FMRFamide-activated amiloride-sensitive sodium channel

Overview
NameFMRFamide-activated amiloride-sensitive sodium channel
Smed IDSMED30022882
Length (bp)1998
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FMRFamide-activated amiloride-sensitive sodium channel (SMED30022882) t-SNE clustered cells

Violin plots show distribution of expression levels for FMRFamide-activated amiloride-sensitive sodium channel (SMED30022882) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FMRFamide-activated amiloride-sensitive sodium channel (SMED30022882) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FMRFamide-activated amiloride-sensitive sodium channel (SMED30022882) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022882

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30022882h1SMcG0021359 dd_Smed_v4_16274_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30022882h1SMcG0021359 OX_Smed_1.0.11220ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1G (sodium channel epithelial 1 gamma subunit [Source:HGNC Symbol;Acc:HGNC:10602])

HSP 1 Score: 56.6102 bits (135), Expect = 1.167e-7
Identity = 45/178 (25.28%), Postives = 80/178 (44.94%), Query Frame = 2
Query:  800 GLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINE-PDRIYRDLDNVFKYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCGYLEPEKYHDLLFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQ 1330
            G +VIIH  + YP +E  G +IE   +  +      + K+      C  +  D   R++ N   Y + +C +   Q +++ +C C    Y + L P+    YC Y   +++ + ++    + + F     ++  L     C  +CS  E+T TTS+ +W P+     WL  VL  W Q
Sbjct:  326 GAKVIIHRQDEYPFVEDVGTEIETAMVTSIGMHLTESFKLSEPYSQCTEDGSDVPIRNIYNA-AYSLQICLHSCFQTKMVEKCGC--AQYSQPLPPAAN--YCNY---QQHPNWMYCYYQLHRAF-----VQEELGCQSVCKEACSFKEWTLTTSLAQW-PSVVSEKWLLPVL-TWDQ 488          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 51.6026 bits (122), Expect = 4.231e-6
Identity = 61/304 (20.07%), Postives = 117/304 (38.49%), Query Frame = 2
Query:  644 HPSYFNCFTVEPHPKYASIFSRLGLIIWLGPDEQTN------IKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDRIYRDLDNVF--KYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCGYLEPEKYHDLLFRKNCITKIFNEAPDIKSN-LKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQY-----------YNLMARNINIPSN--NMTTTDRIMLQNLTSRIETFFTRKNLSEFIPESEKLLFN 1489
            HP Y NC+T            +    +W+      N      ++  Q     +     G RV++H  +    ++  G  + PG    ++ + E   ++  +   C      +   ++N++  KY   +C +   Q+ +I EC C Y +YPR     + + YC Y +   +    ++            D  S+ L    KC   CS   Y  +   ++W P+     W+ ++L     Y            N+  + +N  +N  + + T   +L NL S+   +F    LS  + E  +L+F+
Sbjct:  299 HPMYGNCYTFN---------DKNNSNLWMSSMPGINNGLSLMLRAEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDV--PVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPR----PQNVEYCDYRKHSSWGYCYYKLQV---------DFSSDHLGCFTKCRKPCSVTSYQLSAGYSRW-PSVTSQEWVFQMLSRQNNYTVNNKRNGVAKVNIFFKELNYKTNSESPSVTMVTLLSNLGSQWSLWFGSSVLS--VVEMAELVFD 575          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 51.2174 bits (121), Expect = 6.046e-6
Identity = 61/304 (20.07%), Postives = 117/304 (38.49%), Query Frame = 2
Query:  644 HPSYFNCFTVEPHPKYASIFSRLGLIIWLGPDEQTN------IKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDRIYRDLDNVF--KYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCGYLEPEKYHDLLFRKNCITKIFNEAPDIKSN-LKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQY-----------YNLMARNINIPSN--NMTTTDRIMLQNLTSRIETFFTRKNLSEFIPESEKLLFN 1489
            HP Y NC+T            +    +W+      N      ++  Q     +     G RV++H  +    ++  G  + PG    ++ + E   ++  +   C      +   ++N++  KY   +C +   Q+ +I EC C Y +YPR     + + YC Y +   +    ++            D  S+ L    KC   CS   Y  +   ++W P+     W+ ++L     Y            N+  + +N  +N  + + T   +L NL S+   +F    LS  + E  +L+F+
Sbjct:  322 HPMYGNCYTFN---------DKNNSNLWMSSMPGINNGLSLMLRAEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDV--PVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPR----PQNVEYCDYRKHSSWGYCYYKLQV---------DFSSDHLGCFTKCRKPCSVTSYQLSAGYSRW-PSVTSQEWVFQMLSRQNNYTVNNKRNGVAKVNIFFKELNYKTNSESPSVTMVTLLSNLGSQWSLWFGSSVLS--VVEMAELVFD 598          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 50.447 bits (119), Expect = 9.961e-6
Identity = 61/304 (20.07%), Postives = 117/304 (38.49%), Query Frame = 2
Query:  644 HPSYFNCFTVEPHPKYASIFSRLGLIIWLGPDEQTN------IKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDRIYRDLDNVF--KYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCGYLEPEKYHDLLFRKNCITKIFNEAPDIKSN-LKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQY-----------YNLMARNINIPSN--NMTTTDRIMLQNLTSRIETFFTRKNLSEFIPESEKLLFN 1489
            HP Y NC+T            +    +W+      N      ++  Q     +     G RV++H  +    ++  G  + PG    ++ + E   ++  +   C      +   ++N++  KY   +C +   Q+ +I EC C Y +YPR     + + YC Y +   +    ++            D  S+ L    KC   CS   Y  +   ++W P+     W+ ++L     Y            N+  + +N  +N  + + T   +L NL S+   +F    LS  + E  +L+F+
Sbjct:  358 HPMYGNCYTFN---------DKNNSNLWMSSMPGINNGLSLMLRAEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDV--PVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPR----PQNVEYCDYRKHSSWGYCYYKLQV---------DFSSDHLGCFTKCRKPCSVTSYQLSAGYSRW-PSVTSQEWVFQMLSRQNNYTVNNKRNGVAKVNIFFKELNYKTNSESPSVTMVTLLSNLGSQWSLWFGSSVLS--VVEMAELVFD 634          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: del-4 (DEgenerin Like [Source:UniProtKB/TrEMBL;Acc:P91835])

HSP 1 Score: 78.9518 bits (193), Expect = 3.525e-15
Identity = 126/595 (21.18%), Postives = 212/595 (35.63%), Query Frame = 2
Query:   74 VIRKFFANTSIRGFSRIVKSETTFLRTLWILFVVSTITFLIVSIFKVVIDYRQYSVNIQTYIQIDNATPFPALTFCNHQPFSERAYQLWEESKVMSP--TQFNELFRSEALKQFKDMVRTKMTPKDSDFNHPLFLTTINDRLSVYYQNLPTTVSSELGHNISIIKNCVWSYGQHMAFDNHCQDDMLI-------VKNIS------HPSYFNCFTVEPHPKYASIFSR--LGLIIWLGPDEQTNIKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDRIYRDLDNVFKYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCGYLEPEKYHDLLFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQYYNLMARNINIPSNNMTTTDRIML---QNLTSRIETFFTRKNLSEFIPESEKLLFNERYTFVVVKRKANNTFIKEERLVLSFNALVSRVGGLCSLYIGLTFAFFIELIDFLYTIIF-LRKPLSREDSVEKIERTGQKRTSQTLFLKNVHETDQKLKTEI 1795
            V   F   TS  G   I  +   +LR  WIL VV +I   I     ++ +Y  +SVN +T +Q    T FP +T C+  P+         E+K + P  +   + + S++                + F  P  LT    + +  +  + +   +E  +N +   +  +SY           DDM++         NI+      +PSY NC        Y+S  +    GL + +  D+ T +          + +A G+ + IH  +  P  +  G    PG  + L        ++      C  +             Y ++ CF   +Q++II  C C   YYP Y H S       Y+  +     L   NC+  + N A   + ++  D  C   C    Y  T S  +W P+D                Y     N   PS     +    L   +  T  IE ++ R N        + L  +  YTFV                       +S VGG   L++G++    IE +  ++ + F      SR   +E++E   +K       +    +  QK   E+
Sbjct:   11 VFTDFSCWTSTHGVPHIGMANARWLRAFWILVVVVSIALFIWQFITLLTNYLSFSVNTETTLQFAERT-FPTVTICHLNPWK------LSETKSVDPDMSALIDAYNSDS--------------SSAQFGLPASLTADRQQQASKWTLMYSERLNEKQYNDA--ADIAYSY-----------DDMVVSCTYNAKTCNITDFNDFYNPSYGNCLQFNTDGMYSSSRAGPLYGLRMVMRTDQDTYLP---------WTEASGVIIDIHMQDEIPYPDVFGYFAPPGTASSLGVSYVQTTRLSKPYGSCTTKTKLKTTHYTGT--YTVEACFRSCMQEKIIASCGC---YYPAYSHASNTTQ---YVSCDNGVQTLSNLNCV-DLINSADSTEFDVLTDCDCPQPCEIDSYGVTVSTAQW-PSD---------------SYVPTECNPGGPSGPWDASGESCLDWYKANTILIEIYYERMNF-------QVLTESPAYTFV---------------------NFISDVGGQVGLFLGMSIISAIEYLVLIFLVFFYCCTHKSRRAEIEQLEMDIKKAKDDVDQVAEKRKKHQKANAEL 509          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: del-1 (Degenerin del-1 [Source:UniProtKB/Swiss-Prot;Acc:Q19038])

HSP 1 Score: 60.8474 bits (146), Expect = 2.321e-9
Identity = 82/353 (23.23%), Postives = 135/353 (38.24%), Query Frame = 2
Query:  236 SVNIQTYIQIDNATPFPALTFCNHQPFSERAYQLWEESKVMSPTQFNELFRSEALKQFKDMVRTKMTPKDSDFNHPLFLTTINDRLSVYYQNLPTTVSSELGHNIS-IIKNCVWSYGQHMAFDNHCQDDMLIVKNISHPSYFNCFTVEPHPKYASIFSRLG------LIIWLGPDEQTNIKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDRIYRDLDNVFKYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCGYLEPEKYHDLLFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKW 1273
            S NI  Y Q++       + +C  QP S R  ++WE      P + + L R E ++Q   +    MT      +     T   +++ +    L     + LG+  S +IK C ++ GQ    D          K    PS+ NC+T   +P+     SR G      L++++   +           +    +A G+R+ IH     P  ++ G     G ++          ++      C+ + +   R +   +KY+ + CF    Q RII +C C     PRY  P K   +C        + L      ++         K N K   KCI  C   +YTTT S  KW
Sbjct:  275 SGNIPCYCQLE-------MGYCVFQPES-RVRRIWEFQGNKIPEKGSPL-RKEYMEQLTQLGYGNMT------DQVAITTQAKEKMILKMSGLHPQRRAALGYGKSELIKMCSFN-GQQCNIDTE-------FKLHIDPSFGNCYTFNANPEKKLASSRAGPSYGLRLMMFVNSSD-----------YLPTTEATGVRIAIHGKEECPFPDTFGYSAPTGVISSFGISLRNINRLPQPYGNCLQKDNPQSRSIYKGYKYEPEGCFRSCYQYRIIAKCGCA---DPRYPKPWKRSAWCDSTNTTTLNCLTTEGAKLS--------TKENQK-HCKCIQPCQQDQYTTTYSAAKW 581          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: del-1 (Degenerin del-1 [Source:UniProtKB/Swiss-Prot;Acc:Q19038])

