+  H+I  ++F   ++             +E ++V+ + +  P AVVG    +  +  +V  R YPWG  EV+N +H D   +R +L+ TH+Q+L   +++V YEN+RSR L+ +  N
Sbjct:   21 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYAPDYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQ---MPDNRVHCCLYFIAPSGH--GLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDE------------EENKLVKKIKDGLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN 310          
BLAST of Septin vs. Ensembl Xenopus
Match: SEPTIN7 (septin 7 [Source:NCBI gene;Acc:100216295])

HSP 1 Score: 221.476 bits (563), Expect = 2.655e-66
Identity = 118/307 (38.44%), Postives = 179/307 (58.31%), Query Frame = 2
Query:  200 TGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQ-----FPQNT----KTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQN 1093
             GF+ +  Q+YRKS   GF+F LM+VG SGLGKST +NSLF T      +P  +    KT  V ++   + E  V+L L +++ P FGD ++NS  W+ + DY++  F   LN ES++NR       D+ VH CLYFI P      LK LD+EFMK +H KV++IP+IAKAD++T  E Q  K  ++ E+  H+I  ++F   ++             +E ++V+ + +  P AVVG    +  +  +V  R YPWG  EV+N +H D   +R +L+ TH+Q+L   +++V YEN+RSR L+ +  N
Sbjct:   18 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYAPDYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQ---MPDNRVHCCLYFIAPSGH--GLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDE------------EENKLVKKIKDGLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN 307          
BLAST of Septin vs. Ensembl Mouse
Match: Sept7 (septin 7 [Source:MGI Symbol;Acc:MGI:1335094])

HSP 1 Score: 222.631 bits (566), Expect = 5.889e-67
Identity = 118/307 (38.44%), Postives = 180/307 (58.63%), Query Frame = 2
Query:  200 TGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRT-----QFPQNT----KTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQN 1093
             GF+ +  Q+YRKS   GF+F LM+VG SGLGKST +NSLF T     ++P  +    KT  V ++   + E  V+L L +++ P FGD ++NS  W+ + DY++  F   LN ES++NR       D+ V  CLYFI P      LK LD+EFMK +H KV++IP+IAKAD++T  E Q  K  ++ E+  H+I  ++F   ++             +E ++V+ + +R P AVVG    +  +  +V  R YPWG  EV+N +H D   +R +L+ TH+Q+L   +++V YEN+RSR L+ +  N
Sbjct:   31 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQ---MPDNRVQCCLYFIAPSGH--GLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDE------------EENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN 320          
BLAST of Septin vs. Ensembl Mouse
Match: Sept7 (septin 7 [Source:MGI Symbol;Acc:MGI:1335094])

HSP 1 Score: 222.631 bits (566), Expect = 7.588e-67
Identity = 118/307 (38.44%), Postives = 180/307 (58.63%), Query Frame = 2
Query:  200 TGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRT-----QFPQNT----KTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQN 1093
             GF+ +  Q+YRKS   GF+F LM+VG SGLGKST +NSLF T     ++P  +    KT  V ++   + E  V+L L +++ P FGD ++NS  W+ + DY++  F   LN ES++NR       D+ V  CLYFI P      LK LD+EFMK +H KV++IP+IAKAD++T  E Q  K  ++ E+  H+I  ++F   ++             +E ++V+ + +R P AVVG    +  +  +V  R YPWG  EV+N +H D   +R +L+ TH+Q+L   +++V YEN+RSR L+ +  N
Sbjct:   31 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQ---MPDNRVQCCLYFIAPSGH--GLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDE------------EENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN 320          
BLAST of Septin vs. Ensembl Mouse
Match: Sept4 (septin 4 [Source:MGI Symbol;Acc:MGI:1270156])

HSP 1 Score: 199.134 bits (505), Expect = 2.485e-59
Identity = 108/307 (35.18%), Postives = 170/307 (55.37%), Query Frame = 2
Query:  200 TGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQFPQNTKTSGVVENTYKLIE----------NDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQ 1090
             GF+ +  Q++RKS   GF F LM+ G SGLGKST +NSLF T   ++ K  G  E   + +E            V L L +++ P FGD +NN++ WK + +Y+++ F +    ES +NR + +   D+ VH CLYFI P      L+ LD+EFMK +H +V+++PI+AKAD++T  E+   K  +       EI +F  K+ +      + +   KLQ+    Q+L E  PFAV+G    +     +V  R YPWG +EV+N  H D   +R +L+ TH+Q+L   +    YEN+R++ +  + +
Sbjct:    7 VGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQ---DNRVHCCLYFISPFGHG--LRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDRKKCKIR-----EEIEHFGIKIYQFPDCDSDEDEDFKLQD----QALKESIPFAVIGSNTVVEARGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQSMTR 299          
BLAST of Septin vs. Ensembl Mouse
Match: Sept4 (septin 4 [Source:MGI Symbol;Acc:MGI:1270156])

HSP 1 Score: 199.134 bits (505), Expect = 1.527e-58
Identity = 108/306 (35.29%), Postives = 170/306 (55.56%), Query Frame = 2
Query:  203 GFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQFPQNTKTSGVVENTYKLIE----------NDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQ 1090
            GF+ +  Q++RKS   GF F LM+ G SGLGKST +NSLF T   ++ K  G  E   + +E            V L L +++ P FGD +NN++ WK + +Y+++ F +    ES +NR + +   D+ VH CLYFI P      L+ LD+EFMK +H +V+++PI+AKAD++T  E+   K  +       EI +F  K+ +      + +   KLQ+    Q+L E  PFAV+G    +     +V  R YPWG +EV+N  H D   +R +L+ TH+Q+L   +    YEN+R++ +  + +
Sbjct:   27 GFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQ---DNRVHCCLYFISPFGHG--LRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDRKKCKIR-----EEIEHFGIKIYQFPDCDSDEDEDFKLQD----QALKESIPFAVIGSNTVVEARGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQSMTR 318          
BLAST of Septin vs. Ensembl Mouse
Match: Sept4 (septin 4 [Source:MGI Symbol;Acc:MGI:1270156])

HSP 1 Score: 197.593 bits (501), Expect = 1.819e-57
Identity = 108/306 (35.29%), Postives = 170/306 (55.56%), Query Frame = 2
Query:  203 GFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQFPQNTKTSGVVENTYKLIE----------NDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQ 1090
            GF+ +  Q++RKS   GF F LM+ G SGLGKST +NSLF T   ++ K  G  E   + +E            V L L +++ P FGD +NN++ WK + +Y+++ F +    ES +NR + +   D+ VH CLYFI P      L+ LD+EFMK +H +V+++PI+AKAD++T  E+   K  +       EI +F  K+ +      + +   KLQ+    Q+L E  PFAV+G    +     +V  R YPWG +EV+N  H D   +R +L+ TH+Q+L   +    YEN+R++ +  + +
Sbjct:  126 GFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQ---DNRVHCCLYFISPFGHG--LRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDRKKCKIR-----EEIEHFGIKIYQFPDCDSDEDEDFKLQD----QALKESIPFAVIGSNTVVEARGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQSMTR 417          
BLAST of Septin vs. UniProt/SwissProt
Match: sp|Q9WVC0|SEPT7_RAT (Septin-7 OS=Rattus norvegicus OX=10116 GN=Septin7 PE=1 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 3.426e-66
Identity = 118/307 (38.44%), Postives = 180/307 (58.63%), Query Frame = 2
Query:  200 TGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRT-----QFPQNT----KTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQN 1093
             GF+ +  Q+YRKS   GF+F LM+VG SGLGKST +NSLF T     ++P  +    KT  V ++   + E  V+L L +++ P FGD ++NS  W+ + DY++  F   LN ES++NR       D+ V  CLYFI P      LK LD+EFMK +H KV++IP+IAKAD++T  E Q  K  ++ E+  H+I  ++F   ++             +E ++V+ + +R P AVVG    +  +  +V  R YPWG  EV+N +H D   +R +L+ TH+Q+L   +++V YEN+RSR L+ +  N
Sbjct:   30 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQ---MPDNRVQCCLYFIAPSGH--GLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQGHKIKIYEFPETDDE------------EENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN 319          
BLAST of Septin vs. UniProt/SwissProt
Match: sp|Q5R1W1|SEPT7_PANTR (Septin-7 (Fragment) OS=Pan troglodytes OX=9598 GN=SEPTIN7 PE=2 SV=2)

HSP 1 Score: 223.016 bits (567), Expect = 3.656e-66
Identity = 118/307 (38.44%), Postives = 180/307 (58.63%), Query Frame = 2
Query:  200 TGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRT-----QFPQNT----KTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQN 1093
             GF+ +  Q+YRKS   GF+F LM+VG SGLGKST +NSLF T     ++P  +    KT  V ++   + E  V+L L +++ P FGD ++NS  W+ + DY++  F   LN ES++NR       D+ V  CLYFI P      LK LD+EFMK +H KV++IP+IAKAD++T  E Q  K  ++ E+  H+I  ++F   ++             +E ++V+ + +R P AVVG    +  +  +V  R YPWG  EV+N +H D   +R +L+ TH+Q+L   +++V YEN+RSR L+ +  N
Sbjct:   28 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQ---MPDNRVQCCLYFIAPSGH--GLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDE------------EENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN 317          
BLAST of Septin vs. UniProt/SwissProt
Match: sp|O55131|SEPT7_MOUSE (Septin-7 OS=Mus musculus OX=10090 GN=Septin7 PE=1 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 4.100e-66
Identity = 118/307 (38.44%), Postives = 180/307 (58.63%), Query Frame = 2
Query:  200 TGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRT-----QFPQNT----KTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQN 1093
             GF+ +  Q+YRKS   GF+F LM+VG SGLGKST +NSLF T     ++P  +    KT  V ++   + E  V+L L +++ P FGD ++NS  W+ + DY++  F   LN ES++NR       D+ V  CLYFI P      LK LD+EFMK +H KV++IP+IAKAD++T  E Q  K  ++ E+  H+I  ++F   ++             +E ++V+ + +R P AVVG    +  +  +V  R YPWG  EV+N +H D   +R +L+ TH+Q+L   +++V YEN+RSR L+ +  N
Sbjct:   30 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQ---MPDNRVQCCLYFIAPSGH--GLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDE------------EENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN 319          
BLAST of Septin vs. UniProt/SwissProt
Match: sp|Q5R481|SEPT7_PONAB (Septin-7 OS=Pongo abelii OX=9601 GN=SEPTIN7 PE=2 SV=2)

