Transmembrane protein 41A

Overview
NameTransmembrane protein 41A
Smed IDSMED30022880
Length (bp)1533
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transmembrane protein 41A (SMED30022880) t-SNE clustered cells

Violin plots show distribution of expression levels for Transmembrane protein 41A (SMED30022880) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transmembrane protein 41A (SMED30022880) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transmembrane protein 41A (SMED30022880) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Transmembrane protein 41A vs. Ensembl Human
Match: TMEM41A (transmembrane protein 41A [Source:HGNC Symbol;Acc:HGNC:30544])

HSP 1 Score: 209.92 bits (533), Expect = 9.651e-64
Identity = 114/246 (46.34%), Postives = 167/246 (67.89%), Query Frame = 3
Query:  150 IFGSSLVCSCIVFIIFLIENRPSLSRDFDVPTMK--YEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYRQANI 881
            + G  LV +   F ++L+  R    R            + FP++L E++++ +VL +Y+KEH  YV +LF  AY++KQ F IPGS  LN+ AGALFG  +   L  +LT VGATCCYL+S  FG++LV  YFP K++ L++ +E N + LFF+L+FLRLFPMTPNW LN+++P++N+P+  FFFSV  GL+PYNFICVQTG+IL  ++SLD++F+   + K+   A V L+PG LI+  K+ Q ++
Sbjct:    4 LLGLLLVFAGCTFALYLLSTRLPRGRRLGSTEEAGGRSLWFPSDLAELRELSEVLREYRKEHQAYVFLLFCGAYLYKQGFAIPGSSFLNVLAGALFGPWLGLLLCCVLTSVGATCCYLLSSIFGKQLVVSYFPDKVALLQRKVEENRNSLFFFLLFLRLFPMTPNWFLNLSAPILNIPIVQFFFSVLIGLIPYNFICVQTGSILSTLTSLDALFSWDTVFKLLAIAMVALIPGTLIK--KFSQKHL 247          
BLAST of Transmembrane protein 41A vs. Ensembl Human
Match: TMEM41B (transmembrane protein 41B [Source:HGNC Symbol;Acc:HGNC:28948])

HSP 1 Score: 149.058 bits (375), Expect = 2.126e-40
Identity = 78/230 (33.91%), Postives = 133/230 (57.83%), Query Frame = 3
Query:  183 VFIIFLI-ENRPSLSRDFDVPTMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYR 869
             F++FL+ +N P LS +  V      +K P ++ + K + +VLS+YK      V++ + + Y+F Q+F IPGS  L+I +G L+  P+A FLV L +G+GA+ CY++S   GR +V +Y   K  +  + +E +   L  Y++FLR+ P  PNW +NI SP+INVPL  FF   F G+ P +F+ ++ G  LY +++     +   +  +   A +++LP +  +  K +
Sbjct:   65 AFVMFLVYKNFPQLSEEERV-----NMKVPRDMDDAKALGKVLSKYKDTFYVQVLVAYFATYIFLQTFAIPGSIFLSILSGFLYPFPLALFLVCLCSGLGASFCYMLSYLVGRPVVYKYLTEKAVKWSQQVERHREHLINYIIFLRITPFLPNWFINITSPVINVPLKVFFIGTFLGVAPPSFVAIKAGTTLYQLTTAGEAVSWNSIFILMILAVLSILPAIFQKKLKQK 289          
BLAST of Transmembrane protein 41A vs. Ensembl Human
Match: TMEM41B (transmembrane protein 41B [Source:HGNC Symbol;Acc:HGNC:28948])