HSP 1 Score: 60.8474 bits (146), Expect = 2.589e-9
Identity = 82/353 (23.23%), Postives = 135/353 (38.24%), Query Frame = 2
Query:  236 SVNIQTYIQIDNATPFPALTFCNHQPFSERAYQLWEESKVMSPTQFNELFRSEALKQFKDMVRTKMTPKDSDFNHPLFLTTINDRLSVYYQNLPTTVSSELGHNIS-IIKNCVWSYGQHMAFDNHCQDDMLIVKNISHPSYFNCFTVEPHPKYASIFSRLG------LIIWLGPDEQTNIKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDRIYRDLDNVFKYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCGYLEPEKYHDLLFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKW 1273
            S NI  Y Q++       + +C  QP S R  ++WE      P + + L R E ++Q   +    MT      +     T   +++ +    L     + LG+  S +IK C ++ GQ    D          K    PS+ NC+T   +P+     SR G      L++++   +           +    +A G+R+ IH     P  ++ G     G ++          ++      C+ + +   R +   +KY+ + CF    Q RII +C C     PRY  P K   +C        + L      ++         K N K   KCI  C   +YTTT S  KW
Sbjct:  250 SGNIPCYCQLE-------MGYCVFQPES-RVRRIWEFQGNKIPEKGSPL-RKEYMEQLTQLGYGNMT------DQVAITTQAKEKMILKMSGLHPQRRAALGYGKSELIKMCSFN-GQQCNIDTE-------FKLHIDPSFGNCYTFNANPEKKLASSRAGPSYGLRLMMFVNSSD-----------YLPTTEATGVRIAIHGKEECPFPDTFGYSAPTGVISSFGISLRNINRLPQPYGNCLQKDNPQSRSIYKGYKYEPEGCFRSCYQYRIIAKCGCA---DPRYPKPWKRSAWCDSTNTTTLNCLTTEGAKLS--------TKENQK-HCKCIQPCQQDQYTTTYSAAKW 556          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: del-1 (Degenerin del-1 [Source:UniProtKB/Swiss-Prot;Acc:Q19038])

HSP 1 Score: 60.4622 bits (145), Expect = 2.947e-9
Identity = 82/353 (23.23%), Postives = 135/353 (38.24%), Query Frame = 2
Query:  236 SVNIQTYIQIDNATPFPALTFCNHQPFSERAYQLWEESKVMSPTQFNELFRSEALKQFKDMVRTKMTPKDSDFNHPLFLTTINDRLSVYYQNLPTTVSSELGHNIS-IIKNCVWSYGQHMAFDNHCQDDMLIVKNISHPSYFNCFTVEPHPKYASIFSRLG------LIIWLGPDEQTNIKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDRIYRDLDNVFKYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCGYLEPEKYHDLLFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKW 1273
            S NI  Y Q++       + +C  QP S R  ++WE      P + + L R E ++Q   +    MT      +     T   +++ +    L     + LG+  S +IK C ++ GQ    D          K    PS+ NC+T   +P+     SR G      L++++   +           +    +A G+R+ IH     P  ++ G     G ++          ++      C+ + +   R +   +KY+ + CF    Q RII +C C     PRY  P K   +C        + L      ++         K N K   KCI  C   +YTTT S  KW
Sbjct:  230 SGNIPCYCQLE-------MGYCVFQPES-RVRRIWEFQGNKIPEKGSPL-RKEYMEQLTQLGYGNMT------DQVAITTQAKEKMILKMSGLHPQRRAALGYGKSELIKMCSFN-GQQCNIDTE-------FKLHIDPSFGNCYTFNANPEKKLASSRAGPSYGLRLMMFVNSSD-----------YLPTTEATGVRIAIHGKEECPFPDTFGYSAPTGVISSFGISLRNINRLPQPYGNCLQKDNPQSRSIYKGYKYEPEGCFRSCYQYRIIAKCGCA---DPRYPKPWKRSAWCDSTNTTTLNCLTTEGAKLS--------TKENQK-HCKCIQPCQQDQYTTTYSAAKW 536          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: copg2 (coatomer protein complex subunit gamma 2 [Source:Xenbase;Acc:XB-GENE-941264])

HSP 1 Score: 82.4185 bits (202), Expect = 1.039e-15
Identity = 61/215 (28.37%), Postives = 93/215 (43.26%), Query Frame = 2
Query:  644 HPSYFNCFTVEPHPKYASIFS-----RLGLIIWLGPDEQTNIKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDRIYRDLDNVFKYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCGYLEPEKYHDLLFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKW 1273
            HP Y NCFT+  H K  S +S     + GL I +  D   N+         +  QA G R++IH PN  P +E +G  I PG  N ++ + E  I++  +   C ++   +   +     Y +  C N   Q ++I  C C Y +YP  L P  E  YC Y    K+ D  +   C  +++ +  D    L    +C   C   EY  +    KW
Sbjct:  258 HPIYGNCFTINNHWKENSWYSSRPGKQYGLSIVVKTDLHDNMP--------LLSQAAGARIMIHNPNQPPLVEHQGFDIRPGTENSISVKQEEAIRLGGKYSQCTSDGSDLGIKILYNTSYTMQACLNSCFQYKMIEVCGCGYYFYP--LPPGME--YCNY---NKHPDWGY---CFYQLYEKMLD--HTLICFTQCPKQCKQTEYHLSAGTAKW 452          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: copg2 (coatomer protein complex subunit gamma 2 [Source:Xenbase;Acc:XB-GENE-941264])

HSP 1 Score: 82.0333 bits (201), Expect = 1.061e-15
Identity = 61/215 (28.37%), Postives = 93/215 (43.26%), Query Frame = 2
Query:  644 HPSYFNCFTVEPHPKYASIFS-----RLGLIIWLGPDEQTNIKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDRIYRDLDNVFKYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCGYLEPEKYHDLLFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKW 1273
            HP Y NCFT+  H K  S +S     + GL I +  D   N+         +  QA G R++IH PN  P +E +G  I PG  N ++ + E  I++  +   C ++   +   +     Y +  C N   Q ++I  C C Y +YP  L P  E  YC Y    K+ D  +   C  +++ +  D    L    +C   C   EY  +    KW
Sbjct:  258 HPIYGNCFTINNHWKENSWYSSRPGKQYGLSIVVKTDLHDNMP--------LLSQAAGARIMIHNPNQPPLVEHQGFDIRPGTENSISVKQEEAIRLGGKYSQCTSDGSDLGIKILYNTSYTMQACLNSCFQYKMIEVCGCGYYFYP--LPPGME--YCNY---NKHPDWGY---CFYQLYEKMLD--HTLICFTQCPKQCKQTEYHLSAGTAKW 452          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: foxe3 (forkhead box E3 [Source:Xenbase;Acc:XB-GENE-480592])

HSP 1 Score: 79.337 bits (194), Expect = 7.619e-15
Identity = 55/215 (25.58%), Postives = 91/215 (42.33%), Query Frame = 2
Query:  632 KNISHPSYFNCFTVEPHPKYASIFS-RLGLIIWLGPDEQTNIKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDRIYRDLDNVFKYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCGYLEPEKYHDLLFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKW 1273
            K   HP Y +CFTV P  K  +++S R G    L    + + KH    L     QA G R++IH PN  P +E +G  I PG    +  + +    +  +  PC ++ + +   L     Y +  C N   Q ++   C C Y +YP  L P  E  YC Y +   +       +C  +++ +  D + +     +C   C+   Y  +    +W
Sbjct:  254 KFFHHPIYGSCFTVTPQGKENALYSPRAGKKYGLSLKMKVDQKHNMPLL----SQAAGARIMIHNPNQPPRVEHQGFDIRPGTETSIGVKQDEVRHLGGKYGPCASDGNNLGLKLLYSTSYTLQACLNSCFQYKMTETCGCGYYFYP--LPPGTE--YCNYNKHPGW------GHCFYQLYEKMLDHRHH--CFTQCPMQCTKTRYQLSAGTAQW 452          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: cdh12 (cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase;Acc:XB-GENE-982876])

HSP 1 Score: 67.3958 bits (163), Expect = 5.179e-11
Identity = 65/272 (23.90%), Postives = 115/272 (42.28%), Query Frame = 2
Query:  644 HPSYFNCFTVEPHPKYASIFSRLG-------LIIWLGPDEQTNIKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDRIYRDLDNVF--KYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELP----YCGYLEPEKYHDLLFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQYYNLMARNINIPSNNMTTTDRIMLQNLTSR 1420
            HP Y NC+T     +   + S +G       +++++  DE                 A G ++++H+ + YP IE  G ++E      +  Q   + K+      C  +   +   ++N++  KY + +C N   Q+ ++  C C         H  + LP    YC Y   E+Y   ++   C  K++ +   ++  L     C  SCS  E+T T S+ KW P+     W+  VL +W     L   N N+  N++   + I  Q+L SR
Sbjct:  288 HPLYGNCYTFNSAERGNLLVSSMGGAEYGLKVVLYIDEDEYN----------PYLSTAAGAKILVHDQDEYPFIEDLGTELETATETSIGMQLTESTKLSDPYSDCTMDGSDV--SVENLYSKKYTLQICLNSCFQREMVRTCGCA--------HYDQPLPNGAKYCNY---EEYPSWIY---CYFKLYKQF--VQEELGCQSACRESCSFKEWTLTRSLAKW-PSLNSEQWMLRVL-SWELGEKL---NKNLTKNDLANLN-IFYQDLNSR 525          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: cdh12 (cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase;Acc:XB-GENE-982876])

HSP 1 Score: 64.6994 bits (156), Expect = 3.766e-10
Identity = 55/241 (22.82%), Postives = 98/241 (40.66%), Query Frame = 2
Query:  644 HPSYFNCFTVEPHPKYASIFSRLG-------LIIWLGPDEQTNIKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDRIYRDLDNVF--KYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELP----YCGYLEPEKYHDLLFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWA 1327
            HP Y NC+T     +   + S +G       +++++  DE                 A G ++++H+ + YP IE  G ++E      +  Q   + K+      C  +   +   ++N++  KY + +C N   Q+ ++  C C         H  + LP    YC Y   E+Y   ++   C  K++ +   ++  L     C  SCS  E+T T S+ KW   +       EV  AW 
Sbjct:  278 HPLYGNCYTFNSAERGNLLVSSMGGAEYGLKVVLYIDEDEYN----------PYLSTAAGAKILVHDQDEYPFIEDLGTELETATETSIGMQLTESTKLSDPYSDCTMDGSDV--SVENLYSKKYTLQICLNSCFQREMVRTCGCA--------HYDQPLPNGAKYCNY---EEYPSWIY---CYFKLYKQF--VQEELGCQSACRESCSFKEWTLTRSLAKWPSLN------SEVRSAWV 484          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1g (sodium channel, nonvoltage-gated 1 gamma [Source:MGI Symbol;Acc:MGI:104695])