HSP 1 Score: 222.631 bits (566), Expect = 4.578e-66
Identity = 118/307 (38.44%), Postives = 180/307 (58.63%), Query Frame = 2
Query:  200 TGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRT-----QFPQNT----KTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQN 1093
             GF+ +  Q+YRKS   GF+F LM+VG SGLGKST +NSLF T     ++P  +    KT  V ++   + E  V+L L +++ P FGD ++NS  W+ + DY++  F   LN ES++NR       D+ V  CLYFI P      LK LD+EFMK +H KV++IP+IAKAD++T  E Q  K  ++ E+  H+I  ++F   ++             +E ++V+ + +R P AVVG    +  +  +V  R YPWG  EV+N +H D   +R +L+ TH+Q+L   +++V YEN+RSR L+ +  N
Sbjct:   31 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQ---MPDNRVQCCLYFIAPSGH--GLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDE------------EENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN 320          
BLAST of Septin vs. UniProt/SwissProt
Match: sp|Q16181|SEPT7_HUMAN (Septin-7 OS=Homo sapiens OX=9606 GN=SEPTIN7 PE=1 SV=2)

HSP 1 Score: 222.631 bits (566), Expect = 4.578e-66
Identity = 118/307 (38.44%), Postives = 180/307 (58.63%), Query Frame = 2
Query:  200 TGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRT-----QFPQNT----KTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQN 1093
             GF+ +  Q+YRKS   GF+F LM+VG SGLGKST +NSLF T     ++P  +    KT  V ++   + E  V+L L +++ P FGD ++NS  W+ + DY++  F   LN ES++NR       D+ V  CLYFI P      LK LD+EFMK +H KV++IP+IAKAD++T  E Q  K  ++ E+  H+I  ++F   ++             +E ++V+ + +R P AVVG    +  +  +V  R YPWG  EV+N +H D   +R +L+ TH+Q+L   +++V YEN+RSR L+ +  N
Sbjct:   31 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQ---MPDNRVQCCLYFIAPSGH--GLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDE------------EENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN 320          
BLAST of Septin vs. TrEMBL
Match: A0A504YX32 (Septin OS=Fasciola gigantica OX=46835 GN=FGIG_02326 PE=3 SV=1)

HSP 1 Score: 258.455 bits (659), Expect = 1.198e-76
Identity = 156/402 (38.81%), Postives = 225/402 (55.97%), Query Frame = 2
Query:  203 GFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQ-----FPQNT----KTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKD-QVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQNLGIVTENQHHPSVYLEKYFKLLHVSLAKKINEMESGFKELVHKR-------ESALLNKAKDLEEQSEVMADELNQALCEFDRDFTKFIAVKTEWD 1357
            G+S +  Q+YRK+   GF+FNLM+VG SGLGKSTF+NSLF T      +P  +    KTS V  +T  L EN V L LK+I+ P FGD ++N+  W+ I DY++  F   +  ES++ R +  + AD  VHA +YFI P      LK LD+EF++ V  KV++IP+IAKADS+T+ E +  K  +L EL  + I+ F F   +E   R      VKL+  R      +R PFAVVG    ++ D   ++  RSYPWG +EV+N++H+D AA+R LLL+  +QEL   +H+V YEN+R+  LS + Q     T +   P   +E   K     + K   EMES F++ V ++       E+ L+ +A  + EQ      E   A   FD + T +     EWD
Sbjct:   67 GYSNLPNQVYRKAVRRGFEFNLMVVGESGLGKSTFINSLFLTDMYNADYPGPSRRPKKTSSVQSSTVILKENGVLLKLKMIDTPGFGDSVDNTNCWQPIIDYIDARFDDYIWGESRVTRGTQTV-ADQRVHALIYFIAPTGH--TLKQLDIEFLRRVQDKVNVIPVIAKADSLTSDECKEFKKTILNELATNRIHTFDFPDSDECTDRGNEEEMVKLKRLR------DRAPFAVVGANTLVVGDGGTRIRARSYPWGVVEVENMEHNDFAALRYLLLTAFMQELRDVTHNVHYENYRTAKLSGIAQESHFQTRDGKDPMSLMESEKKEHEAKMRKMEAEMESVFEQKVEEKNQKLLEFENDLMRRADQMREQLRAQEQEQEAARRAFDLERTSWEEAWREWD 459          
BLAST of Septin vs. TrEMBL
Match: A0A4Z2CUS1 (Septin-7 isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_007460 PE=3 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 2.812e-72
Identity = 156/419 (37.23%), Postives = 229/419 (54.65%), Query Frame = 2
Query:   71 PKVYALKSSTEKLDEIPE-KESSKQNMNNLEKILMNYKLKPIAA-TGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQF-------PQNT--KTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKD-QVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQNLGIVTENQHHPSVYLEKYFKLLHVSLAKKINEMESGFKELVHKRESALLNKAKDLEEQSEVMADEL 1291
            P + +LK  ++  D + + K     ++N +   L N  + P+    G+S +  QIYRK+   GF+FN+++VG SG+GKSTF+NSLF ++        P N   KT+ V  +T  L EN V L L LI+ P FGD I+N+  W+ I DY+   F   ++ ES++NR    I  D  VHAC+YFI P      LK LDLEF+  +  KV++IP+IAKAD++T  E +  K  +L +L   +I  F+F    E   R      +KL+  R      +R PFAVVG    + N    +V  RSYPWG +EV+N+DH+D AA+R LLLS ++QEL   +H+V YEN+R+  LS +       T +   P   +E   K     + K   EME+ F + V ++   L     DL  + E M ++L
Sbjct:   24 PNLDSLKIQSKDTDVVKDNKTDPGVHINGVVTTLAN-GISPVEGYVGYSNLPNQIYRKAVRKGFEFNILVVGESGVGKSTFINSLFLSEVYNSDHPGPSNRHRKTTCVQSHTVILKENGVFLKLNLIDTPGFGDCIDNTNCWQPIVDYIISRFDDYISGESRVNRPCQSI-PDQRVHACIYFIAPTGH--SLKPLDLEFLSRIQDKVNVIPVIAKADTLTPEECREFKKTILNDLASRKIRVFEFIDPPECADRTNDEELIKLRRLR------DRVPFAVVGANTLITNSAGVRVRARSYPWGIVEVENMDHNDFAAIRYLLLSVYMQELRDMTHNVHYENYRNAKLSGIAMESHFQTRDGKDPMAIMEAEKKEHEAKMRKMEAEMEAVFDQKVEEKNQKLRELESDLMRRVEQMREQL 432          
BLAST of Septin vs. TrEMBL
Match: A0A183UMF3 (Septin-type G domain-containing protein OS=Toxocara canis OX=6265 GN=TCNE_LOCUS9673 PE=3 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 9.841e-72
Identity = 147/363 (40.50%), Postives = 210/363 (57.85%), Query Frame = 2
Query:  203 GFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQF----PQNTK----TSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGG-QESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQNLGIVTENQHHPSVYLEKYFKLLHVSLAKKINEMESGFKELVHKRESALLNKAKDLEE 1264
            GF+    Q++R++  NGF+F LM+VG SGLGKSTF+NSLF  +     P+  K    T+ + E T +LIEN V L L L++ P FGD I+N+K W+ I +Y+E  + +  + E+KI R+S     D  VH CLYFI P      LK LD+EFMK +H +V++IP+IAKAD+MTA EL   K+ +  EL  + I  +KF  L++              EK+    L ER PFAVVG  Q   IN++ +V  R YPWG +EV+NL H+D  A+R L++ T+L ++I+ + SV YEN R R +S+     G  +     P   LE   ++    L  K  EME  F E V +RE  L  +  +++E
Sbjct:   36 GFANFPNQVFRRAVKNGFEFTLMVVGQSGLGKSTFINSLFSAEINDPSPRPEKSLSPTTQIEEKTVRLIENGVILNLTLVDCPGFGDAIDNNKCWEPIVEYVECKYLEYFSEETKIERSST--IPDRRVHLCLYFIAPTGH--GLKQLDVEFMKRLHERVNIIPVIAKADTMTAEELARFKAQVTKELAENNIRLYKFPELDDE------------DEKKQFDPLRERVPFAVVGSNQVKEINNR-RVRYREYPWGVVEVENLKHNDFIALRDLIIRTYLIDMITVTRSVHYENFRYRQMSK-----GPKSSVDRDPFTQLEHERQVKENELEAKKAEMEKIFSEKVLEREKKLSARQAEIDE 376          
BLAST of Septin vs. TrEMBL
Match: A0A4D5RKE8 (Putative septins p-loop gtpase (Fragment) OS=Ixodes scapularis OX=6945 PE=3 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 1.107e-71
Identity = 146/412 (35.44%), Postives = 225/412 (54.61%), Query Frame = 2
Query:  203 GFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRT-----QFP---QNTKTSGVVENTYKLI-ENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQNLGIVTENQHHPSVYLEKYFKLLHVSLAKKINEMESGFKELVHKRESALLNKAKDLEEQSEVMADELNQALCEFDRDFTKFIAVKTEWDCENIDYHETYGTLRITRN 1411
            GF+ +  Q+YRK+   GF+F LM+VG SGLGKST LNS+F T     ++P   Q  K +  VE T  ++ E  V L L +++ P FGD ++NS+ W+ + DY+E  FA+ L+ ES+++R++    +D  VH CLYFI P      LK LD+EFMK +H KV++IP++AKAD+MT  E  + K  +L E+  H+I  ++F   ++             +E +  + L ER PFAVVG    +  +  +V  R YPWG  EV+N++H D  A+R +LL TH+Q+L   ++SV YEN+R R L+    + G   +N   P   +E+  K     + +   EME  F+  V ++   L     DL+ + E M   L Q   E +     F   K  +D  + D  + +  + +  N
Sbjct:   69 GFASLPNQVYRKAVKKGFEFTLMVVGESGLGKSTLLNSMFLTDVYSNEYPGPSQRVKKTVQVETTRVVLREGSVHLCLTVVDTPGFGDAVDNSQCWQPVADYVEAQFARYLDAESRVHRSA---LSDGRVHCCLYFIAPSGHG--LKPLDVEFMKRLHDKVNIIPVVAKADTMTPEECSLFKRTILNEMTQHKIRLYEFPDCDDE------------EENKRQKPLRERVPFAVVGSNTVVEVNGKRVRGRKYPWGVAEVENMEHCDYLALRNMLLRTHMQDLKDITNSVHYENYRCRKLAGGAADPGRSNKN---PLAQMEEEKKEHEAKMQRMEKEMEQVFEMKVREKMHKLKESEADLQRRHEQMKKSLEQQKLELEEKRRNFEKEKAAFDLAHRDMDDVFRKMAVDSN 460          
BLAST of Septin vs. TrEMBL
Match: F1L1Y8 (Septin-7 OS=Ascaris suum OX=6253 PE=2 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 1.503e-71
Identity = 144/363 (39.67%), Postives = 207/363 (57.02%), Query Frame = 2
Query:  203 GFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQFPQNTK--------TSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGG-QESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQNLGIVTENQHHPSVYLEKYFKLLHVSLAKKINEMESGFKELVHKRESALLNKAKDLEE 1264
            GF+    Q++R++  NGF+F LM+VG SGLGKSTF+NSLF  +    T         T+ + E T +LIEN V L L L++ P FGD I+N+K W+ I +Y+E+ +    + E+KI R +     D  VH CLYFI P      LK LD+EFMK +H +V++IP+IAKAD+MTA EL   K+ +  EL  + I  +KF  +E+              EK+    L ER PFAVVG  Q   IN++ +V  R YPWG +EV+NL H+D  A+R L++ T+L ++I+ + SV YEN R R +S+  +N          P   LE   ++    L  K  EME  F E V +RE  L  +  ++++
Sbjct:   42 GFANFPNQVFRRAVKNGFEFTLMVVGQSGLGKSTFINSLFSAEINDPTPRAERSFSPTTQIEEKTVRLIENGVILNLTLVDCPGFGDAIDNNKCWEPIVEYVERKYLDYFSEETKIERAAT--IPDRRVHLCLYFIAPTGH--GLKQLDVEFMKRLHERVNVIPVIAKADTMTAEELARFKTQVTKELEENNIKLYKFPEVEDE------------DEKKQFDPLRERVPFAVVGSNQVKEINNR-RVRYREYPWGVVEVENLKHNDFIALRDLIIRTYLIDMIAVTRSVHYENFRFRQMSKGPKN-----SVDRDPFTQLEHERQIKENELEAKKAEMEKIFNEKVDEREKKLAARQAEIDD 382          
BLAST of Septin vs. Ensembl Cavefish
Match: sept7a (septin 7a [Source:ZFIN;Acc:ZDB-GENE-040426-1008])