HSP 1 Score: 149.058 bits (375), Expect = 2.126e-40
Identity = 78/230 (33.91%), Postives = 133/230 (57.83%), Query Frame = 3
Query:  183 VFIIFLI-ENRPSLSRDFDVPTMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYR 869
             F++FL+ +N P LS +  V      +K P ++ + K + +VLS+YK      V++ + + Y+F Q+F IPGS  L+I +G L+  P+A FLV L +G+GA+ CY++S   GR +V +Y   K  +  + +E +   L  Y++FLR+ P  PNW +NI SP+INVPL  FF   F G+ P +F+ ++ G  LY +++     +   +  +   A +++LP +  +  K +
Sbjct:   65 AFVMFLVYKNFPQLSEEERV-----NMKVPRDMDDAKALGKVLSKYKDTFYVQVLVAYFATYIFLQTFAIPGSIFLSILSGFLYPFPLALFLVCLCSGLGASFCYMLSYLVGRPVVYKYLTEKAVKWSQQVERHREHLINYIIFLRITPFLPNWFINITSPVINVPLKVFFIGTFLGVAPPSFVAIKAGTTLYQLTTAGEAVSWNSIFILMILAVLSILPAIFQKKLKQK 289          
BLAST of Transmembrane protein 41A vs. Ensembl Human
Match: TMEM41B (transmembrane protein 41B [Source:HGNC Symbol;Acc:HGNC:28948])

HSP 1 Score: 149.058 bits (375), Expect = 2.126e-40
Identity = 78/230 (33.91%), Postives = 133/230 (57.83%), Query Frame = 3
Query:  183 VFIIFLI-ENRPSLSRDFDVPTMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYR 869
             F++FL+ +N P LS +  V      +K P ++ + K + +VLS+YK      V++ + + Y+F Q+F IPGS  L+I +G L+  P+A FLV L +G+GA+ CY++S   GR +V +Y   K  +  + +E +   L  Y++FLR+ P  PNW +NI SP+INVPL  FF   F G+ P +F+ ++ G  LY +++     +   +  +   A +++LP +  +  K +
Sbjct:   65 AFVMFLVYKNFPQLSEEERV-----NMKVPRDMDDAKALGKVLSKYKDTFYVQVLVAYFATYIFLQTFAIPGSIFLSILSGFLYPFPLALFLVCLCSGLGASFCYMLSYLVGRPVVYKYLTEKAVKWSQQVERHREHLINYIIFLRITPFLPNWFINITSPVINVPLKVFFIGTFLGVAPPSFVAIKAGTTLYQLTTAGEAVSWNSIFILMILAVLSILPAIFQKKLKQK 289          
BLAST of Transmembrane protein 41A vs. Ensembl Human
Match: TMEM41B (transmembrane protein 41B [Source:HGNC Symbol;Acc:HGNC:28948])

HSP 1 Score: 82.8037 bits (203), Expect = 1.181e-17
Identity = 46/123 (37.40%), Postives = 75/123 (60.98%), Query Frame = 3
Query:  183 VFIIFLI-ENRPSLSRDFDVPTMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRK 548
             F++FL+ +N P LS +  V      +K P ++ + K + +VLS+YK      V++ + + Y+F Q+F IPGS  L+I +G L+  P+A FLV L +G+GA+ CY++S   GR +V +Y   K
Sbjct:   65 AFVMFLVYKNFPQLSEEERV-----NMKVPRDMDDAKALGKVLSKYKDTFYVQVLVAYFATYIFLQTFAIPGSIFLSILSGFLYPFPLALFLVCLCSGLGASFCYMLSYLVGRPVVYKYLTEK 182          
BLAST of Transmembrane protein 41A vs. Ensembl Celegans
Match: Y71A12C.2 (pep chromosome:WBcel235:I:14046234:14048017:-1 gene:WBGene00013513.1 transcript:Y71A12C.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y71A12C.2)

HSP 1 Score: 171.014 bits (432), Expect = 1.353e-49
Identity = 77/183 (42.08%), Postives = 119/183 (65.03%), Query Frame = 3
Query:  237 VPTMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVF 785
            +P      +FP +L  ++++   L++Y++ H  Y ++LF +AY++KQ+F IPGSF +N+ AGALFG      LV  L  VGA+ C+ +S  F   +V+R+   +I  LR L+ A    L+F+L+  R+FP TP+WLLNI+SP ++VPL Y   SVF GL PYN +CV+ G +L +++S+  VF
Sbjct:   27 LPEGAQRPRFPRDLEGLRELSSSLTKYEESHAAYTVLLFSAAYLYKQTFAIPGSFFMNLLAGALFGTVRGVALVCSLNAVGASLCFCLSALFAAPIVDRFLKSRIESLRCLVNAERDRLWFFLLSARIFPFTPHWLLNISSPFLDVPLRYHASSVFVGLFPYNLLCVRAGTVLAEVNSMSDVF 209          
BLAST of Transmembrane protein 41A vs. Ensembl Celegans
Match: bus-19 (pep chromosome:WBcel235:V:12878516:12882108:1 gene:WBGene00011590.1 transcript:T07F10.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:bus-19)