HSP 1 Score: 63.1586 bits (152), Expect = 6.866e-10
Identity = 56/238 (23.53%), Postives = 102/238 (42.86%), Query Frame = 2
Query:  644 HPSYFNCFTVEPHPKYASIFSRLG-------LIIWLGPDEQTNIKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDRIYRDLDNVF--KYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCGYLEPEKYHDLLFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQ 1330
            HP Y NC+T         + + +G       +I+++  DE         FL      + G +V++H+ N YP IE  G +IE      +      + K+      C  +   +   + N++   Y + +C     Q +++ +C C    Y + L P+    YC Y   +++ + ++   C  +++     ++  L     C  SCS  E+T TTS+ +W P++    WL  VL  W Q
Sbjct:  283 HPMYGNCYTFNNRENATILSTSMGGSEYGLQVILYINEDE------YNPFLVS----STGAKVLVHQQNEYPFIEDVGTEIETAMSTSIGMHLTESFKLSEPYSQCTEDGSDV--PVTNIYNAAYSLQICLYSCFQTKMVEKCGC--AQYSQPLPPAAN--YCNY---QQHPNWMY---CYYQLYQAF--VREELGCQSVCKQSCSFKEWTLTTSLAQW-PSEASEKWLLNVL-TWDQ 494          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1a (sodium channel, nonvoltage-gated 1 alpha [Source:MGI Symbol;Acc:MGI:101782])

HSP 1 Score: 51.9878 bits (123), Expect = 2.459e-6
Identity = 61/303 (20.13%), Postives = 118/303 (38.94%), Query Frame = 2
Query:  644 HPSYFNCFTVEPHPKYASIFSRLGLIIWLGPDEQTN------IKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDRIYRDLDNVF--KYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCGYLEPEKYHDLLFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQY-----------YNLMARNINIPSNNMTTTDRI--MLQNLTSRIETFFTRKNLSEFIPESEKLLFN 1489
            HP Y NC+T           ++    +W+      N      ++  Q     +     G RV++H  +    ++  G  + PG    ++ + E    +      C      +   + N++  KY   +C +   Q+ +I +C C Y +YP+     K + +C YL+   +        C  K+  +A     +L    KC   CS   Y  +   ++W P+     W+ E+L     Y            N+  + +N  +N+ + +  +  +L NL S+   +F    LS  + E  +L+F+
Sbjct:  220 HPMYGNCYTFN---------NKNNSNLWMSSMPGVNNGLSLTLRTEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNVRPGVETSISMRKEALDSLGGNYGDCTENGSDV--PVKNLYPSKYTQQVCIHSCFQENMIKKCGCAYIFYPK----PKGVEFCDYLKQSSW------GYCYYKL--QAAFSLDSLGCFSKCRKPCSVTNYKLSAGYSRW-PSVKSQDWIFEMLSLQNNYTINNKRNGVAKLNIFFKELNYKTNSESPSVTMVSLLSNLGSQWSLWFGSSVLS--VVEMAELIFD 496          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1a (sodium channel, nonvoltage-gated 1 alpha [Source:MGI Symbol;Acc:MGI:101782])

HSP 1 Score: 51.9878 bits (123), Expect = 2.498e-6
Identity = 61/303 (20.13%), Postives = 118/303 (38.94%), Query Frame = 2
Query:  644 HPSYFNCFTVEPHPKYASIFSRLGLIIWLGPDEQTN------IKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDRIYRDLDNVF--KYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCGYLEPEKYHDLLFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQY-----------YNLMARNINIPSNNMTTTDRI--MLQNLTSRIETFFTRKNLSEFIPESEKLLFN 1489
            HP Y NC+T           ++    +W+      N      ++  Q     +     G RV++H  +    ++  G  + PG    ++ + E    +      C      +   + N++  KY   +C +   Q+ +I +C C Y +YP+     K + +C YL+   +        C  K+  +A     +L    KC   CS   Y  +   ++W P+     W+ E+L     Y            N+  + +N  +N+ + +  +  +L NL S+   +F    LS  + E  +L+F+
Sbjct:  220 HPMYGNCYTFN---------NKNNSNLWMSSMPGVNNGLSLTLRTEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNVRPGVETSISMRKEALDSLGGNYGDCTENGSDV--PVKNLYPSKYTQQVCIHSCFQENMIKKCGCAYIFYPK----PKGVEFCDYLKQSSW------GYCYYKL--QAAFSLDSLGCFSKCRKPCSVTNYKLSAGYSRW-PSVKSQDWIFEMLSLQNNYTINNKRNGVAKLNIFFKELNYKTNSESPSVTMVSLLSNLGSQWSLWFGSSVLS--VVEMAELIFD 496          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1a (sodium channel, nonvoltage-gated 1 alpha [Source:MGI Symbol;Acc:MGI:101782])

HSP 1 Score: 51.2174 bits (121), Expect = 4.702e-6
Identity = 61/303 (20.13%), Postives = 118/303 (38.94%), Query Frame = 2
Query:  644 HPSYFNCFTVEPHPKYASIFSRLGLIIWLGPDEQTN------IKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDRIYRDLDNVF--KYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCGYLEPEKYHDLLFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQY-----------YNLMARNINIPSNNMTTTDRI--MLQNLTSRIETFFTRKNLSEFIPESEKLLFN 1489
            HP Y NC+T           ++    +W+      N      ++  Q     +     G RV++H  +    ++  G  + PG    ++ + E    +      C      +   + N++  KY   +C +   Q+ +I +C C Y +YP+     K + +C YL+   +        C  K+  +A     +L    KC   CS   Y  +   ++W P+     W+ E+L     Y            N+  + +N  +N+ + +  +  +L NL S+   +F    LS  + E  +L+F+
Sbjct:  327 HPMYGNCYTFN---------NKNNSNLWMSSMPGVNNGLSLTLRTEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNVRPGVETSISMRKEALDSLGGNYGDCTENGSDV--PVKNLYPSKYTQQVCIHSCFQENMIKKCGCAYIFYPK----PKGVEFCDYLKQSSW------GYCYYKL--QAAFSLDSLGCFSKCRKPCSVTNYKLSAGYSRW-PSVKSQDWIFEMLSLQNNYTINNKRNGVAKLNIFFKELNYKTNSESPSVTMVSLLSNLGSQWSLWFGSSVLS--VVEMAELIFD 603          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1a (sodium channel, nonvoltage-gated 1 alpha [Source:MGI Symbol;Acc:MGI:101782])