HSP 1 Score: 224.172 bits (570), Expect = 9.000e-68
Identity = 119/307 (38.76%), Postives = 181/307 (58.96%), Query Frame = 2
Query:  200 TGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRT-----QFPQNT----KTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQN 1093
             GF+ +  Q+YRKS   GF+F LM+VG SGLGKST +NSLF T     ++P  +    KT  V ++   + E  V+L L +++ P FGD ++NS  W+ + D+++  F   LN ES++NR       D+ VH CLYFI P      LK LD+EFMK +H KV++IP+IAKAD+MT  E Q  K  ++ E+  H+I  ++F   ++             +E ++V+ + +R P AVVG    +  +  +V  R YPWG  EV+N +H D   +R +L+ TH+Q+L   +++V YEN+RSR L+ +  N
Sbjct:   11 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSAEYPGPSHRIKKTVQVEQSKVLVKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDHIDSKFEDYLNAESRVNRRQ---MPDNRVHCCLYFIAPSGH--GLKPLDIEFMKRLHEKVNIIPLIAKADTMTPEECQQFKKQIMREIQEHKIKTYEFPETDDE------------EENKIVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN 300          
BLAST of Septin vs. Ensembl Cavefish
Match: sept7a (septin 7a [Source:ZFIN;Acc:ZDB-GENE-040426-1008])

HSP 1 Score: 224.172 bits (570), Expect = 1.070e-67
Identity = 119/307 (38.76%), Postives = 181/307 (58.96%), Query Frame = 2
Query:  200 TGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRT-----QFPQNT----KTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQN 1093
             GF+ +  Q+YRKS   GF+F LM+VG SGLGKST +NSLF T     ++P  +    KT  V ++   + E  V+L L +++ P FGD ++NS  W+ + D+++  F   LN ES++NR       D+ VH CLYFI P      LK LD+EFMK +H KV++IP+IAKAD+MT  E Q  K  ++ E+  H+I  ++F   ++             +E ++V+ + +R P AVVG    +  +  +V  R YPWG  EV+N +H D   +R +L+ TH+Q+L   +++V YEN+RSR L+ +  N
Sbjct:   11 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSAEYPGPSHRIKKTVQVEQSKVLVKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDHIDSKFEDYLNAESRVNRRQ---MPDNRVHCCLYFIAPSGH--GLKPLDIEFMKRLHEKVNIIPLIAKADTMTPEECQQFKKQIMREIQEHKIKTYEFPETDDE------------EENKIVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN 300          
BLAST of Septin vs. Ensembl Cavefish
Match: sept15 (septin-7-like [Source:NCBI gene;Acc:111195760])

HSP 1 Score: 222.246 bits (565), Expect = 1.236e-66
Identity = 139/399 (34.84%), Postives = 219/399 (54.89%), Query Frame = 2
Query:  200 TGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQ-----FP---QNTKTSGVVENTYKLI-ENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQNLGIVTENQHH----PSVYLEKYFKLLHVSLAKKINEMESGFKELVHKRESALLNKAKDLEEQSEVMADELNQALCEFDRDFTKFIAVKTEWD 1357
             GF+ +  Q+YRKS   GF+F LM+VG SGLGKST +NSLF T      +P   Q  K +  VE +  LI E  V+LTL +++ P FGD ++NS  W+ + +Y++      LN ES++NR       D+ VH CLYFI P      LK LD+EFMK +H KV++IP+IAKAD++T  E Q+ K  ++ E+  H+I  ++F   EE             ++ ++++ + ER P AVVG    +  +  +V  R YPWG  EV+N +H D   +R +L+ TH+Q+L   +++V YEN+RS+ L+ +  N    ++++      P   +E+  +   + + K   EME  F+  V +++  L +   +LE + E M   L     E +    +F   K  W+
Sbjct:   47 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSKDYPGPSQRIKKTVQVEQSKVLIKEGGVQLTLTIVDTPGFGDAVDNSNCWQPVINYIDSKCEDFLNAESRVNRRQ---MPDNRVHCCLYFIAPSGHG--LKPLDIEFMKRLHDKVNVIPLIAKADTLTPEECQLFKKQIMKEIQEHKIKIYEFPDTEED------------EDSKLIRKIKERMPLAVVGSNVVVEVNGRKVRGRQYPWGVAEVENGEHCDFTVLRNMLIRTHMQDLKDVTNNVHYENYRSKKLAAVTCNGVDASKSKGQLTKSPLAQMEEERREHVMKMKKMETEMEQVFEMKVKEKKQKLKDSEAELERRHEQMKRNLEAQYKELEEKRRQFEEEKANWE 428          
BLAST of Septin vs. Ensembl Cavefish
Match: sept15 (septin-7-like [Source:NCBI gene;Acc:111195760])

HSP 1 Score: 216.853 bits (551), Expect = 8.872e-65
Identity = 139/403 (34.49%), Postives = 219/403 (54.34%), Query Frame = 2
Query:  200 TGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQ-----FP---QNTKTSGVVENTYKLI-ENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIE----VDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQNLGIVTENQHH----PSVYLEKYFKLLHVSLAKKINEMESGFKELVHKRESALLNKAKDLEEQSEVMADELNQALCEFDRDFTKFIAVKTEWD 1357
             GF+ +  Q+YRKS   GF+F LM+VG SGLGKST +NSLF T      +P   Q  K +  VE +  LI E  V+LTL +++ P FGD ++NS  W+ + +Y++      LN ES++NR       D+ VH CLYFI P      LK LD+EFMK +H KV++IP+IAKAD++T  E Q+ K  ++ E+  H+I  ++F   EE             ++ ++++ + ER P AVVG    +  +  +V  R YPWG  E    V+N +H D   +R +L+ TH+Q+L   +++V YEN+RS+ L+ +  N    ++++      P   +E+  +   + + K   EME  F+  V +++  L +   +LE + E M   L     E +    +F   K  W+
Sbjct:   20 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSKDYPGPSQRIKKTVQVEQSKVLIKEGGVQLTLTIVDTPGFGDAVDNSNCWQPVINYIDSKCEDFLNAESRVNRRQ---MPDNRVHCCLYFIAPSGH--GLKPLDIEFMKRLHDKVNVIPLIAKADTLTPEECQLFKKQIMKEIQEHKIKIYEFPDTEED------------EDSKLIRKIKERMPLAVVGSNVVVEVNGRKVRGRQYPWGVAEEGIFVENGEHCDFTVLRNMLIRTHMQDLKDVTNNVHYENYRSKKLAAVTCNGVDASKSKGQLTKSPLAQMEEERREHVMKMKKMETEMEQVFEMKVKEKKQKLKDSEAELERRHEQMKRNLEAQYKELEEKRRQFEEEKANWE 405          
BLAST of Septin vs. Ensembl Cavefish
Match: sept15 (septin-7-like [Source:NCBI gene;Acc:111195760])

HSP 1 Score: 216.468 bits (550), Expect = 2.210e-64
Identity = 139/403 (34.49%), Postives = 219/403 (54.34%), Query Frame = 2
Query:  200 TGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQ-----FP---QNTKTSGVVENTYKLI-ENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIE----VDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQNLGIVTENQHH----PSVYLEKYFKLLHVSLAKKINEMESGFKELVHKRESALLNKAKDLEEQSEVMADELNQALCEFDRDFTKFIAVKTEWD 1357
             GF+ +  Q+YRKS   GF+F LM+VG SGLGKST +NSLF T      +P   Q  K +  VE +  LI E  V+LTL +++ P FGD ++NS  W+ + +Y++      LN ES++NR       D+ VH CLYFI P      LK LD+EFMK +H KV++IP+IAKAD++T  E Q+ K  ++ E+  H+I  ++F   EE             ++ ++++ + ER P AVVG    +  +  +V  R YPWG  E    V+N +H D   +R +L+ TH+Q+L   +++V YEN+RS+ L+ +  N    ++++      P   +E+  +   + + K   EME  F+  V +++  L +   +LE + E M   L     E +    +F   K  W+
Sbjct:   47 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSKDYPGPSQRIKKTVQVEQSKVLIKEGGVQLTLTIVDTPGFGDAVDNSNCWQPVINYIDSKCEDFLNAESRVNRRQ---MPDNRVHCCLYFIAPSGHG--LKPLDIEFMKRLHDKVNVIPLIAKADTLTPEECQLFKKQIMKEIQEHKIKIYEFPDTEED------------EDSKLIRKIKERMPLAVVGSNVVVEVNGRKVRGRQYPWGVAEEGIFVENGEHCDFTVLRNMLIRTHMQDLKDVTNNVHYENYRSKKLAAVTCNGVDASKSKGQLTKSPLAQMEEERREHVMKMKKMETEMEQVFEMKVKEKKQKLKDSEAELERRHEQMKRNLEAQYKELEEKRRQFEEEKANWE 432          
BLAST of Septin vs. Ensembl Sea Lamprey
Match: SEPTIN7 (septin 7 [Source:HGNC Symbol;Acc:HGNC:1717])