HSP 1 Score: 170.629 bits (431), Expect = 2.294e-49
Identity = 84/198 (42.42%), Postives = 121/198 (61.11%), Query Frame = 3
Query:  261 KFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIR 854
            + P        +      YK++H  Y+  LF  AY++KQ+F IPGSFLLN+ AG ++ +   F L   LT +G+T CY+ S  FGRE V  YF +K++ L++ I+ N + L  +L+F R+FP++P+WLLNI +P +N+PL  F  S  FGL PYNFICVQ G IL D+ S D VF+   + K+   A + L   + IR
Sbjct:   37 EIPKQFDNFTVLADKFRAYKEDHFGYITTLFICAYLYKQTFAIPGSFLLNVIAGVVYDLWSGFILCCCLTTLGSTLCYMFSELFGREYVFYYFGQKLTYLQQKIDDNSNRLLPFLLFARMFPISPSWLLNIVAPFLNIPLPIFVVSALFGLAPYNFICVQAGYILRDLRSWDDVFSTTTMLKLFSFALIPLAYAIYIR 234          
BLAST of Transmembrane protein 41A vs. Ensembl Celegans
Match: tag-175 (Transmembrane protein 41 homolog [Source:UniProtKB/Swiss-Prot;Acc:O62126])

HSP 1 Score: 149.058 bits (375), Expect = 2.390e-41
Identity = 82/222 (36.94%), Postives = 129/222 (58.11%), Query Frame = 3
Query:  204 ENRPSLSRDFDVPTMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGS--AYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSK 863
             N P +S D      K  +K+P NL + KQ+ +VLS+YK+   NY ++L G    YVF QSF IPGS  L I +G LF   +A  LV   +  GA  CY +S+ FGR  V + FP +I++ +  +  +      Y++FLR+ P+ PNWL+NIASP+++VPL  FF+  F G+ P +F+ +Q G+ L  +S     ++ + +  +  +A ++L P +L +  K
Sbjct:   30 SNFPEVSAD-----EKVHLKYPRNLEDAKQLGRVLSKYKEN--NYSVVLCGVIVVYVFLQSFAIPGSIFLTILSGYLFPFYVAIVLVCSCSATGAAICYTISKLFGRSFVLQKFPERIAKWQDDLSKHRDDFLNYMIFLRVTPIVPNWLINIASPVLDVPLAPFFWGTFLGVAPPSFLYIQAGSTLEQLSHTSVAWSWSSIVLLTGSAILSLAPILLKKKLK 244          
BLAST of Transmembrane protein 41A vs. Ensembl Fly
Match: stas (gene:FBgn0030850 transcript:FBtr0074487)

HSP 1 Score: 167.548 bits (423), Expect = 2.355e-47
Identity = 92/243 (37.86%), Postives = 138/243 (56.79%), Query Frame = 3
Query:  150 IFGSSLVCSCIVFIIFLIENRPSLSRDFDVPTMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGS--AYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYRQ 872
            IF +SLV  C V+ IF     P L+      + K  +K P ++ + K + +VL +YK   M Y  ++FG   AYVF Q+F IPGS  L+I  G L+  PIA FL+   + +GAT CY +S   GR L+  ++P+K S+  K +E     LF Y++FLR+ P+ PNW +N+ASP+I VPLH F    F G+ P + I +Q G  L  ++S    F+   +  +   A  +LLPG+L    K+++
Sbjct:   88 IFVASLVTMCYVYAIF-----PELNA-----SEKQHLKIPRDIQDAKMLAKVLDRYKD--MYYFEVMFGVVVAYVFLQTFAIPGSLFLSILLGFLYKFPIALFLICFCSALGATLCYTLSNLVGRRLIRHFWPKKTSEWSKHVEEYRDSLFNYMLFLRMTPILPNWFINLASPVIGVPLHIFALGTFCGVAPPSVIAIQAGKTLQKMTSSSEAFSWTSMGILMACACASLLPGLLKNKFKHKK 318          
BLAST of Transmembrane protein 41A vs. Ensembl Zebrafish
Match: tmem41aa (transmembrane protein 41aa [Source:NCBI gene;Acc:553803])