HSP 1 Score: 50.8322 bits (120), Expect = 4.713e-6
Identity = 61/303 (20.13%), Postives = 118/303 (38.94%), Query Frame = 2
Query:  644 HPSYFNCFTVEPHPKYASIFSRLGLIIWLGPDEQTN------IKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDRIYRDLDNVF--KYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCGYLEPEKYHDLLFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQY-----------YNLMARNINIPSNNMTTTDRI--MLQNLTSRIETFFTRKNLSEFIPESEKLLFN 1489
            HP Y NC+T           ++    +W+      N      ++  Q     +     G RV++H  +    ++  G  + PG    ++ + E    +      C      +   + N++  KY   +C +   Q+ +I +C C Y +YP+     K + +C YL+   +        C  K+  +A     +L    KC   CS   Y  +   ++W P+     W+ E+L     Y            N+  + +N  +N+ + +  +  +L NL S+   +F    LS  + E  +L+F+
Sbjct:  301 HPMYGNCYTFN---------NKNNSNLWMSSMPGVNNGLSLTLRTEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNVRPGVETSISMRKEALDSLGGNYGDCTENGSDV--PVKNLYPSKYTQQVCIHSCFQENMIKKCGCAYIFYPK----PKGVEFCDYLKQSSW------GYCYYKL--QAAFSLDSLGCFSKCRKPCSVTNYKLSAGYSRW-PSVKSQDWIFEMLSLQNNYTINNKRNGVAKLNIFFKELNYKTNSESPSVTMVSLLSNLGSQWSLWFGSSVLS--VVEMAELIFD 577          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|Q25011|FANA_CORAP (FMRFamide-activated amiloride-sensitive sodium channel OS=Cornu aspersum OX=6535 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 2.188e-14
Identity = 119/584 (20.38%), Postives = 227/584 (38.87%), Query Frame = 2
Query:   56 NKQCFEVIRKFFANTSIRGFSRIVKSETTFLRTLWILFVVSTITFLIVSIFKVVIDYRQYSVNIQTYIQIDNATPFPALTFCNHQPFS----ERAYQLWEESKVMSPTQFNELFRSEALKQFKDMVRTKMTPKDSDFNHPLFLTTINDRLSVYYQNLPTTVSSELGHNI-SIIKNCVWSYGQHMAFDNHCQDDMLIVKNIS---HPSYFNCFTVEPHPKYA--SIFSRLGLIIWLGPDEQTNIKHRQG-FLFD--IFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDRIYRDLDNV--FKYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCGYLEP-----EKYHDLLFRKNCITKIFNEAPDI------KSNLKADK------KCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQYYNLMARNINIPSNNMTTTDRIMLQNLTSRIETFFTRKN------LSEFIPESEKLLFNERYTFVVVKRKANNTFIKEERLV-------LSFNALVSRVGGLCSLYIGLTFAFFIELIDFLYTIIFL 1672
            N+   ++I +  + ++  G ++IV S  T  + +W L V++  T   + +  +V  Y Q+ V   + I+      +P+++ CN +P S     R Y   E   +++  +F + FR E               +DS      F+ +I      +Y+NL    + +L HN+  ++ +C ++             ++  V N S     +YFNCFT     +    +     GL +    ++   +    G + FD  I   A G+RV++H P S P+    G+ I PG  + +  +  L+ ++      C N+       L+ +  +KY    C  +  Q+ II  C C     P    PS    +CG ++        + +    ++   + F   P +      + NL  D+       C   CS   Y  + S++ W    +QL  ++       Q             N+   T    L+ L    +    R +      LS+    SEK +  E    +       N ++++  +V            L + +GG   L++G++    +ELI+ +  +  L
Sbjct:   36 NRSAIDIIAELGSESNAHGLAKIVTSRDTKRKVIWALLVIAGFTAATLQLSLLVRKYLQFQVVELSEIKDSMPVQYPSVSICNIEPISLRTIRRMYFNNESQNLITWLRFIQKFRFE---------------QDS------FMNSIR----AFYENLGQD-AKKLSHNLEDMLMHCRFN------------RELCHVSNFSTFFDGNYFNCFTFNSGQRLQMHATGPENGLSLIFSVEKDDPLPGTYGVYNFDNNILHSA-GVRVVVHAPGSMPSPVDHGIDIPPGYSSSVGLKAILHTRLPYPYGNCTNDM------LNGIKQYKYTFFACLQLCKQRLIIQRCGCKSSALPEV--PSYNATFCGVIKDWQEINRNHSNEDHNQSEEDRAFIPTPYLACEEREQKNLNNDRTYELSCGCFQPCSETSYLKSVSLSYWPLEFYQLSAVERFFKQERQ----------AGQNHFMKTAYEYLEKLAHPSQKHLARNDSHMDDILSKSYSLSEKEMAKEASDLIRQNMLRLNIYLEDLSVVEYRQLPAYGLADLFADIGGTLGLWMGISVLTIMELIELVIRLTGL 562          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|H2QAR5|SCNNG_PANTR (Amiloride-sensitive sodium channel subunit gamma OS=Pan troglodytes OX=9598 GN=SCNN1G PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 4.170e-13
Identity = 97/439 (22.10%), Postives = 181/439 (41.23%), Query Frame = 2
Query:   71 EVIRKFFANTSIRGFSRIVKSETTFLRTLWILFVVSTITFLIVSIFKVVIDYRQYSVNIQTYIQIDNATPFPALTFCNHQPFSERAYQ-----LWEESK--VMSPTQFNELFRSEALKQFKDMVRTKMTPKDSDFNH--PLFLTTINDRLSV--YYQNLPTTVSSELGHNISIIKNCVWSYGQHMAFDNHCQDDMLIVKNISHPSYFNCFTVEPHPKYASIFSRLG-------LIIWLGPDEQTNIKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINE-PDRIYRDLDNVFKYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCGYLEPEKYHDLLFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQ 1330
            E++R +  NT+  G  RIV S     R LWI F ++ +  ++     +V  +   SV+I+ + +      FPA+T CN  P+     +     L +E++  + S   F E  +    + +  +   K  P+   F+H  PL +   +++     ++      V   + H  S + +      Q + F        L      HP + NC+T         + + +G       +I+++  +E         FL      + G +VIIH  + YP +E  G +IE   +  +      + K+      C  +  D   R++ N   Y + +C +   Q +++ +C C    Y + L P+    YC Y   +++ + ++    + + F     ++  L     C  +CS  E+T TTS+ +W P+     WL  VL  W Q
Sbjct:   27 ELMRWYCLNTNTHGCRRIVVSRGRLRRLLWIGFTLTAVALILWQCALLVFSFYTVSVSIKVHFR---KLDFPAVTICNINPYKYSTVRHLLADLEQETREALKSLYGFPESRKRREAESWSSISEGKQ-PR---FSHRIPLLIFDQDEKGKARDFFTGRKRKVGGSIIHKASNVMHI--ESKQVVGFQ-------LNFTLFHHPMHGNCYTFNNRENETILSTSMGGSEYGLQVILYINEEEYNP------FLVS----STGAKVIIHRQDEYPFVEDVGTEIETAMVTSIGMHLTESFKLSEPYSQCTEDGSDVPIRNIYNA-AYSLQICLHSCFQTKMVEKCGC--AQYSQPLPPAAN--YCNY---QQHPNWMYCYYQLHRAF-----VQEELGCQSVCKEACSFKEWTLTTSLAQW-PSVVSEKWLLPVL-TWDQ 424          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|O13263|SCNNH_XENLA (Amiloride-sensitive sodium channel subunit gamma-2 OS=Xenopus laevis OX=8355 GN=scnn1g-b PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 2.796e-11
Identity = 67/272 (24.63%), Postives = 117/272 (43.01%), Query Frame = 2
Query:  644 HPSYFNCFTVEPHPKYASIFSRLG-------LIIWLGPDEQTNIKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDRIYRDLDNVF--KYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELP----YCGYLEPEKYHDLLFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQYYNLMARNINIPSNNMTTTDRIMLQNLTSR 1420
            HP Y NC+T     +   + S +G       +++++  DE                 A G ++++H+ + YP IE  G ++E G    +  Q   + K+      C  +   I   ++N++  KY + +C N   Q+ ++  C C         H  + LP    YC Y   E+Y + ++   C  K++ +   ++  L     C  SCS  E+T T S+ KW P+     W+  VL +W     L   N N+  N++   + I  Q+L SR
Sbjct:  280 HPLYGNCYTFNSAERGNLLVSSMGGAEYGLKVVLYIDEDEYN----------PYLSTAAGAKILVHDQDEYPFIEDLGTELETGTETSIGMQLTESTKLSDPYSDCTIDGSDI--SVENLYNKKYTLQICLNSCFQREMVRSCGCA--------HYDQPLPNGAKYCNY---EEYPNWIY---CYVKLYKQF--VQEELGCQSTCRESCSFKEWTLTRSLAKW-PSLNSEEWMLRVL-SWELGEKL---NKNLTKNDLGNLN-IFYQDLNSR 517          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|P51171|SCNNG_XENLA (Amiloride-sensitive sodium channel subunit gamma OS=Xenopus laevis OX=8355 GN=scnn1g-a PE=1 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 4.947e-10
Identity = 65/272 (23.90%), Postives = 115/272 (42.28%), Query Frame = 2
Query:  644 HPSYFNCFTVEPHPKYASIFSRLG-------LIIWLGPDEQTNIKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDRIYRDLDNVF--KYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELP----YCGYLEPEKYHDLLFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQYYNLMARNINIPSNNMTTTDRIMLQNLTSR 1420
            HP Y NC+T     +   + S +G       +++++  DE                 A G ++++H+ + YP IE  G ++E      +  Q   + K+      C  +   +   ++N++  KY + +C N   Q+ ++  C C         H  + LP    YC Y   E+Y   ++   C  K++ +   ++  L     C  SCS  E+T T S+ KW P+     W+  VL +W     L   N N+  N++   + I  Q+L SR
Sbjct:  280 HPLYGNCYTFNSAERGNLLVSSMGGAEYGLKVVLYIDEDEYN----------PYLSTAAGAKILVHDQDEYPFIEYLGTELETATETSIGMQLTESAKLSDPYSDCTMDGRDV--SVENLYNKKYTLQICLNSCFQREMVRSCGCA--------HYDQPLPNGAKYCNY---EEYPSWIY---CYFKVYKQF--VQEELGCQSACRESCSFKEWTLTRSLAKW-PSLNSEEWMLRVL-SWELGEKL---NKNLTKNDLANLN-IFYQDLNSR 517          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|H1AFJ5|SCNNA_NEOFS (Amiloride-sensitive sodium channel subunit alpha OS=Neoceratodus forsteri OX=7892 GN=scnn1a PE=1 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 5.951e-10
Identity = 73/310 (23.55%), Postives = 122/310 (39.35%), Query Frame = 2
Query:  644 HPSYFNCFTV---EPHPKYASIFSRLGLIIWLGPDEQTNIKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDRIYRDLDNVFKYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCGYLEPEKYHDLLFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQYYNLMARNINIPSNNM--------------TTTDRIMLQNLTSRIETFFTRKNLSEFIPESEKLLFNERYTFVVVKRK 1522
            HP Y NC+T    +    +AS    +G  + L       ++  Q           G RV++H+ N  P +E  G+ I PG    +  + E+  ++      C +  D    +L N   Y+   C     Q  I+ +C C Y +YP    PS    YC Y   + +    ++   + K F  A D    L   ++C   C   +Y  T    +W P+     W+  +L    Q YN+ +   NI   N+              + T   +L N+ S+   +F    LS  + E  +L+F+     V+V R+
Sbjct:  269 HPVYGNCYTYNDGQSATPWASFVPGVGNGLSL------VLRTEQNDFLPFLSTVAGARVLVHDQNQPPFMEDSGLDIRPGVETSIGMKKEIISRLGGVYGNCTDGSDIDVVNLYNS-DYNQQACVRSCFQATIVQQCGCGYYFYPL---PSGA-EYCSYSRNKSWGYCYYK---LYKAF--AAD---ELGCFRRCRKPCQYTDYKMTAGYAQW-PSSVSESWITSILSQENQ-YNMTSGRKNIAKLNVYFYELNYQTMGESPSFTVVTLLSNMGSQWSLWFGSSVLS--VVEMGELVFDLIAVGVIVLRR 555          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A183A613 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS2398 PE=3 SV=1)

HSP 1 Score: 466.077 bits (1198), Expect = 7.230e-153
Identity = 250/597 (41.88%), Postives = 349/597 (58.46%), Query Frame = 2
Query:   86 FFANTSIRGFSRIVKSETTFLRTLWILFVVSTITFLIVSIFKVVIDYRQYSVNIQTYIQIDNATPFPALTFCNHQPFSERAYQLWEESKVMSPTQFNELFRSEALKQFKDMVRTKMTPKDSDFNHPLFLTT-------INDRLSVYYQNLPTTVSSELGH--NISIIKNCVWSY-GQHMAFDNH-CQDDMLIVKNISHPSYFNCFTVEPHPKYASIFSRLGLIIWLGPDEQTNIKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDRIYRDLDNVFKYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCGYLEPEKYHDL-----LFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQYYNLMARNINIPSNNMTTTDRIMLQNLTSRIETFFTRKNLSEFIPESEKLLFNERYTFVVVKRKANNTFIKEERLVLSFNALVSRVGGLCSLYIGLTFAFFIELIDFLYTIIFLRK-------PLS----------REDSVEKIERTGQKRTSQTLFLKNVHETDQ 1777
            F  + SIRG +RIVK+++ F+R LWI ++V T  FL VS+ ++V +Y  YSVNIQTY+ +D    FPA+TFCNHQPFSE  Y+LW + +V+SPT+FN + R EA  +            ++  +HP  L         + D + +YYQNL      +LGH  N SI   C++ Y G+H+      C DDM+ V   SHP +FNC TV   P+ A     +GLIIWLGP E  +  HRQ FL D+FEQAYGLRV IHEP    N++S G+QIEPGR+NELN++   +I + T R PCI +P+  Y+DLD  + Y+ +LC N  +Q +++ +C+C+Y Y PR   P+  LPYCG    E    L       RK C T I ++A  +K + + +  C+  C S++Y +T SVT WR T WQLYW +E   A               S+  T      L NL+S +      KN  +    + +  F++RYT+V+VKRK+N+T +K E LVL+FNALVSR+GGLCSLYIG+TFA  IELI+FLY  I+  +       P+S          R DSV + E T    TS+   +++ ++TDQ
Sbjct:   34 FLESISIRGCNRIVKAQSRFIRHLWICYLVFTSLFLWVSVMRLVSEYWNYSVNIQTYVSMDAPADFPAITFCNHQPFSEYGYELWRQGQVISPTKFNHVLRQEADHRI-----------NASRDHPYLLPPEAAQLGFVFDSVKLYYQNLDWPYPKQLGHQRNESIYM-CLFRYLGEHLVIGGSGCHDDMIRVSVRSHPHHFNCHTVSIAPRKAKQVQEVGLIIWLGPQENYDASHRQAFLLDLFEQAYGLRVAIHEPGQLANLDSHGIQIEPGRMNELNFEAVRHIHMRTPRNPCITKPESKYKDLDETYDYEFELCLNTLVQAKVVEKCRCLYAYLPRIAFPNSTLPYCGRFLAESGEQLDVQGVFERKQCATDIMSQAAHLKKSFETEGLCLRRCESVDYVSTVSVTTWRSTQWQLYWSQETAAALDS------------SDTGTLASYFRLANLSSAL----GEKNNVQSKGPTGQYGFSDRYTYVLVKRKSNDTIVKAENLVLTFNALVSRIGGLCSLYIGMTFAVVIELIEFLYIAIYGSRLXVVDTGPVSNDATAHNNNNRLDSVPENEGT----TSKACAVQDSNDTDQ 598          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A183WY05 (Uncharacterized protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS17010 PE=3 SV=1)