HSP 1 Score: 217.238 bits (552), Expect = 1.463e-65
Identity = 139/414 (33.57%), Postives = 222/414 (53.62%), Query Frame = 2
Query:  158 EKILMNYKLKPIAA-TGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRT-----QFPQNTK----TSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQNLGIVTENQ--HHPSVYLEKYFKLLHVSLAKKINEMESGFKELVHKRESALLNKAKDLEEQSEVMADELNQALCEFDRDFTKFIAVKTEWDCE 1363
            E++L   + KP+    GF+ +  QIYRK+   GF+F LM+VG SG+GKST +NS+F+T     +FP  TK    T  V ++   + E  V LTL +++ P +GD INNS+  + + D+++  F   LN ES++NR       D  VHACLYFI P      LK LD+EFMK +H KV++IP++AKAD+   +E    K  ++ ++H + I  ++F    +             ++ +++  + ER P AV+G    +     +V  R YPWG  EVDN++H D   +R +L+ TH+Q+L   +++V YEN RS  L+ L  N+   ++ Q    P   +E+  K     + K   EME  F   V +++  L +   +L+ +SE M   L   L E +    +F   +  W+ +
Sbjct:   20 ERVLF-LQTKPMEGYVGFANLPNQIYRKAAKRGFEFTLMVVGESGVGKSTLINSMFKTDLYSEEFPGPTKRIQKTVKVEQSKVVIREEGVHLTLTIVDTPGYGDFINNSECVQPVIDHIDSQFEDYLNAESRVNRRP---MPDSRVHACLYFIAPSGHG--LKALDIEFMKRLHNKVNIIPLVAKADAFLPTECCAFKKQIMKDIHDNNIKIYQFTDTHDE------------EDNKLLNKIKERLPLAVIGSNVVVDVGGRRVWGRHYPWGVAEVDNVEHCDFTTLRRMLIRTHMQDLKDVTNNVHYENFRSCKLAALTGNVAENSKRQLTKSPLAQMEEEKKDHKSKMKKMETEMEQVFDMKVKEKKQKLKDSEAELQRRSEQMKRSLESQLRELEERRKQFEEERLAWESQ 415          
BLAST of Septin vs. Ensembl Sea Lamprey
Match: zgc:162239 (zgc:162239 [Source:ZFIN;Acc:ZDB-GENE-070424-28])

HSP 1 Score: 203.756 bits (517), Expect = 3.508e-61
Identity = 113/306 (36.93%), Postives = 171/306 (55.88%), Query Frame = 2
Query:  200 TGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLF-------RTQFPQNTK---TSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELC 1087
             GF+ +  Q++RKS   GF+F LM+ G SGLGKST +NSLF       R   P + K   T+ ++  T ++ E  V L L L++ P F D I+N++ W+ + +Y+E+ F      ES ++R + +   D  VH CLYFI P      LK LD+EFMK +H KV+++P+IAKAD++T  E +  K  +  EL  ++I  ++F   +      E + F     KR  + L    PFAV+GG   +     +V  R YPWG  EVD+ +H D A +R +L+ TH+Q+L   +  + YE HR+R +   C
Sbjct:   25 VGFATLPNQVHRKSVKKGFEFTLMVAGESGLGKSTLINSLFLTDLYHDRVLLPADGKRCDTTEILRRTLEIEEKGVRLRLSLVDTPGFADAIDNTECWQPVVEYVEEQFESYFREESGLDRKNLQ---DTRVHCCLYFISPYGHG--LKPLDVEFMKALHNKVNIVPVIAKADTLTMRERETLKRRVQEELSENDIKIYQFPECDSD----EDDEF-----KRQDEELKASIPFAVIGGSAVVEASGRRVRGRLYPWGIAEVDSSEHCDLAKLRTMLIRTHMQDLKDVTRDLHYEEHRARCIRLSC 316          
BLAST of Septin vs. Ensembl Sea Lamprey
Match: SEPTIN7 (septin 7 [Source:HGNC Symbol;Acc:HGNC:1717])

HSP 1 Score: 167.162 bits (422), Expect = 3.640e-49
Identity = 91/216 (42.13%), Postives = 132/216 (61.11%), Query Frame = 2
Query:  185 KPIAA-TGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRT-----QFPQNT----KTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRL 802
            KP+    GF+ +  Q+YRKS   GF+F LM+VG SGLGKST +NSLF T     ++P  +    KT  V ++   L E  V+LTL +++ P FGD ++NS  W+ I DY++      LN E+++NR    +  D  VH CLYFI P   +  LK LD+EFMK +H KV++IP+IAKADS+T  E Q  K  ++ E+  H+I  ++F  +E+   +L
Sbjct:   11 KPLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYASEYPGPSQRVRKTLQVEQSKVVLKEGGVQLTLTIVDTPGFGDAVDNSSCWQSIIDYIDSKCEDYLNAEARVNR---RLMPDSRVHCCLYFIFPSGHQ--LKPLDIEFMKRLHDKVNIIPLIAKADSLTTEECQQFKKTIMKEILEHKIKIYEFPDVEDDDEKL 221          
BLAST of Septin vs. Ensembl Sea Lamprey
Match: SEPTIN9 (septin 9 [Source:HGNC Symbol;Acc:HGNC:7323])

HSP 1 Score: 170.244 bits (430), Expect = 6.405e-49
Identity = 103/311 (33.12%), Postives = 163/311 (52.41%), Query Frame = 2
Query:  182 LKPIAATGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQFPQNTKTSGVVENTYKLIE----------NDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLI-ERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSE 1081
            L      G   + +Q+ RK+   GF+FN+M+VG SGLGKST +N+LF++   + + T    E   K +E            V++ L +I+ P FGD+INN+  W+ +  Y+   + K L  E  +N T  ++  D  VH C+YFI      + L  LD+EFMK +   V+++P+IAK+D++T  E Q  K  +  +L    I+ +  K  +E             +E R V + I E  PFAVVG  +  + +  + L R   WG IE++N+ H + + +R LL+ +H Q+L   +  V YE +R   LSE
Sbjct:   41 LDAFGYVGIDAVLEQMRRKAMKQGFEFNIMVVGQSGLGKSTLVNTLFKSPVSRKSCTPNHEEKIPKTVEIKSVSHVIEEKGVKMKLTVIDTPGFGDQINNNNCWEPVLKYINDQYEKYLAEE--VNITRKKVIPDSRVHCCIYFIPATGHSLRL--LDIEFMKRLGKVVNIVPVIAKSDTLTLEERQAFKKKIREQLETQGISIYPHKEHDED------------EEDRSVNNKIRELMPFAVVGSDKDYLVNGRKTLGRKTKWGIIEIENVAHCEFSQLRELLIRSHTQDLKEVTSCVHYEGYRVLRLSE 335          
BLAST of Septin vs. Ensembl Sea Lamprey
Match: SEPTIN9 (septin 9 [Source:HGNC Symbol;Acc:HGNC:7323])

HSP 1 Score: 157.147 bits (396), Expect = 1.260e-44
Identity = 93/279 (33.33%), Postives = 152/279 (54.48%), Query Frame = 2
Query:  278 GCSGLGKSTFLNSLFRTQFPQNTKTSGVVENTYKLIE----------NDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEIN-YFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSE 1081
            G SGLGKST +N+LF+++  + + T    E   K +E            V++ L +I+ P FGD+INN   W+ I  Y+ + + K L  E +I R  +    D  VH C+Y I P      L+ LD+EFM+++   V ++P+I KAD++T  E  + +  + A+L  H I+ Y + +  E+   RLE+              + E+ PFAVVG       +  +VL R   WG +EV+N++H + A +R LL+ +H+++L   +HS++YE +R R L+E
Sbjct:    1 GQSGLGKSTLVNTLFKSRVSRKSCTPNYQERILKTVEIQSVSHVIEERGVKMKLTVIDTPGFGDQINNENCWEPILKYIGEQYEKYLREEVRITRKRH--IPDTRVHCCIYCIPPSGHS--LRPLDVEFMQHLSKVVSVVPVITKADTLTLEERHLFRQRIQADLVAHGIDVYPQREFDEDEQGRLEN------------AEVREKIPFAVVGSDREYQENGRRVLGRKTRWGLVEVENINHCEFALLRDLLIRSHMEDLKDVTHSILYETYRVRRLNE 263          
BLAST of Septin vs. Ensembl Yeast
Match: CDC12 (Component of the septin ring that is required for cytokinesis; septins are GTP-binding proteins that assemble into rod-like hetero-oligomers that can associate with other rods to form filaments; septin rings at the mother-bud neck act as scaffolds for recruiting cell division factors and as barriers to prevent diffusion of specific proteins between mother and daughter cells [Source:SGD;Acc:S000001149])

HSP 1 Score: 167.548 bits (423), Expect = 2.245e-47
Identity = 113/321 (35.20%), Postives = 170/321 (52.96%), Query Frame = 2
Query:  203 GFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQFPQNTKTSGVVENTYKLIENDV----------ELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKD-QVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQNLGIVTENQHHPSV 1132
            G S +  Q Y+     G  F +M+ G SGLGK+TF+N+LF+T   +        E   K +E D+          EL + +I+ P FGD +NN+K+W+ + D+++      +  E +  RT      D  VHA LYFI+P      LK +D+E MK +  + +LIP+IAKAD++TA ELQ  KS +   +   EI  F   +  +S    +S            + LIE  PFA+VG ++   N +  QV+ R YPWG +E++N  H D   +RALLL T+L +LIST+  + YE +R   L E  +N G   E+   P++
Sbjct:   16 GISNLPNQRYKIVNEEGGTFTVMLCGESGLGKTTFINTLFQTVLKRADGQQHRQEPIRKTVEIDITRALLEEKHFELRVNVIDTPGFGDNVNNNKAWQPLVDFIDDQHDSYMRQEQQPYRTK---KFDLRVHAVLYFIRPTGH--GLKPIDIETMKRLSTRANLIPVIAKADTLTAQELQQFKSRIRQVIEAQEIRIFTPPLDADSKEDAKSGSNPDSAAVEHARQLIEAMPFAIVGSEKKFDNGQGTQVVARKYPWGLVEIENDSHCDFRKLRALLLRTYLLDLISTTQEMHYETYRRLRL-EGHENTGEGNEDFTLPAI 330          
BLAST of Septin vs. Ensembl Yeast
Match: CDC3 (Component of the septin ring that is required for cytokinesis; septins are GTP-binding proteins that assemble with other septins into rod-like complexes that can associate with other rods to form filament polymers; septin rings at the mother-bud neck act as scaffolds for recruiting factors needed for cell division and as barriers to prevent diffusion of specific proteins between mother and daughter cells [Source:SGD;Acc:S000004306])