HSP 1 Score: 216.853 bits (551), Expect = 2.135e-66
Identity = 117/234 (50.00%), Postives = 162/234 (69.23%), Query Frame = 3
Query:  204 ENRPSLSRDFDVP----TMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYRQANILPDG 893
            E   + ++D D P    T    +KFP++L E+K++ ++L  YK EH  YV++LF SAY++KQ+F IPGS  LNI AGALFG      L  +LT VGAT C+L+S+ FG+  + + FP K++ L+K +E N S LFF+L+FLR FPM+PNW LN+ SP++N+P+  FF +VF GLMPYNFICVQTG++L  ISSLD +F+ +V+ K+   A V LLPG LIR  KY   ++  DG
Sbjct:   37 EGETTDAKDGDEPSEMETASSRLKFPSDLDELKEMAELLQFYKTEHTGYVLLLFCSAYLYKQAFAIPGSSFLNILAGALFGTWFGLLLTCVLTTVGATLCFLLSQAFGKHHIVKLFPDKVAMLQKKVEENRSSLFFFLLFLRFFPMSPNWFLNMTSPILNIPVTLFFMAVFIGLMPYNFICVQTGSMLSQISSLDDLFSWSVVLKLLLTACVALLPGALIR--KYSTRHLHLDG 268          
BLAST of Transmembrane protein 41A vs. Ensembl Zebrafish
Match: tmem41ab (transmembrane protein 41ab [Source:NCBI gene;Acc:406356])

HSP 1 Score: 191.045 bits (484), Expect = 1.184e-56
Identity = 110/212 (51.89%), Postives = 151/212 (71.23%), Query Frame = 3
Query:  234 DVPTMKY-EVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLI-RYSK 863
            D P  K   +KFP++L E++++ ++L  YK EH  YV ILF SAY++KQSF IPGS  LN+ +GALFG      +   LT VG+T CYL+SR FG+  + R FP K++ L++++E N S LFF+L+FLR FPMTPNW LN+ SP++N+P+  FFFS+  GL+PYNFICV TG +L +I+SLD +F+ + L ++   A V LLPG LI RYSK
Sbjct:   44 DEPEEKVLRLKFPSDLEELRELAELLKFYKTEHTGYVFILFCSAYLYKQSFAIPGSSFLNMLSGALFGPLHGLIIACTLTTVGSTNCYLLSRTFGKRHIVRLFPEKVAMLQRMVEENRSSLFFFLLFLRFFPMTPNWFLNVTSPILNIPIPIFFFSILIGLIPYNFICVHTGAVLSEINSLDDIFSWSTLLQLLLIACVALLPGALIRRYSK 255          
BLAST of Transmembrane protein 41A vs. Ensembl Zebrafish
Match: tmem41ab (transmembrane protein 41ab [Source:NCBI gene;Acc:406356])

HSP 1 Score: 189.889 bits (481), Expect = 3.472e-56
Identity = 110/212 (51.89%), Postives = 150/212 (70.75%), Query Frame = 3
Query:  234 DVPTMKY-EVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLI-RYSK 863
            D P  K   +KFP++L E++++ ++L  YK EH  YV ILF SAY++KQSF IPGS  LN+ +GALFG      +   LT VG+T CYL+SR FG+  + R FP K++ L++++E N S LFF+L+FLR FPMTPNW LN+ SP+ N+P+  FFFS+  GL+PYNFICV TG +L +I+SLD +F+ + L ++   A V LLPG LI RYSK
Sbjct:   44 DEPEEKVLRLKFPSDLEELRELAELLKFYKTEHTGYVFILFCSAYLYKQSFAIPGSSFLNMLSGALFGPLHGLIIACTLTTVGSTNCYLLSRTFGKRHIVRLFPEKVAMLQRMVEENRSSLFFFLLFLRFFPMTPNWFLNVTSPIFNIPIPIFFFSILIGLIPYNFICVHTGAVLSEINSLDDIFSWSTLLQLLLIACVALLPGALIRRYSK 255          
BLAST of Transmembrane protein 41A vs. Ensembl Zebrafish
Match: tmem41ab (transmembrane protein 41ab [Source:NCBI gene;Acc:406356])