HSP 1 Score: 449.129 bits (1154), Expect = 5.830e-146
Identity = 238/551 (43.19%), Postives = 334/551 (60.62%), Query Frame = 2
Query:   50 KKNKQCFEVIRK----FFANTSIRGFSRIVKSETTFLRTLWILFVVSTITFLIVSIFKVVIDYRQYSVNIQTYIQIDNATPFPALTFCNHQPFSERAYQLWEESKVMSPTQFNELFRSEALKQFKDMVRTKMTPKDSDF-NHPLFLTTINDRLSVYYQNLPTTVSSELGH--NISIIKNCVWSY--GQHMAFDNHCQDDMLIVKNISHPSYFNCFTVEPHPKYASIFSRLGLIIWLGPDEQTNIKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDRIYRDLDNVFKYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCGYLEPEKYHDL-----LFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQYYNLMARNINIPSNNMTTTDRIMLQNLTSRIETFFTRKNLS-------EFIPESEKLLFNERYTFVVVKRKANNTFIKEERLVLSFNALVSRVGGLCSLYIGLTFAFFIE 1639
            K N  C    R+    F  + SIRG +RIV++E+ F+R LWI +++ T  FL+ SI +++ +Y  YSVNIQTYI +D  + FPA+TFCNHQPFS RAY+LW   +++SPTQF++L ++ A     D        K+  F     F     D + +YYQNL    S  LGH  N SI   C++ Y  G  +     C DDM+I++  SHP +FNC TVE    Y+     LGLIIWLGP+E  N+++RQ FL D+FEQAYGLRV IHEP    N++S+G+QIEPGR+NELN+     I  +T RKPCI++P ++Y DL+  + Y+ +LC N  LQ  +IT+C C+Y Y PR   P+  LPYCG+L       L     L RK C+  I +++  +K + + +  C+  C  ++Y +T SVT WR T WQL+W +E   A    ++L      +   N+  T+   L+NL    + +F   NLS       E    +E   F++RYT+++VKRK+N+T +K E LVL+ NALVSR+GGLCSLYIG+TFA FIE
Sbjct:   50 KGNNVCCRRTRENLYLFLDSISIRGCNRIVRAESGFIRLLWIFYLIFTSLFLLFSIIRLINEYNTYSVNIQTYIDMDAPSNFPAITFCNHQPFSSRAYELWRSGEIISPTQFSKLLKNAA-----DYYLNASQSKNQSFPQEAGFFAFEFDTVKMYYQNLDWQKSKLLGHERNQSIYM-CLFRYSGGNLVIGGPGCHDDMIIIRERSHPHHFNCHTVEVSQAYSQEVQELGLIIWLGPNENYNVQYRQAFLMDLFEQAYGLRVAIHEPGQLANLDSQGIQIEPGRMNELNFDAVKTIHQETPRKPCIHQPKQMYTDLEQEYNYEFELCLNTHLQNLLITQCTCLYAYLPRVKLPNISLPYCGHLITTNNQSLDTTGILTRKECVRNILSKSAILKKSFEDNGLCLRRCELVDYESTASVTTWRSTRWQLHWSQETSAALEVLFSL-----PMDVQNVNNTNDKALKNL----QVYFRTDNLSLITSNFHEKDSLTEAYGFSDRYTYLLVKRKSNDTIVKAETLVLTLNALVSRIGGLCSLYIGMTFAVFIE 585          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A0R3SVH1 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS9571 PE=3 SV=1)

HSP 1 Score: 442.195 bits (1136), Expect = 6.823e-144
Identity = 245/624 (39.26%), Postives = 357/624 (57.21%), Query Frame = 2
Query:   14 RKSVVMNSVIGNKKNKQCF-----EVIRKFFANTSIRGFSRIVKSETTFLRTLWILFVVSTITFLIVSIFKVVIDYRQYSVNIQTYIQIDNATPFPALTFCNHQPFSERAYQLWEESKVMSPTQFNELFRSEALKQFKDMVRTKMTPKDSD--FNHPLFLTTIN-----DRLSVYYQNLPTTVSSELGHN-ISIIKNCVWSYGQHMAFDN-HCQDDMLIVKNISHPSYFNCFTVEPHPKYASIFSRLGLIIWLGPDEQTNIKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDRIYRDLDNVFKYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCGYLEPEKYHDLLFR-----KNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQYYNLMARNINIPSNNMTTTDRIMLQNLTSRIETFFTRKNLSEFIPESEKLLFNERYTFVVVKRKANNTFIKEERLVLSFNALVSRVGGLCSLYIGLTFAFFIELIDFLYTIIFLR--KPLSREDSVEKIERTGQK------RTSQTLFLKNVHETDQKLKTEITNS 1804
            RK    +  +G  KNK  +        R F  +TSIRG SRIV+SET  LR +W +++ ST  FLI SI K+V +Y +YSVNIQTY ++D    FP +TFCNHQPFSERAY+LW+   V+SPT+FN+L R  A + F   ++  +    +    N  L   ++      D L +YYQ++      +LGH+   +I  C++ YG   A     C+D +L VK +S P +FNC++VE   +++     LGLI+WLGPDE    + RQ FLFD+FEQAYG++V IHEP    N++    QI PGR+NEL +Q       D   KPC + P +IY DL+ ++ Y  ++C N  LQ+RI+ EC C+Y YYPR   P+K LPYCG L  +    +  +     ++C   I   A   +  ++  + C   C S+EY +  SVTKWR T WQLYW    L   + + ++   +++ P   +              IE F    NL++F   +  ++F+ERYT+++V+RK+N+T IKEE LVL+ NAL SR+GGLCSLYIGLT A  +E+++F+Y     R  K  S ++S E+ E+  Q+       T +TL   N  + DQK   ++ +S
Sbjct:    9 RKKNKKDGGVGKNKNKPGWIFRAKSNCRFFLESTSIRGCSRIVRSETHTLRWMWAIYLCSTTLFLIGSILKLVTEYMKYSVNIQTYNEMDAPMDFPTVTFCNHQPFSERAYELWKNGSVISPTRFNQLVRHRAAELFARSIQIPLNDNGTVRILNKSLMYESLRQGIVYDSLPLYYQSVQWPSQIDLGHDPKDLIALCLFQYGNQYAVTGPGCEDAVLRVKRLSDPKFFNCYSVEIIKEFSKSIKELGLILWLGPDENHGKEDRQAFLFDLFEQAYGIKVSIHEPGQMVNLDKYSFQIAPGRMNELTFQTVKIHHYDRPPKPCTHNPTQIYTDLNELYNYQFEVCLNSHLQRRIVEECGCLYAYYPRIYEPNKTLPYCGRLIDDSMRLMDMKVVEKHEHCAEGIVKNAAAYRKAIEDSETCKRRCVSVEYESQVSVTKWRATAWQLYW---SLKTSSLFDSVANGSLSPPDARL--------------IEHFLRTPNLADFENSTSPIVFDERYTYLLVRRKSNDTIIKEENLVLTVNALFSRIGGLCSLYIGLTLAVLMEIVEFIYISWVRRKEKKKSSDESSEQNEQNSQQSPTEDNHTEKTLLENN--KNDQKSNDQVGSS 613          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A504YZK8 (FMRFamide-activated amiloride-sensitive sodium channel OS=Fasciola gigantica OX=46835 GN=FGIG_11629 PE=3 SV=1)

HSP 1 Score: 436.802 bits (1122), Expect = 2.564e-142
Identity = 225/544 (41.36%), Postives = 318/544 (58.46%), Query Frame = 2
Query:   86 FFANTSIRGFSRIVKSETTFLRTLWILFVVSTITFLIVSIFKVVIDYRQYSVNIQTYIQIDNATPFPALTFCNHQPFSERAYQLWEESKVMSPTQFNELFRSEALKQFKDMVRTKMTPKDSDFNHPLFLTTINDRLSVYYQNLPTTVSSELGH--NISIIKNCVWSYGQHMAFDNH-CQDDMLIVKNISHPSYFNCFTVEPHPKYASIFSRLGLIIWLGPDEQTNIKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDRIYRDLDNVFKYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCGYLEPEKYHDL------LFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQYYNLMARNINIPSNNMTTTDRIMLQNLTSRIETFFTRKNLSEFIPE--------SEKLLFNERYTFVVVKRKANNTFIKEERLVLSFNALVSRVGGLCSLYIGLTFAFFIELIDFLYTII 1666
            F  + SIRG +RIVK++  F+R +WI F++ T  FL VS+ +++ +Y  YSVNIQTY+ +D    FPA+TFCNHQPFSE AY+LW   +V+SPTQFN + R  A +Q  ++    M     +  H  F   + D + +YYQNL     + LGH  N SI        G  ++     C D M+ V   SHP +FNC TV   P+Y      +GLIIWLGP E  +  HRQ FL D+F+QAYGLRV IHEP    N++S G+QIEPGR+NELN++   N+ + T + PCI +P+  Y+DLD+ + Y+ +LC N  +Q  ++  C+C+Y Y PR   P+K LPYCG    E    L      L R  C + + +++  +K   + +  C+  C S++Y +T SVT WR T WQL+W +E   A                  +   D       T+ + ++F   NLS  +          + K  F++RYT+V+VKRK+N+T +K E LVL+FNALVSR+GGLCSLYIG+TFA  IELI+F+Y  +
Sbjct:   35 FLESVSIRGCNRIVKAQNRFIRHMWIWFLIITSLFLCVSVSRLISEYLNYSVNIQTYVHMDAPANFPAITFCNHQPFSEHAYKLWRLGEVISPTQFNRVLRQAADRQ-ANVTHDTMGGLSPEVAHFAF---VFDSVKLYYQNLNWPYQTGLGHQRNESIYMCLFRHLGGRLSIGGSGCHDSMIRVTLRSHPHHFNCHTVSIDPQYGKQVQEVGLIIWLGPQENYDEMHRQAFLLDLFDQAYGLRVAIHEPEQLANLDSHGIQIEPGRMNELNFEVVRNVHMKTPKNPCITKPESKYQDLDSTYDYEFELCLNTLVQTEVVRTCQCLYAYLPRIAVPNKTLPYCGRFLTEAGQQLMQMPKVLQRMRCASDVISQSAHLKKLYETEGLCLRRCESVDYVSTVSVTTWRSTQWQLHWSQETAAA------------------LDVMD-------TAPLFSYFRTNNLSSVLGHYDTQSESPTGKYGFSDRYTYVLVKRKSNDTTVKAENLVLTFNALVSRIGGLCSLYIGMTFAVVIELIEFVYIAL 549          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A4E0RXL2 (FMRFamide-activated amiloride-sensitive sodium channel OS=Fasciola hepatica OX=6192 GN=D915_001083 PE=3 SV=1)