HSP 1 Score: 169.859 bits (429), Expect = 2.316e-47
Identity = 128/405 (31.60%), Postives = 203/405 (50.12%), Query Frame = 2
Query:  200 TGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQFPQNTKTSGVVE-----------------------------NTYKLI--ENDVELTLKLIEVPKFGDKINNS-KSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMIN-DKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQNLGIVTEN---QHHPSVYLEKYFKLLH-VSLAKKINEMESGFKELVHKRESALLNKAKDLEEQSEVMADELNQAL 1303
             GF+ + +Q +R+S  NGF FNL+ VG  G+GK+T + +LF     +        E                              +Y+ +  EN V+L L +I+   FGD +NN  KSW  I   ++  F + L+ E+KINR S     D  +HACLYFI+P      LK LDL+FM++V+ K +LIP+IAK+D +T  E+   K  ++ +L    I  FK  +                +   + + L    P+AV+G  + + N   +QV  RSYPWG IEVDN +HSD   ++ LL+   ++EL   +  ++YEN+RS  L++    LGI  +N   +    +  ++  K LH   LAK   EM++ F++ V ++E  L     +L  + + M ++L + L
Sbjct:  100 VGFANLPKQWHRRSIKNGFSFNLLCVGPDGIGKTTLMKTLFNNDDIEANLVKDYEEELANDQEEEEGQGEGHENQSQEQRHKVKIKSYESVIEENGVKLNLNVIDTEGFGDFLNNDQKSWDPIIKEIDSRFDQYLDAENKINRHS---INDKRIHACLYFIEPTGH--YLKPLDLKFMQSVYEKCNLIPVIAKSDILTDEEILSFKKTIMNQLIQSNIELFKPPIYSNDD----------AENSHLSERLFSSLPYAVIGSNDIVENYSGNQVRGRSYPWGVIEVDNDNHSDFNLLKNLLIKQFMEELKERTSKILYENYRSSKLAK----LGIKQDNSVFKEFDPISKQQEEKTLHEAKLAKLEIEMKTVFQQKVSEKEKKLQKSETELFARHKEMKEKLTKQL 485          
BLAST of Septin vs. Ensembl Yeast
Match: CDC10 (Component of the septin ring, required for cytokinesis; septins are GTP-binding proteins that assemble into rod-like hetero-oligomers that can associate to form filaments; septin rings at the mother-bud neck act as scaffolds for recruiting cell division factors and as barriers to prevent diffusion of specific proteins between mother and daughter cells; N-terminus interacts with phosphatidylinositol-4,5-bisphosphate; protein abundance increases under DNA damage stress [Source:SGD;Acc:S000000595])

HSP 1 Score: 160.614 bits (405), Expect = 1.053e-45
Identity = 105/315 (33.33%), Postives = 169/315 (53.65%), Query Frame = 2
Query:  182 LKPIAATGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQFPQN-----------TKTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQN 1093
            ++P +  GF  I  QI  +    GFQFN+M+VG SGLGKST +N+LF +    +           TKT+ +  +T+ L+E+ V L + +I+ P FGD I+NSK+W+ I  Y+++  ++ L  E    R       D  VHA LYF+QP   +  L  LD+E +K +    ++IP+I K+D++T     +++     EL  +E   + FK+     +  E     +L+  R V+S+I   PFAVVG +  +  + +    R   W  I V++++  D   +R  L+ THLQ+LI T+  + YE  R+R L  L +N
Sbjct:    7 VQPASYVGFDTITNQIEHRLLKKGFQFNIMVVGQSGLGKSTLINTLFASHLIDSATGDDISALPVTKTTEMKISTHTLVEDRVRLNINVIDTPGFGDFIDNSKAWEPIVKYIKEQHSQYLRKELTAQR--ERFITDTRVHAILYFLQPNGKE--LSRLDVEALKRLTEIANVIPVIGKSDTLT-----LDERTEFRELIQNEFEKYNFKIYP---YDSEELTDEELELNRSVRSII---PFAVVGSENEIEINGETFRGRKTRWSAINVEDINQCDFVYLREFLIRTHLQDLIETTSYIHYEGFRARQLIALKEN 306          
BLAST of Septin vs. Ensembl Yeast
Match: CDC11 (Component of the septin ring that is required for cytokinesis; present at the ends of rod-like septin hetero-oligomers; C-terminal extension is important for recruitment of Bni5p to the mother-bud neck, which in turn is required for Myo1p recruitment and cytokinesis; septin rings at the mother-bud neck act as scaffolds for recruiting cell division factors and as barriers to prevent diffusion of specific proteins between mother and daughter cells [Source:SGD;Acc:S000003837])

HSP 1 Score: 155.606 bits (392), Expect = 5.645e-43
Identity = 98/299 (32.78%), Postives = 162/299 (54.18%), Query Frame = 2
Query:  233 RKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQ---------FPQNTKTS---GVVENTYKLIEND-VELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEE--SGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQE--SMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLS 1078
            RK    G  F +MIVG SG G+STF+N+L   Q          P +T T     + E T +L +++ V++ L +I+ P FGD ++NS S++ I DY+   + + L  ES++ R  N    D  VH CLY I P      LK++D+EF++ +   V++IP+I+K+DS+T  EL++NK  ++ ++    +  + F   E+  S    E+N +++              PFA++G  E   M  D   +  R YPWG ++V++   SD   +R  LL +HL +L + +H ++YE +R+  LS
Sbjct:   14 RKHLKRGITFTVMIVGQSGSGRSTFINTLCGQQVVDTSTTILLPTDTSTEIDLQLREETVELEDDEGVKIQLNIIDTPGFGDSLDNSPSFEIISDYIRHQYDEILLEESRVRR--NPRFKDGRVHCCLYLINPTGH--GLKEIDVEFIRQLGSLVNIIPVISKSDSLTRDELKLNKKLIMEDIDRWNLPIYNFPFDEDEISDEDYETNMYLRTL-----------LPFAIIGSNEVYEMGGDVGTIRGRKYPWGILDVEDSSISDFVILRNALLISHLHDLKNYTHEILYERYRTEALS 297          
BLAST of Septin vs. Ensembl Yeast
Match: SPR28 (Sporulation-specific homolog of the CDC3/10/11/12 family of genes; meiotic septin expressed at high levels during meiotic divisions and ascospore formation; the yeast CDC3/10/11/12 family is a family of bud neck microfilament genes [Source:SGD;Acc:S000002626])

HSP 1 Score: 138.272 bits (347), Expect = 1.582e-36
Identity = 105/340 (30.88%), Postives = 166/340 (48.82%), Query Frame = 2
Query:  233 RKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQF-------------------PQNTKTSGVVENTYKLIE--------------ND---VELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKM-------------LEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQV-LVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQNLGI 1102
            RK    G Q +++++G  G GKSTFLN+L                        P+N      ++  YK                 ND   V +TL +I  P  GD ++NS+S   I +YL++ FA  L  E +I R + E   D   H CLYF+  KS    +K  D+E MK +  KV+LIPII KAD +T +EL ++K  +  E+  + I  F FK              ++ S  + + +   K++E           PFA+V  +    N +++V  +R+Y WG + V++ + SD   ++A+LL +HLQEL   +++V+YEN+R++ L+E   N  I
Sbjct:   23 RKGYKKGLQLSILLLGEKGSGKSTFLNNLCGQDISLSDGDYDDDDDKVTNNVTPENGNAIEDIDPGYKTAHLSPGLKLVTRRVYLNDELGVPITLDIILFPGCGDNVDNSQSSVVIKNYLDQQFANVLKEEVRIKRNTKE--TDGRPHVCLYFL--KSTPRGVKKFDIELMKTICDKVNLIPIIPKADGLTETELNLHKDIVRQEISQNNIRVFDFKSDTLGETLALYDMDIDSSSAKSKYDNDTKIKEIS---------PFAIVCSKTFNKNSENRVEHIRTYEWGSLVVEDQNTSDFIYLKAILLGSHLQELKDVTNNVLYENYRAKVLTEKKNNYDI 349          
BLAST of Septin vs. Ensembl Nematostella
Match: EDO34522 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP25])

HSP 1 Score: 206.068 bits (523), Expect = 3.291e-61
Identity = 115/306 (37.58%), Postives = 175/306 (57.19%), Query Frame = 2
Query:  200 TGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQF--PQN--------TKTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLE-ESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSEL 1084
             GF+ +  Q++RKS   GF+F +M+VG SGLGKST LNSLF T    P +         KT  V   T +L E  V L L +++ P FGD ++N+  WK +  Y++  F + LN ES++ R+      D+ VH CLYFI P      LK LD+EFMK +H KV+++P+I+KAD++T  E    K  +L E+  + I+ ++F  L  E    L++   V +++K          PFAVVG    +  +  +V  R YPWG +EV+N++H D  A+R +L+ TH+Q+L   ++   YEN+R   L+ +
Sbjct:    5 VGFANLPNQVFRKSVKKGFEFTVMVVGESGLGKSTLLNSLFLTDLYTPSSYPSIKEKLNKTVEVKPCTVELKEGGVRLRLTVVDTPGFGDAVDNTDCWKPVIKYIDSKFEEHLNAESRVQRSP---FPDNRVHCCLYFISPTGHS--LKPLDIEFMKKLHNKVNIVPVISKADTLTTEECTRFKKQILQEIKENNISIYEFPDLGGEEDAELDA---VNMRDK---------VPFAVVGSNTVLEVNGKRVRARVYPWGVVEVENVEHCDFVALRNMLIRTHMQDLKDVTNDAHYENYRCDKLASM 293          
BLAST of Septin vs. Ensembl Nematostella
Match: EDO47409 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLX3])

HSP 1 Score: 199.134 bits (505), Expect = 3.035e-59
Identity = 112/305 (36.72%), Postives = 168/305 (55.08%), Query Frame = 2
Query:  191 IAATGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQF-------PQNTKTSGVV---ENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTL 1075
            +A  GF+ +  Q++RKS   GF+F LM+VG SGLGKST ++SLF T         P   +    V    NT ++ E  V L L +++ P F D ++N+ SW+ I DY++  F   L  ES +NR +     D  VH CLYFI P      L+ +D+EFMK +H KV+++P+IAK+DS+T +E+   K  +L E+  HEI  + F   +      +   F+ +      + L    PFAV+G    +     +V  R YPWG  EV+N DH D   +R +L+ TH+Q+L   +  V YEN+R++ L
Sbjct:   15 VAYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLIDSLFLTDLYDDKSIPPAKGRIGQTVHIESNTVEIEEKGVRLRLTVVDTPGFADAVDNTYSWEPIVDYIDHQFESYLRDESGLNRRN---IMDTRVHCCLYFINPHGH--GLRPVDVEFMKALHTKVNIVPVIAKSDSLTKTEISRLKRKVLDEIADHEIKIYSFPECDSE----DDEEFLAIN-----KDLKASLPFAVIGSNTVIEVKGRKVRARWYPWGYAEVENPDHCDFIKLRNMLVRTHMQDLKDVTQDVHYENYRAQRL 305          
BLAST of Septin vs. Ensembl Nematostella
Match: EDO37950 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE59])