HSP 1 Score: 189.119 bits (479), Expect = 7.736e-56
Identity = 110/212 (51.89%), Postives = 150/212 (70.75%), Query Frame = 3
Query:  234 DVPTMK-YEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLI-RYSK 863
            D P  K   +KFP++L E++++ ++L  YK EH  YV ILF SAY++KQSF IPGS  LN+ +GALFG      +   LT VG+T CYL+SR FG+  + R FP K++ L++++E N S LFF+L+FLR FPMTPNW LN+ SP++N+P+  FFFS+  GL+PYNFICV TG +L +I+SLD +F+   L ++   A V LLPG LI RYSK
Sbjct:   44 DEPEEKVLRLKFPSDLEELRELAELLKFYKTEHTGYVFILFCSAYLYKQSFAIPGSSFLNMLSGALFGPLHGLIIACTLTTVGSTNCYLLSRTFGKRHIVRLFPEKVAMLQRMVEENRSSLFFFLLFLRFFPMTPNWFLNVTSPILNIPIPIFFFSILIGLIPYNFICVHTGAVLSEINSLDDIFSWFTLLQLLLIACVALLPGALIRRYSK 255          
BLAST of Transmembrane protein 41A vs. Ensembl Zebrafish
Match: tmem41b (transmembrane protein 41B [Source:NCBI gene;Acc:561208])

HSP 1 Score: 150.599 bits (379), Expect = 2.633e-41
Identity = 73/202 (36.14%), Postives = 122/202 (60.40%), Query Frame = 3
Query:  168 VCS-CIVFIIFLIENRPSLSRDFDVPTMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISS 770
             CS C+++++F   N P LS D      + ++K P ++ + K +  VLS+YK  +   V++ + + Y+F Q+F IPGS  L+I +G L+  P+A FLV L +G+GA+ CY++S   GR +V +Y   +  +  + ++ +   L  Y++FLR+ P  PNW +NI SP+INVPL  FF   F G+ P +F+ +  G  LY +++
Sbjct:   53 ACSACVMYLVF--RNFPQLSED-----EREKIKIPKDMEDAKALGTVLSKYKDTYYTQVLLAYFATYIFLQTFAIPGSIFLSILSGYLYPFPLALFLVCLCSGLGASFCYMLSYLVGRPMVYKYLTERAQKWSQQVDKHREHLINYIIFLRITPFLPNWFINITSPVINVPLGVFFLGTFLGVAPPSFVAINAGTTLYKLTT 247          
BLAST of Transmembrane protein 41A vs. Ensembl Xenopus
Match: cfap157 (cilia and flagella associated protein 157 [Source:Xenbase;Acc:XB-GENE-5795998])

HSP 1 Score: 206.068 bits (523), Expect = 2.257e-62
Identity = 113/250 (45.20%), Postives = 165/250 (66.00%), Query Frame = 3
Query:  111 VMKKLTSSTYFKLIFGSSLVCSCIVFIIFLIEN--RPSLSRDFDVPTMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIR 854
            ++ +L+S T  + + G  LV  C  F ++ +    RP   ++      +  + FP++L E++++   L  YK+EH  YV++LF SAY++KQSF IPGS  LN+  GALFG  +  FL   LT +GAT CYL+S  FG+++V  YFP K+S L+  +E N S LFF+L+FLRLFPMTPNW LN+ SP++N+P+  FFFSV  GL+PYNFICVQTG+IL  + SLD +F+   + K+   A   L+PG +++
Sbjct:    1 MLSQLSSGT-MRSLPGFLLVFGCATFYLYALSTKLRPGSGQE-----AERSLVFPSDLEELRELADFLQHYKREHQTYVMVLFCSAYLYKQSFAIPGSSFLNLLGGALFGPWLGLFLCCTLTSIGATFCYLLSHAFGKKMVLMYFPDKVSTLQNKVEENRSSLFFFLLFLRLFPMTPNWFLNLTSPILNIPVEQFFFSVLIGLLPYNFICVQTGSILSQVKSLDDMFSSGTIFKLLAIALTALVPGAIVK 244          
BLAST of Transmembrane protein 41A vs. Ensembl Xenopus
Match: dedd2 (death effector domain containing 2 [Source:Xenbase;Acc:XB-GENE-1004127])