HSP 1 Score: 439.499 bits (1129), Expect = 3.049e-142
Identity = 226/544 (41.54%), Postives = 319/544 (58.64%), Query Frame = 2
Query:   86 FFANTSIRGFSRIVKSETTFLRTLWILFVVSTITFLIVSIFKVVIDYRQYSVNIQTYIQIDNATPFPALTFCNHQPFSERAYQLWEESKVMSPTQFNELFRSEALKQFKDMVRTKMTPKDSDFNHPLFLTTINDRLSVYYQNLPTTVSSELGH--NISIIKNCVWSYGQHMAFDNH-CQDDMLIVKNISHPSYFNCFTVEPHPKYASIFSRLGLIIWLGPDEQTNIKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDRIYRDLDNVFKYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCGYLEPEKYHDL------LFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQYYNLMARNINIPSNNMTTTDRIMLQNLTSRIETFFTRKNLSEFIPE--------SEKLLFNERYTFVVVKRKANNTFIKEERLVLSFNALVSRVGGLCSLYIGLTFAFFIELIDFLYTII 1666
            F  + SIRG +RIVK++  F+R +WI F++ T  FL VS+ +++ +Y  YSVNIQTY+ +D    FPA+TFCNHQPFSE AY+LW   +V+SPTQFN + R  A +Q  ++    M     +  H  F   + D + +YYQNL     + LGH  N SI        G  ++     C D M+ V   SHP +FNC TV   P+Y      +GLIIWLGP E  + KHRQ FL D+F+QAYGLRV IHEP    N++S G+QIEPGR+NELN++   N+ + T + PCI +P+  Y+DLD+ + Y+ +LC N  +Q  ++  C+C+Y Y PR   P+K LPYCG    E    L      L R  C + + +++  +K   + +  C+  C S++Y +T SVT WR T WQL+W +E   A                  +   D       T+ + ++F   NLS  +          + K  F++RYT+V+VKRK+N+T +K E LVL+FNALVSR+GGLCSLYIG+TFA  IELI+F+Y  +
Sbjct:   35 FLESVSIRGCNRIVKAQNRFIRHMWIWFLIITSLFLCVSVSRLISEYLNYSVNIQTYVHMDAPANFPAITFCNHQPFSEHAYKLWRLGEVISPTQFNRVLRQAADRQ-ANVTHDTMDGLSPEVAHFAF---VFDSVKLYYQNLNWPYQTGLGHQRNDSIYMCLFRHLGGRLSIGGSGCHDSMIRVTLRSHPHHFNCHTVSIDPQYGKQVQEVGLIIWLGPQENYDEKHRQAFLLDLFDQAYGLRVAIHEPEQLANLDSHGIQIEPGRMNELNFEVVRNVHMKTPQNPCITKPESKYQDLDSTYDYEFELCLNTLVQTEVVRTCQCLYAYLPRVAVPNKTLPYCGRFLTEAGQQLMQMPKVLQRMRCASDVISQSAHLKKLYETEGLCLRRCESVDYVSTVSVTTWRSTQWQLHWSQETAAA------------------LDVMD-------TAPLFSYFRTNNLSSVLGHYDTQSESPTGKYGFSDRYTYVLVKRKSNDTTVKAENLVLTFNALVSRIGGLCSLYIGMTFAVVIELIEFVYIAL 549          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 58.5362 bits (140), Expect = 3.332e-9
Identity = 113/519 (21.77%), Postives = 189/519 (36.42%), Query Frame = 2
Query:   71 EVIRKFFANTSIRGFSRIVKSETTFLRT-LW-ILFVVSTITFLIVSIFKVVIDYRQYSVNIQTYIQIDNATPFPALTFCNHQPFSERAYQL-WEESKVMSPTQFNELFRSE-------------ALKQFKDMVRTKMTPKDSDF-------------NHPLFLTTINDRLSVYYQNLPTTVSSELGH----NI-SIIKNCVWSYGQHMAFDNHCQDDMLIVKNISHPSYFNCFTVEPHPKYASIFSRLGLIIWLGPDEQTNIKHR--QGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPG-------RLNELNYQPE--LNIKVDTERKPCINEPDRIYRDLDNVFKYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCGYLEPEKYHDLLFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQY-----------YNLMARNINIP--SNNMTTTDRIMLQNLTSRIETFFTRKNLS 1453
            E+   F  NT+I G  R+V S+   L+T  W +LF V+ I F   S   V + Y  Y+V +   +    +T FPA+T C+  P+     Q    +   M+     +L+  +              ++    +V  +  P    F             ++   +  + +  +  Y N+ + V S +      NI   I +C++S          C D         HP+Y NC+T           S+L      G D   ++  R  Q           G R+++H+  S P +E  G  + PG       R+ E    P+   N   D    P +N    +Y     V   +   CF + L    +  C C Y +YP  L P+    YC       Y++  +  +C  K++ +   I   L    KC   C++  +  T     W P      W+  +L     Y            N+  R +N+   S +  T    +L N+ S+   +F    LS
Sbjct:   21 EMFEFFCDNTTIHGTIRLVCSKRNKLKTAFWSLLFTVTVILFYYTSAL-VFLQYYSYTVAVTMGLMFQQST-FPAITVCSLNPYRYEVVQSSLSQLDSMTGQALQQLYGYQPPATKAAGTAAAPGIRLDTGVVLERTGPDTVGFKLCNATGGDCFYQSYGSGVQAVTEWYTFQYVNIMSQVPSYIKQSDDANIEDFIFSCMFS-------GMPCSDSEY--SRFHHPTYGNCYTFNSANS-----SKLWQASKPGRDYGLSLILRTEQNDYIPFLSTVAGARIMVHDQESPPFMEEGGFDMRPGFETSLGIRMLEATRMPDPYGNCTEDGSNVPVLN----LYSSAYTVQVPECS-CFQLAL----VEACGCGYYFYP--LPPNAS--YC------SYNNTAWAGHCYYKLYRQF--ISDELGCVDKCAQPCTTKRFAVTPGYAAW-PDSSSEKWIFNLLSLQNNYSVTTVRNDVAKLNVYFRELNMKTISESAATNVIWLLSNIGSQWSLWFGSSVLS 501          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Match: SCNN1G (sodium channel epithelial 1 gamma subunit [Source:HGNC Symbol;Acc:HGNC:10602])

HSP 1 Score: 48.1358 bits (113), Expect = 5.679e-6
Identity = 63/279 (22.58%), Postives = 104/279 (37.28%), Query Frame = 2
Query:  632 KNISHPSYFNCFTVEPHPKYASI-FSRLGLIIWLGPDEQTNIKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDRIYRDLDNVFK--YDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELP-YCGYLEPEKYHDLLFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQYYNLMARNINIPSNNMTTTDRIMLQNLTSRIETFFTRKNLSE 1456
            K + HP   NCFT        S+  +  G+   L       +  RQ           G ++ IH  N+ P IE+ G+ I P   + L  +     K+      C  +   I  D+ +++   Y +  C N   Q  +I  C C       Y  P  E   +C Y     +      + C  ++++    IK  LK  + C   CS  E+  T S+  W P+     WL   L          ++   +P+N+      I + N+  +     T+K +SE
Sbjct:  267 KKLQHPILGNCFTFNDGSDGKSLDIASAGIDYGL----HMVLNTRQDNSLPYLAMGAGAKIGIHLQNTTPFIEAVGIDIPPAMESSLGLRVNDVQKLGDPYSDCTMDGSDI--DVKSLYDSPYSVQTCQNSCFQWEMIKSCGCA-----NYEQPLPEGSRFCNYDNNPGW------EYCYYRLYDMY--IKEELKCIQVCRQICSETEHEVTLSLADW-PSKASKGWLLRAL----------SKEQGLPANDTLKPSDIAIVNIYFK---DLTQKTISE 512          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000062815.1 (SMESG000062815.1)

HSP 1 Score: 1327 bits (3433), Expect = 0.000e+0
Identity = 640/643 (99.53%), Postives = 641/643 (99.69%), Query Frame = 2
Query:   29 MNSVIGNKKNKQCFEVIRKFFANTSIRGFSRIVKSETTFLRTLWILFVVSTITFLIVSIFKVVIDYRQYSVNIQTYIQIDNATPFPALTFCNHQPFSERAYQLWEESKVMSPTQFNELFRSEALKQFKDMVRTKMTPKDSDFNHPLFLTTINDRLSVYYQNLPTTVSSELGHNISIIKNCVWSYGQHMAFDNHCQDDMLIVKNISHPSYFNCFTVEPHPKYASIFSRLGLIIWLGPDEQTNIKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDRIYRDLDNVFKYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCGYLEPEKYHDLLFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQYYNLMARNINIPSNNMTTTDRIMLQNLTSRIETFFTRKNLSEFIPESEKLLFNERYTFVVVKRKANNTFIKEERLVLSFNALVSRVGGLCSLYIGLTFAFFIELIDFLYTIIFLRKPLSREDSVEKIERTGQKRTSQTLFLKNVHETDQKLKTEITNSPMELENNNMFHGTIYWNVSSKNQINENSNFLEDDNRGPTLSNPWIPIGDDK 1957
            MNSVIGNKKNKQCFEVIRKFFANTSIRGFSRIVKSETTFLRTLWILFVVSTITFLIVSIFKVVIDYRQYSVNIQTYIQIDNATPFPALTFCNHQPFSERAYQLWEESKVMSPTQFNELFRSEALKQFKDMVRTKMTPKDSDFNHPLFLTTINDRLSVYYQNLPTTVSSELGHNISIIKNCVWSYGQHMAFDNHCQDDMLIVKNISHPSYFNCFTVEPHPKYASIFSRLGLIIWLGPDEQTNIKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDRIYRDLDNVFKYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCGYLEPEKYHDLLFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQYYNLMARNINIPSNNMTTTDRIMLQNLTSRIETFFTRKNLSEFIPESEKLLFNERYTFVVVKRKANNTFIKEERLVLSFNALVSRVGGLCSLYIGLTFAFFIELIDFLYTIIFLRKPLSREDSVEK ERTGQKRTSQTLFLKNV ETDQKLKTEITNSPMELENNNMFHGTIYWNVSSKNQINENSNFLED+NRGPTLSNPWIPIGDDK
Sbjct:    1 MNSVIGNKKNKQCFEVIRKFFANTSIRGFSRIVKSETTFLRTLWILFVVSTITFLIVSIFKVVIDYRQYSVNIQTYIQIDNATPFPALTFCNHQPFSERAYQLWEESKVMSPTQFNELFRSEALKQFKDMVRTKMTPKDSDFNHPLFLTTINDRLSVYYQNLPTTVSSELGHNISIIKNCVWSYGQHMAFDNHCQDDMLIVKNISHPSYFNCFTVEPHPKYASIFSRLGLIIWLGPDEQTNIKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDRIYRDLDNVFKYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCGYLEPEKYHDLLFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQYYNLMARNINIPSNNMTTTDRIMLQNLTSRIETFFTRKNLSEFIPESEKLLFNERYTFVVVKRKANNTFIKEERLVLSFNALVSRVGGLCSLYIGLTFAFFIELIDFLYTIIFLRKPLSREDSVEKNERTGQKRTSQTLFLKNVRETDQKLKTEITNSPMELENNNMFHGTIYWNVSSKNQINENSNFLEDENRGPTLSNPWIPIGDDK 643          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000016913.1 (SMESG000016913.1)