HSP 1 Score: 195.667 bits (496), Expect = 5.455e-58
Identity = 122/358 (34.08%), Postives = 190/358 (53.07%), Query Frame = 2
Query:  179 KLKPIAATGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQF---PQNTKTSGVV--ENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQNLGIVTENQHHPSVYLEKYFKLLHVSLAKKINEMESGFKELVHKRESAL 1237
            +L+     GF  +  Q+  KS N GF FN++ +G +G+GKST +++LF+T F   P +    GV    +TY L E++V L L +++   +GD+IN   S   I +Y+++ F   L+ E KI RT +    D  +HACLYFI P      LK LDL  MK +  KV++IPIIAKAD++  SEL+  K  ++ EL  + +  ++F + +E+   + S             ++    PFAVVG +E ++ +K +   R YPWG +EV+N +H D   +R +L+ T++Q LI  +H+V YE  R   L E+  N G      H      E+  K        K  +M   F + V  +E+ L
Sbjct:   18 QLRLAGHVGFDSLPDQLVNKSVNRGFAFNILCIGETGIGKSTLMDTLFQTTFEGQPHSHHLPGVQIEHHTYDLNESNVMLKLTIVDTVGYGDQINKEDSSSSIVNYIDQQFDTYLHQELKIKRTMDTFH-DTRIHACLYFISPTGH--SLKSLDLVCMKQLDKKVNIIPIIAKADTIAKSELKQFKQKIMDELESNGVEIYRFPVDDETVAEMNS-------------TMNNEIPFAVVGSREEVMVNKTKSRARVYPWGTVEVENENHCDFVKLREMLIRTNMQSLIDKTHTVHYELFRRNKLEEMGFNDGDANNKSHSLQETYEERRKEYMSQFQDKEEKMRQRFVQKVKDKENEL 359          
BLAST of Septin vs. Ensembl Nematostella
Match: EDO33106 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST61])

HSP 1 Score: 169.474 bits (428), Expect = 3.543e-49
Identity = 101/278 (36.33%), Postives = 150/278 (53.96%), Query Frame = 2
Query:  200 TGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQFPQNT----------KTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLL 1003
             GF+ +  Q++RKS   GF+F LM+VG SGLGKST ++SLF T    +           KT  +  +T ++ E  V+L L +++ P +GD IN+  S+K I DY    F   L  ES +NR       D  VH C YFI P      LK LD+EFMK +H+ V+++P+I KAD++T +EL+  K  +L E+  + I  ++    +      E   F++       + L E  PFAVVG    +     +V  R YPWG +EV+N  H D + +RA+L+
Sbjct:    5 VGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLIDSLFLTDLYSDRKILSAEERIKKTVKIETSTVEIEERGVKLRLTVVDTPGYGDGINHKNSFKPILDYANNQFESYLKDESGLNRRH---IIDSRVHCCFYFIAPTGHG--LKPLDIEFMKALHHIVNIVPVIGKADTLTPTELKEMKRRVLDEIDEYGIQIYELPQCDSD----EDEEFIE-----QTRQLKEGMPFAVVGSNTLIDVCGKKVRGRLYPWGVVEVENPIHCDFSKLRAMLM 268          
BLAST of Septin vs. Ensembl Nematostella
Match: EDO47975 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKG1])

HSP 1 Score: 145.591 bits (366), Expect = 4.001e-41
Identity = 80/195 (41.03%), Postives = 111/195 (56.92%), Query Frame = 2
Query:  203 GFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQFPQNT---------KTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEIN 760
            GF  + +QI RKS   GF+FNLM+VG SGLGKST +N+LF+ +  + T         KT  V   ++ + E  V L L + + P FGD+INN K W+ I DY+   + K L  E  I R       D  VH CLYFI P   +  LK +D+EFMK +   V+++P+IAKAD+MT  E +  +  L  ++  H IN
Sbjct:    4 GFDTVQEQIRRKSLKRGFEFNLMVVGASGLGKSTMVNTLFKGKLSRPTSTGKPTIIPKTVDVKSVSHVIEEKGVRLKLTITDTPGFGDQINNDKCWEPIMDYINSQYDKFLTEEVTIERKPR--IPDSRVHCCLYFIAPTGHR--LKPIDVEFMKRLDKCVNIVPVIAKADNMTLEEREAFRRRLREDIQAHNIN 194          
BLAST of Septin vs. Ensembl Medaka
Match: sept15 (septin-7-like [Source:NCBI gene;Acc:105358736])

HSP 1 Score: 226.483 bits (576), Expect = 1.407e-68
Identity = 146/414 (35.27%), Postives = 225/414 (54.35%), Query Frame = 2
Query:  182 LKPIAA------TGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQ-----FP---QNTKTSGVVENTYKLI-ENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQNLGIVTENQH-----HPSVYLEKYFKLLHVSLAKKINEMESGFKELVHKRESALLNKAKDLEEQSEVMADELNQALCEFDRDFTKFIAVKTEWDCE 1363
            L PIA        GF+ +  Q+YRKS   GF+F LM+VG SGLGKST +NSLF T      +P   Q  K +  VE +  LI E  V+LTL +++ P FGD ++NS  W+ + +Y++      LN ES++NR S     D+ VH CLYFI P      LK LD+EFMK +H KV++IP+IAKAD++T  E Q+ K  ++ E+  H+I  ++F   EE             ++ ++++ + E+ P AVVG    +  +  +V  R YPWG  EV+N +H D   +R +L+ TH+Q+L   +++V YEN+RSR L+ +  N G+ T  ++      P   +E+  +   + + K   EME  F+  V +++  L +   +LE + E M   L     E +     F   K  W+ +
Sbjct:    9 LPPIAQRNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSKDYPGPSQRIKKTVQVEQSKVLIKEGGVQLTLTIVDTPGFGDAVDNSNCWQPVINYIDSKCEDFLNAESRVNRRS---MPDNRVHCCLYFIAPSGH--GLKPLDIEFMKRLHDKVNVIPLIAKADTLTPEECQLFKKQIMKEIQEHKIKIYEFPDTEED------------EDNKLIRKIKEKMPLAVVGSNVVVEVNGKKVRGRQYPWGVAEVENGEHCDFTVLRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTCN-GVDTSKRNGQLTKSPLAQMEEERREHVMKMKKMEAEMEQVFELKVKEKKQKLKDSEAELERRHEQMKRNLEAQYKELEEKRRVFEEEKANWEAQ 404          
BLAST of Septin vs. Ensembl Medaka
Match: sept7b (septin-7 [Source:NCBI gene;Acc:101155717])

HSP 1 Score: 224.557 bits (571), Expect = 6.900e-68
Identity = 118/307 (38.44%), Postives = 180/307 (58.63%), Query Frame = 2
Query:  200 TGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRT-----QFPQNT----KTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQN 1093
             GF+ +  Q+YRKS   GF+F LM+VG SGLGKST +NSLF T     ++P  +    KT  V ++   + E  V+L L +++ P FGD ++NS  W+ + D+++  F   LN ES++NR       D  +H CLYFI P      LK LD+EFMK +H KV++IP+IAKAD++T  E Q  K  ++ E+  H+I  ++F   ++             +E R+V+ + ++ P AVVG    +  +  +V  R YPWG  EV+N DH D   +R +L+ TH+Q+L   +++V YEN+RSR L+ +  N
Sbjct:   11 VGFASLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSAEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDHIDSKFEDYLNAESRVNRRQ---MPDSRIHCCLYFIAPSGH--GLKPLDIEFMKRLHEKVNVIPLIAKADTLTPEECQQFKKQIMREIQEHKIKIYEFPETDDE------------EENRLVKKIKDKLPLAVVGSNTIIEVNSKRVRGRQYPWGVAEVENSDHCDFTILRDMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN 300          
BLAST of Septin vs. Ensembl Medaka
Match: sept7b (septin-7 [Source:NCBI gene;Acc:101155717])

HSP 1 Score: 224.172 bits (570), Expect = 9.218e-68
Identity = 118/307 (38.44%), Postives = 180/307 (58.63%), Query Frame = 2
Query:  200 TGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRT-----QFPQNT----KTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQN 1093
             GF+ +  Q+YRKS   GF+F LM+VG SGLGKST +NSLF T     ++P  +    KT  V ++   + E  V+L L +++ P FGD ++NS  W+ + D+++  F   LN ES++NR       D  +H CLYFI P      LK LD+EFMK +H KV++IP+IAKAD++T  E Q  K  ++ E+  H+I  ++F   ++             +E R+V+ + ++ P AVVG    +  +  +V  R YPWG  EV+N DH D   +R +L+ TH+Q+L   +++V YEN+RSR L+ +  N
Sbjct:   11 VGFASLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSAEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDHIDSKFEDYLNAESRVNRRQ---MPDSRIHCCLYFIAPSGH--GLKPLDIEFMKRLHEKVNVIPLIAKADTLTPEECQQFKKQIMREIQEHKIKIYEFPETDDE------------EENRLVKKIKDKLPLAVVGSNTIIEVNSKRVRGRQYPWGVAEVENSDHCDFTILRDMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN 300          
BLAST of Septin vs. Ensembl Medaka
Match: sept7b (septin-7 [Source:NCBI gene;Acc:101155717])

HSP 1 Score: 224.557 bits (571), Expect = 2.504e-67
Identity = 118/306 (38.56%), Postives = 180/306 (58.82%), Query Frame = 2
Query:  203 GFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRT-----QFPQNT----KTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQN 1093
            GF+ +  Q+YRKS   GF+F LM+VG SGLGKST +NSLF T     ++P  +    KT  V ++   + E  V+L L +++ P FGD ++NS  W+ + D+++  F   LN ES++NR       D  +H CLYFI P      LK LD+EFMK +H KV++IP+IAKAD++T  E Q  K  ++ E+  H+I  ++F   ++             +E R+V+ + ++ P AVVG    +  +  +V  R YPWG  EV+N DH D   +R +L+ TH+Q+L   +++V YEN+RSR L+ +  N
Sbjct:   12 GFASLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSAEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDHIDSKFEDYLNAESRVNRRQ---MPDSRIHCCLYFIAPSGH--GLKPLDIEFMKRLHEKVNVIPLIAKADTLTPEECQQFKKQIMREIQEHKIKIYEFPETDDE------------EENRLVKKIKDKLPLAVVGSNTIIEVNSKRVRGRQYPWGVAEVENSDHCDFTILRDMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN 300          
BLAST of Septin vs. Ensembl Medaka
Match: ENSORLT00000010965.2 (septin-7 [Source:NCBI gene;Acc:101158211])