HSP 1 Score: 564.303 bits (1453), Expect = 0.000e+0
Identity = 270/573 (47.12%), Postives = 381/573 (66.49%), Query Frame = 2
Query:   68 FEVIRKFFANTSIRGFSRIVKSETTFLRTLWILFVVSTITFLIVSIFKVVIDYRQYSVNIQTYIQIDNATPFPALTFCNHQPFSERAYQLWEESKVMSPTQFNELFRSEALKQFKDMVRTKMTPKDSDFNHPLFLTTINDRLSVYYQNLPTTVSSELGHNISIIKNCVWSYGQHMAFDNHCQDDMLIVKNISHPSYFNCFTVEPHPKYASIFSRLGLIIWLGPDEQTNIKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDRIYRDLDNVFKYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCGYLEPEKYHDLLFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQYYNLMARNINIPSNNM-TTTDRIMLQNLTSRIETFFTRKNLSEFI-PESEKLLFNERYTFVVVKRKANNTFIKEERLVLSFNALVSRVGGLCSLYIGLTFAFFIELIDFLYTIIFLRKPLSREDSVEKI-----ERTGQKRTSQTLFLKNVH 1765
            F+  + F ANTSIRGFSRI+++E+ F++ LW +++++    L +SI +V++DY QYSVNIQTY + DN T FPA+TFCNHQPFS  AY LW   +VMSPT+FN+  R  + K   ++ +T   P   +   PL  TT+ DR+S+YYQ+L   VS++LGHN S+  +C+W YG+ MAF   C+DDML+VK  SHPSYFNC+TVEP  + A   SR+G IIWLGP+E  +I+H+QGFL DIFEQAYGLRV +HE  SYPNI+  G QIEPGRLNELN+QP LN++V++  K C + P   Y+DL   F YD +LC N E+Q+ ++ +C C+YGYYPRY  P+K   YCG+L       ++   NC+ K  + +  +K+NL  +K C+  C +I+Y    SVTKWRPT+WQLYWLK V   + +Y +++ +  +  +     +T  + +++     + F  + NLS     E+ + +F +RY+FVVVKR+ NNTF+KEER VL+F+AL+SR+GGL SLYIGLTFAFF E+I++ Y  +F R     + +         E + +K   Q + LK  H
Sbjct:    6 FDYTKTFLANTSIRGFSRIIRTESIFIKWLWTVYIITNTVLLSISIHRVLLDYWQYSVNIQTYTRFDNGTAFPAVTFCNHQPFSLTAYNLWSSGQVMSPTEFNKKLRHLSSKYLDELEKT---PTVENMMKPLLWTTVMDRMSIYYQSLEPEVSAQLGHNQSMFHHCMWWYGKQMAFGESCKDDMLVVKRFSHPSYFNCYTVEPIKQVAMDISRIGAIIWLGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDNPTVTYQDLGVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTHNYCGHLNFTNDKSIIDNLNCLGKYMDSSSGLKANL--EKSCLLRCRNIDYDLAVSVTKWRPTEWQLYWLKHVNQHFQRYEDVLTKYTDKSTTEKEKSTLELQMKSHLEYFKKFLNQANLSRHSDSENSQSIFGDRYSFVVVKRRDNNTFVKEERFVLTFSALISRIGGLSSLYIGLTFAFFAEVIEYFYVCLFTRSDDDNQKASSTTVIIVNENSPKKNDIQNVLLKEHH 573          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000060702.1 (SMESG000060702.1)

HSP 1 Score: 345.51 bits (885), Expect = 2.075e-110
Identity = 203/540 (37.59%), Postives = 304/540 (56.30%), Query Frame = 2
Query:   74 VIRKFFANTSIRGFSRIVKSETTFLRTLWILFVVSTITFLIVSIFKVVIDYRQYSVNIQTYIQIDNATPFPALTFCNHQPFSERAYQLWEESKVMSPTQFNELFRSEALKQFKDMVRTKMTPKDSDFNHPLFLTTINDRLSVYYQNLPTTVSSELGHNISIIKNCVWSYGQHMAFDNHCQD-DMLIVKNISHPSYFNCFTVEPHPKYASIFSRL-GLIIWLGPDEQTNIKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCI--NEPDRIYRDLDNVFKYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCGYLEPE-KYHDLLFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQYYNLMARNINIPSNNMTTTDRIMLQNLTSRIETFFTRKNLSEF-IPESEKL--LFNERYTFVVVKRKANNTFIKEERLVLSFNALVSRVGGLCSLYIGLTFAFFIELIDFLYTIIF 1669
            ++  F    +IRG +++  S ++FLR LW +FV+     L+ +   +++DY +Y V +       N+T FPA+T C+H PFS+ AY+LW+  KV+SP+ FN   R  AL             +D  F +  +     D + +YYQNL    S  LGH  +I+  C+      + F+N CQ  D  ++K +SHP +FNC+T EP     S+ +R   LI+ LG  E     H Q FL D+FEQA GLR ++HEP + P+IE EG+ +EPG+LNE+N+QP LN+K+DT ++PCI  NE  ++  DLD+ + Y      N+E Q  I+  CKC+Y  YPR L+P+KE+PYCG L P+    +   R NC++        +    + +KKC   CS   Y  T S+TKWR   WQL+WL   L + AQ     A N NI + +         QN  +  +++  R++LS   I +S K   L  + + +VV+K+K++    + E+ VLS   L+SR+GG CSL IGLT A  +E I+F+Y +I 
Sbjct:   42 ILELFCRCMTIRGVNKMT-SASSFLRYLWSVFVLLMTIILVGATCLLILDYFKYDVTLHQRDLQKNST-FPAITICHHHPFSKDAYKLWDSKKVLSPSLFNLYMRQNALHYLN---------QDDKFANNFYYF---DSIDIYYQNLLYNESIALGHKYTIVLYCLRRNDYQIDFENDCQQFDSYVIKRLSHPQHFNCYTFEPRNISVSVSTRFFSLIVSLGRPEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLI-DLDSKYNYTFYEYINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYCGKLWPKIDLDEFTTRINCVSNYLK----MSLTEEIEKKCRPRCSYYTYEATVSITKWRAKQWQLHWLS--LQSNAQ----KALNANISAESY--------QNAKNSWKSYLERRDLSNVNIADSRKSLNLDGDDFAYVVLKKKSSILKERSEKEVLSLPVLLSRIGGFCSLLIGLTVAVVVEFIEFVYLLIL 548          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000043119.1 (SMESG000043119.1)

HSP 1 Score: 342.043 bits (876), Expect = 2.402e-108
Identity = 190/531 (35.78%), Postives = 300/531 (56.50%), Query Frame = 2
Query:   86 FFANTSIRGFSRIVKSETTFLRTLWILFVVSTITFLIVSIFKVVIDYRQYSVNIQTYIQIDNATPFPALTFCNHQPFSERAYQLWEESKVMSPTQFNELFRSEALKQFKDMVRTKMTPKDSDFNHPLFLTTIN--DRLSVYYQNLPTTVSSELGHNISIIKNCVWSYGQHMAFDNHCQD-DMLIVKNISHPSYFNCFTVEP-HPKYASIFSRLGLIIWLGPDEQTNIKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDRI-YRDLDNVFKYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCG-YLEPEKYHDLLFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQYYNLMARNINIPSNNMTTTDRIMLQNLTSRIETFFTRKNLSE-FIPESEKLLFNERYTFVVVKRKANNTFIKEERLVLSFNALVSRVGGLCSLYIGLTFAFFIELIDFLY 1657
            F +  SIRG ++I+K     LR LW+ FV+     LI S   +V D+  Y VNI T ++ID+ TPFPALT C+H PFS R Y++W+  K MSP+ FN   R+  L Q                N      TI+  D +S+YYQNLP   + ++GHN SI   C++     + F  +C   +   +K +SH  +FNC+T EP  P  +S    LG+I+ LGP E  +    Q F+ D F QA GL+VI+HE  + P+I+  G+ +EPG++NE+ Y+P      +T  KPCIN+  RI Y DL N + Y   LC     Q+ I+ +C C++ Y PR + P++ +PYCG  L+     ++     C++ + N+    K      +KC H C+ + + +T S+TKWR T+W LYWL++ + +  +    +  N   P+ N+T +     Q   + +  +  +K+L +  +  +E LL ++ + ++V++R++ ++  K ERLV++   LVSR+GGLCSL +G+T AF +EL++F Y
Sbjct:   64 FCSTISIRGINKIIKGPRP-LRLLWLCFVLIMSAILITSSCLLVRDFMLYDVNINTKLEIDSMTPFPALTVCHHHPFSHRGYRMWKSGKAMSPSYFNRKMRNLTLDQLL-------------LNDVESAETISYYDGISIYYQNLPYEQAIQMGHNSSIFLTCMYLLENQIYFAENCTKLEFYRIKLLSHHEHFNCYTFEPTQPHVSSNLDMLGIIVSLGP-EPKHFDMEQSFIIDTFRQAQGLKVIVHESGTLPDIDEAGLHVEPGKMNEIIYRPNQWQLTNTPAKPCINDTSRIAYVDLANTYNYTKHLCLKYAEQEDIMNQCHCMFIYNPRPMMPNESMPYCGSILKDFNLSNIYSYVKCLSDVLNQKS--KRQQWEKEKCFHRCNYMTFDSTISITKWRATEWHLYWLRQQITSLGEMKQFLKAN---PNRNVTES-----QAFKTWL-IYGNKKDLRKTGLKANEFLLKDDNFAYIVLRRESKDSVKKYERLVITQYVLVSRIGGLCSLTVGITLAFIVELVEFCY 568          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000039581.1 (SMESG000039581.1)