HSP 1 Score: 219.935 bits (559), Expect = 6.034e-66
Identity = 145/399 (36.34%), Postives = 218/399 (54.64%), Query Frame = 2
Query:  194 AATGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRT-----QFPQNT---KTSGVVENTYKLI-ENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQNLGIVTENQHH-------------PSVYLEKYFKLLHVSLAKKINEMESGFKELVHKRESALLNKAKDLEEQSEVMADELNQALCEFDRDF 1324
            A  GF+ +  Q+YRKS   GF+F LM+VG SGLGKST +NSLF T     ++P  +   K +  VE +  LI E  V+L L +++ P FGD ++NS  WK + DY++  F   LN ES++NR       D  VH CLYFI P      LK LD EFMK +H KV++IP+IAKAD++T  E Q  K  ++ E+  +EI  ++F   E+             +E +MV+ + +R P AVVG    +  D  +V  R YPWG  EV+N +H D   +R +L+ TH+Q+L   +++V YEN RS  L+ +  N G+  EN+H+             P   +E+  +     + K   EME+ F+  V ++    L K +D E + +   D++N+++    RD 
Sbjct:   26 AYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKQTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSGCWKSVTDYIDSKFEDFLNAESRVNRRQ---MPDSRVHCCLYFIAPSGHG--LKPLDTEFMKYLHEKVNIIPLIAKADTLTPEECQQFKRQIMKEIQENEIKIYEFPETEDE------------EEMKMVKKIKDRLPLAVVGSNTIIEVDGKRVRGRKYPWGVAEVENSEHCDFMILRNMLIRTHMQDLKDVTNNVHYENFRSGKLAAVTCN-GV--ENKHNGQLTKTDTSDGMSPLAQMEEERQENMGRIKKMEQEMENVFEMKVKEK----LQKLRDSEAELQKRHDQMNRSILAQHRDL 400          
BLAST of Septin vs. Planmine SMEST
Match: SMESG000079489.1 (SMESG000079489.1)

HSP 1 Score: 933.71 bits (2412), Expect = 0.000e+0
Identity = 451/452 (99.78%), Postives = 452/452 (100.00%), Query Frame = 2
Query:   59 MIPKPKVYALKSSTEKLDEIPEKESSKQNMNNLEKILMNYKLKPIAATGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQFPQNTKTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQNLGIVTENQHHPSVYLEKYFKLLHVSLAKKINEMESGFKELVHKRESALLNKAKDLEEQSEVMADELNQALCEFDRDFTKFIAVKTEWDCENIDYHETYGTLRITRNG 1414
            MIPKPKVYALKSSTEKLDEIPEKESSKQNMNNLEKILMNYKLKPIAATGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQFPQNTKTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADH+VHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQNLGIVTENQHHPSVYLEKYFKLLHVSLAKKINEMESGFKELVHKRESALLNKAKDLEEQSEVMADELNQALCEFDRDFTKFIAVKTEWDCENIDYHETYGTLRITRNG
Sbjct:    1 MIPKPKVYALKSSTEKLDEIPEKESSKQNMNNLEKILMNYKLKPIAATGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQFPQNTKTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHIVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQNLGIVTENQHHPSVYLEKYFKLLHVSLAKKINEMESGFKELVHKRESALLNKAKDLEEQSEVMADELNQALCEFDRDFTKFIAVKTEWDCENIDYHETYGTLRITRNG 452          
BLAST of Septin vs. Planmine SMEST
Match: SMESG000016474.1 (SMESG000016474.1)

HSP 1 Score: 236.498 bits (602), Expect = 1.246e-71
Identity = 142/416 (34.13%), Postives = 225/416 (54.09%), Query Frame = 2
Query:  173 NYKLKPIAATGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQF------PQNTKTSGVVE---NTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRL--------ESNWF-VKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQNLGIVTENQHHPSVYLEKYFKLLHVSLAKKINEMESGFKELVHKRESALLNKAKDLEEQSEVMADELNQALCEFDRDFTKFIAVKTEWDCEN 1366
            N K++ +   GF  +  QIYR+S  NGF+FNLM+VGCSGLGKSTF+N+LF ++       P   +T   V     T  + EN V L L LI+ P FGD ++NS+ W  +  Y+E  + + ++ +++++R  N I  D+ VHACLYFI+P      LK LDLEFMK +H KV++IPIIAKAD++   E    K  +L ++  + I  + F   E +   L        E+NW  + ++ KR         PFAVV     +    ++V  R+YPWG +EVDNL+H+D +A+R LLLS+HLQ++  T+  V++EN+R   +S   ++      +   P   +++  +     + K   +M + F++ V ++   L    + +E     M  +L   + E +     F A +  W+  N
Sbjct:   75 NSKMRLVKNIGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKTVHINTTTVNITENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHR--NRI-VDNRVHACLYFIEPTGH--GLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPE-EAAAISLGVTVAKARETNWKDITIKRKRQ--------PFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETN 476          
BLAST of Septin vs. Planmine SMEST
Match: SMESG000064397.1 (SMESG000064397.1)

HSP 1 Score: 230.335 bits (586), Expect = 2.016e-69
Identity = 138/405 (34.07%), Postives = 219/405 (54.07%), Query Frame = 2
Query:  173 NYKLKPIAATGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQFPQNT----------KTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQNLGIVTENQHHPSVYLEKYFKLLHVSLAKKINEMESGFKELVHKRESALLNKAKDLEEQSEVMADELNQALCEFDRDFTKFIAVKTEWD 1357
            N KL  +   GF  +  Q+Y+++   GF+FNLM+VGCSGLGKSTF+NSL  + F  NT          KT  +   T  L ENDV L L L++ P FGD ++NS  W  I +Y++  F + ++ E+K+NR    I  D  +HAC+YFIQP      LK LD+EFMK +H KV++IP+I K+D+MT  E +  K N+L +L  H+I  + F    ESG    ++      E   ++   E+ PF+V+G    +  +  ++  R YPWG +EV+N +H+D   ++ +++ THL +L   +   +YE +R   +S++ ++      +   P + LE         + K   EM+  F++   +R + L     DLE++ E M  +L     E +    KF   K++W+
Sbjct:   66 NKKLDVLYKIGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDF-YNTEYLGPSKRIKKTVYIEPTTVILKENDVALKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRL---IFPDKRIHACIYFIQPTGHN--LKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFP---ESGAAYSAS--DNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIAEDSNFNVSDGKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWE 459          
BLAST of Septin vs. Planmine SMEST
Match: SMESG000064397.1 (SMESG000064397.1)

HSP 1 Score: 228.409 bits (581), Expect = 5.797e-69
Identity = 136/404 (33.66%), Postives = 218/404 (53.96%), Query Frame = 2
Query:  176 YKLKPIAATGFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQFPQNT----------KTSGVVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQNLGIVTENQHHPSVYLEKYFKLLHVSLAKKINEMESGFKELVHKRESALLNKAKDLEEQSEVMADELNQALCEFDRDFTKFIAVKTEWD 1357
            Y+   +   GF  +  Q+Y+++   GF+FNLM+VGCSGLGKSTF+NSL  + F  NT          KT  +   T  L ENDV L L L++ P FGD ++NS  W  I +Y++  F + ++ E+K+NR    I  D  +HAC+YFIQP      LK LD+EFMK +H KV++IP+I K+D+MT  E +  K N+L +L  H+I  + F    ESG    ++      E   ++   E+ PF+V+G    +  +  ++  R YPWG +EV+N +H+D   ++ +++ THL +L   +   +YE +R   +S++ ++      +   P + LE         + K   EM+  F++   +R + L     DLE++ E M  +L     E +    KF   K++W+
Sbjct:   52 YQTNVLYKIGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDF-YNTEYLGPSKRIKKTVYIEPTTVILKENDVALKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRL---IFPDKRIHACIYFIQPTGHN--LKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFP---ESGAAYSAS--DNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIAEDSNFNVSDGKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWE 444          
BLAST of Septin vs. Planmine SMEST
Match: SMESG000076922.1 (SMESG000076922.1)