HSP 1 Score: 322.013 bits (824), Expect = 1.347e-100
Identity = 201/587 (34.24%), Postives = 320/587 (54.51%), Query Frame = 2
Query:   41 IGNKKNKQCFEVIRKFFANTSIRGFSRIVKSETTFLRTLWILFVVSTITFLIVSIFKVVIDYRQYSVNIQTYIQIDNATPFPALTFCNHQPFSERAYQLWEESKVMSPTQFNELFRSEALKQFKDMVRTKMTPKDSDFNHPLFLTTINDRLSVYYQNLPTTVSSELGHNISIIKNCVWSYGQHMAFDNHCQD-DMLIVKNISHPSYFNCFTVEPHPKYASIFSRLGLIIWLGPDEQTNIKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDR-IYRDLDNVFKYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCG-YLEPEKYHDLLFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQYYNLMARNINIPSNNMTTTDRIMLQNLTSRIETFFTRKNLSEFIPE-SEKLLFNERYTFVVVKRKANNTFIKEERLVLSFNALVSRVGGLCSLYIGLTFAFFIELIDFLYTIIFLRKPLSREDSVEKIERTGQ---KRTSQTLFLKNVHETDQK 1780
            + N K K  F +   F + TS++G ++I +     LR LW+ FV++  T LIVS   +V D+  Y VNI   +++ + TPFP++T C+H PFS  AY+ W E+K++SP+ FN   R+       +++  ++   +   N+        D +SVYYQN+    S  +GH   I  +C+      ++++ +C   +   VK  SH  +FNC+T E         + LG+I+ +GP    +    Q F+ D F QA GL+VI+HEP   P+I++ GV +EPG+LNE++Y+P      +T  KPC N+  +  Y DL+  + Y  D+C + E Q+RII EC CI+ Y PR   P+K+LPYCG +LE     +L  R  C+T I  E  + K  L+++ KC   C+ + Y T+ S+TKWR T+W L+W++  L  + Q  N    N  I +   T   + +          ++   NL+    +  E+ L N+ + ++V++R+++N+  K ERLV+S   LVSR+GGLCS  +G+T +FF+E+++FLY      K    E S + I    Q   KR  +   LK +  T  K
Sbjct:   70 LRNPKTKNVFIL---FCSTTSMKGMNKITRGPKP-LRFLWLSFVMTMSTVLIVSSCLLVRDFMLYDVNINIEVRLASQTPFPSITICHHHPFSMEAYKYWRENKILSPSTFNRKMRNLT---HSNLMGNRVMEAEGISNY--------DVISVYYQNIGYNDSMLIGHQKDIFLSCMLLRNNMISYEENCSKLEEYEVKMFSHHEHFNCYTFEAK---VDKITTLGIIVSMGPPPDYSATE-QAFIVDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYNDLERFYNYTQDMCLSSEEQKRIIDECHCIFIYNPRLQIPTKKLPYCGNFLEDSDLSELNHRIECLTNI-QEDVNFKKKLESE-KCFQRCTYMTYETSISITKWRATEWHLHWIRLQLLTFRQLKN----NPQINATESTYFKQWL---------KYWNATNLTVIDEDRKERFLANDNFAYIVLRRESDNSVRKYERLVISPYVLVSRIGGLCSFTVGITASFFVEILEFLYLYYQSNKTSKLEKSEDNIYEKTQFSPKRVLKKSSLKKIPNTKNK 622          
The following BLAST results are available for this feature:
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
SCNN1G1.167e-725.28sodium channel epithelial 1 gamma subunit [Source:... [more]
SCNN1A4.231e-620.07sodium channel epithelial 1 alpha subunit [Source:... [more]
SCNN1A6.046e-620.07sodium channel epithelial 1 alpha subunit [Source:... [more]
SCNN1A9.961e-620.07sodium channel epithelial 1 alpha subunit [Source:... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
del-43.525e-1521.18DEgenerin Like [Source:UniProtKB/TrEMBL;Acc:P9183... [more]
del-12.321e-923.23Degenerin del-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
del-12.589e-923.23Degenerin del-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
del-12.947e-923.23Degenerin del-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
copg21.039e-1528.37coatomer protein complex subunit gamma 2 [Source:X... [more]
copg21.061e-1528.37coatomer protein complex subunit gamma 2 [Source:X... [more]
foxe37.619e-1525.58forkhead box E3 [Source:Xenbase;Acc:XB-GENE-480592... [more]
cdh125.179e-1123.90cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase... [more]
cdh123.766e-1022.82cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Scnn1g6.866e-1023.53sodium channel, nonvoltage-gated 1 gamma [Source:M... [more]
Scnn1a2.459e-620.13sodium channel, nonvoltage-gated 1 alpha [Source:M... [more]
Scnn1a2.498e-620.13sodium channel, nonvoltage-gated 1 alpha [Source:M... [more]
Scnn1a4.702e-620.13sodium channel, nonvoltage-gated 1 alpha [Source:M... [more]
Scnn1a4.713e-620.13sodium channel, nonvoltage-gated 1 alpha [Source:M... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q25011|FANA_CORAP2.188e-1420.38FMRFamide-activated amiloride-sensitive sodium cha... [more]
sp|H2QAR5|SCNNG_PANTR4.170e-1322.10Amiloride-sensitive sodium channel subunit gamma O... [more]
sp|O13263|SCNNH_XENLA2.796e-1124.63Amiloride-sensitive sodium channel subunit gamma-2... [more]
sp|P51171|SCNNG_XENLA4.947e-1023.90Amiloride-sensitive sodium channel subunit gamma O... [more]
sp|H1AFJ5|SCNNA_NEOFS5.951e-1023.55Amiloride-sensitive sodium channel subunit alpha O... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183A6137.230e-15341.88Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A183WY055.830e-14643.19Uncharacterized protein OS=Trichobilharzia regenti... [more]
A0A0R3SVH16.823e-14439.26Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A504YZK82.564e-14241.36FMRFamide-activated amiloride-sensitive sodium cha... [more]
A0A4E0RXL23.049e-14241.54FMRFamide-activated amiloride-sensitive sodium cha... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SCNN1A3.332e-921.77sodium channel epithelial 1 alpha subunit [Source:... [more]
SCNN1G5.679e-622.58sodium channel epithelial 1 gamma subunit [Source:... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062815.10.000e+099.53SMESG000062815.1[more]
SMESG000016913.10.000e+047.12SMESG000016913.1[more]
SMESG000060702.12.075e-11037.59SMESG000060702.1[more]
SMESG000043119.12.402e-10835.78SMESG000043119.1[more]
SMESG000039581.11.347e-10034.24SMESG000039581.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022882 ID=SMED30022882|Name=FMRFamide-activated amiloride-sensitive sodium channel|organism=Schmidtea mediterranea sexual|type=transcript|length=1998bp
ATGACAATATCGCCGTAAATCAGTTGTCATGAATTCAGTTATTGGAAACA
AAAAAAATAAACAATGCTTTGAAGTGATTCGTAAATTCTTTGCAAACACT
TCAATCAGAGGATTCAGCAGAATTGTGAAATCAGAAACCACATTTCTCAG
AACTTTATGGATTTTGTTTGTAGTTAGCACAATCACCTTCCTGATTGTTT
CAATTTTCAAAGTGGTTATAGATTATAGGCAATATTCAGTTAACATTCAA
ACTTACATTCAAATAGACAATGCCACTCCATTTCCCGCTCTGACATTCTG
TAATCATCAACCTTTCTCGGAGAGAGCCTACCAATTGTGGGAAGAGTCCA
AAGTAATGTCACCAACGCAATTCAATGAACTATTTCGGTCAGAAGCACTC
AAACAATTTAAAGATATGGTTCGAACTAAAATGACTCCAAAAGACTCTGA
TTTCAATCATCCGTTATTTTTAACCACCATCAATGATAGACTTTCAGTCT
ATTATCAGAATTTACCGACCACCGTTTCATCGGAGCTTGGACATAACATA
TCAATAATAAAGAATTGTGTATGGTCATATGGTCAGCATATGGCTTTTGA
TAACCATTGTCAAGACGACATGTTAATTGTCAAAAACATATCTCACCCAT
CATATTTTAACTGCTTCACTGTCGAGCCACATCCAAAATACGCTTCAATA
TTTTCAAGGCTAGGTTTAATAATCTGGCTTGGTCCGGATGAGCAAACTAA
TATTAAACACAGACAAGGATTTCTTTTTGATATTTTCGAGCAAGCTTACG
GACTACGGGTTATCATTCATGAACCGAATTCTTATCCTAACATAGAAAGT
GAAGGAGTACAAATAGAACCTGGACGATTAAATGAACTCAACTATCAACC
GGAGCTGAATATAAAAGTTGACACGGAAAGAAAGCCGTGTATAAATGAAC
CAGACAGAATATATAGAGATCTTGATAATGTGTTCAAATATGATATTGAC
TTATGCTTTAACATGGAACTTCAACAAAGAATTATTACTGAATGCAAATG
TATATATGGCTACTATCCTAGATATCTTCATCCAAGTAAAGAATTACCTT
ATTGTGGTTACCTAGAACCGGAAAAGTATCATGATCTTTTGTTCAGGAAA
AATTGCATAACAAAAATTTTTAATGAAGCTCCAGATATTAAAAGTAATTT
AAAAGCTGATAAAAAGTGCATCCATAGTTGTTCTTCAATAGAGTACACTA
CTACAACTTCAGTAACAAAATGGAGACCTACAGATTGGCAACTTTATTGG
CTGAAAGAAGTACTTGATGCGTGGGCCCAATACTATAATCTTATGGCAAG
AAATATTAACATTCCATCCAATAATATGACAACAACAGATAGAATTATGT
TACAGAACTTAACTTCAAGAATTGAGACATTTTTCACGAGAAAGAATCTC
AGTGAATTTATTCCCGAAAGTGAAAAACTCCTTTTTAATGAAAGATATAC
TTTTGTTGTCGTAAAAAGAAAAGCTAACAATACTTTTATAAAAGAAGAAC
GTTTGGTTTTATCTTTCAATGCATTAGTCAGTCGCGTCGGTGGTTTATGC
TCATTGTATATTGGTTTGACATTCGCATTTTTCATAGAACTAATTGACTT
TTTGTATACTATTATTTTCTTAAGAAAACCTCTGTCACGAGAAGACTCAG
TTGAAAAAATTGAAAGAACGGGACAAAAACGCACGTCTCAAACTTTGTTT
CTGAAAAATGTACACGAAACGGATCAGAAACTCAAAACGGAAATCACTAA
TAGTCCAATGGAATTGGAGAATAACAACATGTTTCATGGAACGATCTACT
GGAATGTTTCCTCTAAAAATCAAATAAATGAAAATAGTAATTTTTTGGAA
GATGATAATCGTGGTCCAACTTTGTCCAACCCTTGGATACCAATTGGTGA
TGATAAATAATGTTTGAGGAATAATATAAGCTTTAATTGAAATGCTCC
back to top

protein sequence of SMED30022882-orf-1

>SMED30022882-orf-1 ID=SMED30022882-orf-1|Name=SMED30022882-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=644bp
MNSVIGNKKNKQCFEVIRKFFANTSIRGFSRIVKSETTFLRTLWILFVVS
TITFLIVSIFKVVIDYRQYSVNIQTYIQIDNATPFPALTFCNHQPFSERA
YQLWEESKVMSPTQFNELFRSEALKQFKDMVRTKMTPKDSDFNHPLFLTT
INDRLSVYYQNLPTTVSSELGHNISIIKNCVWSYGQHMAFDNHCQDDMLI
VKNISHPSYFNCFTVEPHPKYASIFSRLGLIIWLGPDEQTNIKHRQGFLF
DIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTE
RKPCINEPDRIYRDLDNVFKYDIDLCFNMELQQRIITECKCIYGYYPRYL
HPSKELPYCGYLEPEKYHDLLFRKNCITKIFNEAPDIKSNLKADKKCIHS
CSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQYYNLMARNINIPSNNM
TTTDRIMLQNLTSRIETFFTRKNLSEFIPESEKLLFNERYTFVVVKRKAN
NTFIKEERLVLSFNALVSRVGGLCSLYIGLTFAFFIELIDFLYTIIFLRK
PLSREDSVEKIERTGQKRTSQTLFLKNVHETDQKLKTEITNSPMELENNN
MFHGTIYWNVSSKNQINENSNFLEDDNRGPTLSNPWIPIGDDK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001873ENaC
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
GO:0006810transport
GO:0006811ion transport
GO:0035725sodium ion transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0005272sodium channel activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001873Epithelial sodium channelPRINTSPR01078AMINACHANNELcoord: 336..353
score: 32.44
coord: 85..101
score: 40.24
coord: 401..421
score: 31.62
coord: 45..62
score: 17.56
IPR001873Epithelial sodium channelPFAMPF00858ASCcoord: 24..545
e-value: 1.0E-54
score: 186.2
IPR001873Epithelial sodium channelPANTHERPTHR11690AMILORIDE-SENSITIVE SODIUM CHANNEL-RELATEDcoord: 20..559
NoneNo IPR availableGENE3DG3DSA:1.10.287.770coord: 45..541
e-value: 6.3E-32
score: 113.0
NoneNo IPR availableGENE3DG3DSA:1.10.3590.10coord: 98..262
e-value: 6.3E-32
score: 113.0
NoneNo IPR availableGENE3DG3DSA:1.10.287.820coord: 300..405
e-value: 6.3E-32
score: 113.0
NoneNo IPR availableGENE3DG3DSA:2.60.470.10coord: 75..513
e-value: 6.3E-32
score: 113.0
NoneNo IPR availableTMHMMTMhelixcoord: 530..552
NoneNo IPR availableTMHMMTMhelixcoord: 46..68