HSP 1 Score: 188.348 bits (477), Expect = 4.226e-54
Identity = 110/304 (36.18%), Postives = 176/304 (57.89%), Query Frame = 2
Query:  203 GFSKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQF---PQNTKTSGVVENTYK-------LIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQLNVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKVHLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLESNWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKD---QVLVRSYPWGKIEVDNLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTL 1075
            GF+ + +Q+ RK+   GF F LMIVG SGLGKSTF+NSL        P+++ +  ++ +T K       L E  V+L L +++ P FGD ++  + WK I +Y+++ F +    E  INR + +   D+ VH CLYFI P    I  K +D+E MK +H+KV+++PIIAKADS+T SEL+I K  ++ +L  ++IN+++  +    G   E  +  +  E R         PF+VVG   ++I D D   ++  R Y WG  EV+N  H +   +R  +L TH+Q+L   ++ ++YEN+R + +
Sbjct:   49 GFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDSSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQ---DNRVHCCLYFISPTGHGI--KPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPIC---GSDEEDEFRAQDAEIRAA------LPFSVVGS--NIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQII 336          
The following BLAST results are available for this feature:
BLAST of Septin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SEPTIN75.493e-6738.44septin 7 [Source:HGNC Symbol;Acc:HGNC:1717][more]
SEPTIN79.043e-6738.44septin 7 [Source:HGNC Symbol;Acc:HGNC:1717][more]
SEPTIN41.421e-5835.18septin 4 [Source:HGNC Symbol;Acc:HGNC:9165][more]
SEPTIN43.249e-5835.29septin 4 [Source:HGNC Symbol;Acc:HGNC:9165][more]
SEPTIN43.786e-5735.29septin 4 [Source:HGNC Symbol;Acc:HGNC:9165][more]
back to top
BLAST of Septin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
unc-593.570e-6635.28pep chromosome:WBcel235:I:13629227:13633494:1 gene... [more]
unc-611.013e-4636.00pep chromosome:WBcel235:V:14731095:14733877:-1 gen... [more]
unc-611.060e-4636.00pep chromosome:WBcel235:V:14731095:14733877:-1 gen... [more]
unc-614.666e-4636.00pep chromosome:WBcel235:V:14731136:14734237:-1 gen... [more]
back to top
BLAST of Septin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pnut8.895e-6734.99gene:FBgn0013726 transcript:FBtr0088792[more]
pnut8.895e-6734.99gene:FBgn0013726 transcript:FBtr0088793[more]
Sep18.939e-5636.96gene:FBgn0011710 transcript:FBtr0077198[more]
Sep41.396e-5434.85gene:FBgn0259923 transcript:FBtr0074371[more]
Sep45.585e-5434.85gene:FBgn0259923 transcript:FBtr0074368[more]
back to top
BLAST of Septin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sept156.573e-7134.91septin 15 [Source:ZFIN;Acc:ZDB-GENE-061103-265][more]
sept157.586e-7134.91septin 15 [Source:ZFIN;Acc:ZDB-GENE-061103-265][more]
sept7a5.701e-6738.44septin 7a [Source:ZFIN;Acc:ZDB-GENE-040426-1008][more]
sept7a5.844e-6738.44septin 7a [Source:ZFIN;Acc:ZDB-GENE-040426-1008][more]
sept4a5.178e-5835.95septin 4a [Source:ZFIN;Acc:ZDB-GENE-051120-87][more]
back to top
BLAST of Septin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SEPTIN71.387e-6737.93septin 7 [Source:NCBI gene;Acc:100216295][more]
SEPTIN71.375e-6638.44septin 7 [Source:NCBI gene;Acc:100216295][more]
SEPTIN71.439e-6638.44septin 7 [Source:NCBI gene;Acc:100216295][more]
SEPTIN72.322e-6638.44septin 7 [Source:NCBI gene;Acc:100216295][more]
SEPTIN72.655e-6638.44septin 7 [Source:NCBI gene;Acc:100216295][more]
back to top
BLAST of Septin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sept75.889e-6738.44septin 7 [Source:MGI Symbol;Acc:MGI:1335094][more]
Sept77.588e-6738.44septin 7 [Source:MGI Symbol;Acc:MGI:1335094][more]
Sept42.485e-5935.18septin 4 [Source:MGI Symbol;Acc:MGI:1270156][more]
Sept41.527e-5835.29septin 4 [Source:MGI Symbol;Acc:MGI:1270156][more]
Sept41.819e-5735.29septin 4 [Source:MGI Symbol;Acc:MGI:1270156][more]
back to top
BLAST of Septin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9WVC0|SEPT7_RAT3.426e-6638.44Septin-7 OS=Rattus norvegicus OX=10116 GN=Septin7 ... [more]
sp|Q5R1W1|SEPT7_PANTR3.656e-6638.44Septin-7 (Fragment) OS=Pan troglodytes OX=9598 GN=... [more]
sp|O55131|SEPT7_MOUSE4.100e-6638.44Septin-7 OS=Mus musculus OX=10090 GN=Septin7 PE=1 ... [more]
sp|Q5R481|SEPT7_PONAB4.578e-6638.44Septin-7 OS=Pongo abelii OX=9601 GN=SEPTIN7 PE=2 S... [more]
sp|Q16181|SEPT7_HUMAN4.578e-6638.44Septin-7 OS=Homo sapiens OX=9606 GN=SEPTIN7 PE=1 S... [more]
back to top
BLAST of Septin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YX321.198e-7638.81Septin OS=Fasciola gigantica OX=46835 GN=FGIG_0232... [more]
A0A4Z2CUS12.812e-7237.23Septin-7 isoform 1 OS=Schistosoma japonicum OX=618... [more]
A0A183UMF39.841e-7240.50Septin-type G domain-containing protein OS=Toxocar... [more]
A0A4D5RKE81.107e-7135.44Putative septins p-loop gtpase (Fragment) OS=Ixode... [more]
F1L1Y81.503e-7139.67Septin-7 OS=Ascaris suum OX=6253 PE=2 SV=1[more]
back to top
BLAST of Septin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sept7a9.000e-6838.76septin 7a [Source:ZFIN;Acc:ZDB-GENE-040426-1008][more]
sept7a1.070e-6738.76septin 7a [Source:ZFIN;Acc:ZDB-GENE-040426-1008][more]
sept151.236e-6634.84septin-7-like [Source:NCBI gene;Acc:111195760][more]
sept158.872e-6534.49septin-7-like [Source:NCBI gene;Acc:111195760][more]
sept152.210e-6434.49septin-7-like [Source:NCBI gene;Acc:111195760][more]
back to top
BLAST of Septin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SEPTIN71.463e-6533.57septin 7 [Source:HGNC Symbol;Acc:HGNC:1717][more]
zgc:1622393.508e-6136.93zgc:162239 [Source:ZFIN;Acc:ZDB-GENE-070424-28][more]
SEPTIN73.640e-4942.13septin 7 [Source:HGNC Symbol;Acc:HGNC:1717][more]
SEPTIN96.405e-4933.12septin 9 [Source:HGNC Symbol;Acc:HGNC:7323][more]
SEPTIN91.260e-4433.33septin 9 [Source:HGNC Symbol;Acc:HGNC:7323][more]
back to top
BLAST of Septin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC122.245e-4735.20Component of the septin ring that is required for ... [more]
CDC32.316e-4731.60Component of the septin ring that is required for ... [more]
CDC101.053e-4533.33Component of the septin ring, required for cytokin... [more]
CDC115.645e-4332.78Component of the septin ring that is required for ... [more]
SPR281.582e-3630.88Sporulation-specific homolog of the CDC3/10/11/12 ... [more]
back to top
BLAST of Septin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO345223.291e-6137.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474093.035e-5936.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379505.455e-5834.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331063.543e-4936.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479754.001e-4141.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Septin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sept151.407e-6835.27septin-7-like [Source:NCBI gene;Acc:105358736][more]
sept7b6.900e-6838.44septin-7 [Source:NCBI gene;Acc:101155717][more]
sept7b9.218e-6838.44septin-7 [Source:NCBI gene;Acc:101155717][more]
sept7b2.504e-6738.56septin-7 [Source:NCBI gene;Acc:101155717][more]
ENSORLT00000010965.26.034e-6636.34septin-7 [Source:NCBI gene;Acc:101158211][more]
back to top
BLAST of Septin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000079489.10.000e+099.78SMESG000079489.1[more]
SMESG000016474.11.246e-7134.13SMESG000016474.1[more]
SMESG000064397.12.016e-6934.07SMESG000064397.1[more]
SMESG000064397.15.797e-6933.66SMESG000064397.1[more]
SMESG000076922.14.226e-5436.18SMESG000076922.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022889 ID=SMED30022889|Name=Septin|organism=Schmidtea mediterranea sexual|type=transcript|length=1482bp
CTTTTCAAATATAGTTTTAAAATAATATTTAATTTTCAATAAAGGTAATT
TTACAAGAATGATCCCTAAGCCAAAGGTTTACGCACTGAAATCATCAACC
GAAAAGCTTGATGAAATTCCAGAAAAAGAATCCTCTAAACAAAACATGAA
TAATTTAGAGAAAATTCTGATGAATTATAAACTGAAACCGATCGCAGCAA
CCGGCTTTAGTAAAATAGCTCAACAAATCTATCGCAAATCTACCAACAAT
GGATTTCAATTTAACCTAATGATAGTTGGCTGCAGTGGCTTGGGTAAATC
GACATTTCTCAACTCGTTATTCCGCACCCAATTTCCCCAGAACACAAAAA
CTTCTGGAGTCGTGGAAAACACTTATAAACTTATCGAAAACGATGTTGAA
TTAACTCTTAAATTAATCGAAGTTCCAAAATTCGGTGACAAAATCAACAA
CTCGAAATCGTGGAAAAAAATCGATGACTATCTCGAAAAATGCTTTGCTA
AACAATTGAATGTCGAATCGAAAATCAACCGAACATCAAATGAGATATCT
GCCGATCATTTAGTCCATGCTTGTCTGTATTTCATTCAACCGAAAAGCGA
CAAGATTTGTTTAAAAGATCTTGATTTGGAATTCATGAAAAATGTTCATT
ACAAGGTTCATCTGATTCCAATTATCGCCAAAGCTGATTCGATGACGGCC
AGTGAGTTGCAAATCAACAAATCGAATTTATTGGCCGAATTGCACTTGCA
CGAAATCAATTATTTTAAATTCAAAATGCTTGAAGAATCCGGATGGAGAC
TGGAATCAAACTGGTTTGTTAAGTTACAGGAGAAACGAATGGTTCAAAGT
CTCATTGAAAGATTTCCATTTGCAGTTGTCGGTGGACAAGAGTCAATGAT
AAACGACAAAGATCAAGTGTTGGTGAGATCATATCCTTGGGGCAAGATTG
AGGTGGATAATTTGGATCATTCTGACACGGCTGCGGTTCGAGCTCTTTTA
CTGTCCACGCATTTGCAGGAACTGATTAGCACGTCGCACTCGGTTGTTTA
CGAAAATCATCGGTCGAGGACACTGTCGGAATTGTGCCAAAACCTCGGAA
TCGTTACAGAAAATCAGCACCACCCTTCTGTATATTTGGAGAAATATTTC
AAATTATTGCATGTTTCTTTGGCGAAAAAGATCAACGAAATGGAATCAGG
GTTTAAAGAATTGGTCCACAAGCGGGAATCGGCTTTACTAAATAAAGCGA
AAGACCTTGAAGAACAATCTGAAGTAATGGCGGATGAGTTGAATCAAGCT
CTTTGTGAATTCGATCGAGATTTTACGAAATTTATCGCCGTCAAAACCGA
ATGGGACTGTGAAAATATTGACTATCACGAGACCTACGGCACTTTGAGAA
TTACCCGAAATGGCAAGTCAAAGCCGATAAGTAAAATACGAAAATAGATA
ATTAAAAATCTTAGATTATTTTTTAAGATACT
back to top

protein sequence of SMED30022889-orf-1

>SMED30022889-orf-1 ID=SMED30022889-orf-1|Name=SMED30022889-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=463bp
MIPKPKVYALKSSTEKLDEIPEKESSKQNMNNLEKILMNYKLKPIAATGF
SKIAQQIYRKSTNNGFQFNLMIVGCSGLGKSTFLNSLFRTQFPQNTKTSG
VVENTYKLIENDVELTLKLIEVPKFGDKINNSKSWKKIDDYLEKCFAKQL
NVESKINRTSNEISADHLVHACLYFIQPKSDKICLKDLDLEFMKNVHYKV
HLIPIIAKADSMTASELQINKSNLLAELHLHEINYFKFKMLEESGWRLES
NWFVKLQEKRMVQSLIERFPFAVVGGQESMINDKDQVLVRSYPWGKIEVD
NLDHSDTAAVRALLLSTHLQELISTSHSVVYENHRSRTLSELCQNLGIVT
ENQHHPSVYLEKYFKLLHVSLAKKINEMESGFKELVHKRESALLNKAKDL
EEQSEVMADELNQALCEFDRDFTKFIAVKTEWDCENIDYHETYGTLRITR
NGKSKPISKIRK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR016491Septin
IPR027417P-loop_NTPase
IPR030379G_SEPTIN_dom
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0000166nucleotide binding
Vocabulary: cellular component
TermDefinition
GO:0031105septin complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 23..43
NoneNo IPR availableCOILSCoilCoilcoord: 394..417
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 45..343
e-value: 7.1E-83
score: 280.0
NoneNo IPR availablePANTHERPTHR18884:SF120SEPTIN-7coord: 32..442
NoneNo IPR availablePANTHERPTHR18884SEPTINcoord: 32..442
IPR030379Septin-type guanine nucleotide-binding (G) domainPFAMPF00735Septincoord: 64..343
e-value: 2.4E-75
score: 253.5
IPR030379Septin-type guanine nucleotide-binding (G) domainPROSITEPS51719G_SEPTINcoord: 64..341
score: 58.367
IPR016491SeptinPIRSFPIRSF006698Septincoord: 8..458
e-value: 2.5E-94
score: 314.0
IPR016491SeptinCDDcd01850CDC_Septincoord: 64..342
e-value: 4.99028E-97
score: 290.987
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 56..238