HSP 1 Score: 149.828 bits (377), Expect = 7.705e-41
Identity = 78/232 (33.62%), Postives = 134/232 (57.76%), Query Frame = 3
Query:  177 CIVFIIFLI-ENRPSLSRDFDVPTMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYR 869
            C   I+FL+ ++ P LS +      + ++K P ++ + K + +VLS+YK      V++ + + Y+F Q+F IPGS  L+I +G L+  P+A FLV L +G+GA+ CYL+S   GR +V +Y   K  +  + +E +   L  Y++FLR+ P  PNW +NI SP+INVPL  FF   F G+ P +F+ ++ G  LY +++     +   +  +   A +++LP +  +  K +
Sbjct:   54 CAASIMFLVYKHFPQLSEE-----EREKIKVPRDMDDAKALGKVLSKYKDTFYVEVLVAYFTTYIFLQTFAIPGSIFLSILSGFLYPFPLALFLVCLCSGLGASFCYLLSYLVGRPVVYKYLSDKAIKWSQQVERHRDHLINYIIFLRITPFLPNWFINITSPVINVPLKVFFLGTFIGVAPPSFVAIKAGTTLYQLTTAGEAVSWNSVIILMVLAVLSILPAIFQKKLKKK 280          
BLAST of Transmembrane protein 41A vs. Ensembl Xenopus
Match: dedd2 (death effector domain containing 2 [Source:Xenbase;Acc:XB-GENE-1004127])

HSP 1 Score: 149.443 bits (376), Expect = 7.733e-41
Identity = 78/232 (33.62%), Postives = 134/232 (57.76%), Query Frame = 3
Query:  177 CIVFIIFLI-ENRPSLSRDFDVPTMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYR 869
            C   I+FL+ ++ P LS +      + ++K P ++ + K + +VLS+YK      V++ + + Y+F Q+F IPGS  L+I +G L+  P+A FLV L +G+GA+ CYL+S   GR +V +Y   K  +  + +E +   L  Y++FLR+ P  PNW +NI SP+INVPL  FF   F G+ P +F+ ++ G  LY +++     +   +  +   A +++LP +  +  K +
Sbjct:   45 CAASIMFLVYKHFPQLSEE-----EREKIKVPRDMDDAKALGKVLSKYKDTFYVEVLVAYFTTYIFLQTFAIPGSIFLSILSGFLYPFPLALFLVCLCSGLGASFCYLLSYLVGRPVVYKYLSDKAIKWSQQVERHRDHLINYIIFLRITPFLPNWFINITSPVINVPLKVFFLGTFIGVAPPSFVAIKAGTTLYQLTTAGEAVSWNSVIILMVLAVLSILPAIFQKKLKKK 271          
BLAST of Transmembrane protein 41A vs. Ensembl Xenopus
Match: dedd2 (death effector domain containing 2 [Source:Xenbase;Acc:XB-GENE-1004127])

HSP 1 Score: 149.443 bits (376), Expect = 9.365e-41
Identity = 78/232 (33.62%), Postives = 134/232 (57.76%), Query Frame = 3
Query:  177 CIVFIIFLI-ENRPSLSRDFDVPTMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYR 869
            C   I+FL+ ++ P LS +      + ++K P ++ + K + +VLS+YK      V++ + + Y+F Q+F IPGS  L+I +G L+  P+A FLV L +G+GA+ CYL+S   GR +V +Y   K  +  + +E +   L  Y++FLR+ P  PNW +NI SP+INVPL  FF   F G+ P +F+ ++ G  LY +++     +   +  +   A +++LP +  +  K +
Sbjct:   50 CAASIMFLVYKHFPQLSEE-----EREKIKVPRDMDDAKALGKVLSKYKDTFYVEVLVAYFTTYIFLQTFAIPGSIFLSILSGFLYPFPLALFLVCLCSGLGASFCYLLSYLVGRPVVYKYLSDKAIKWSQQVERHRDHLINYIIFLRITPFLPNWFINITSPVINVPLKVFFLGTFIGVAPPSFVAIKAGTTLYQLTTAGEAVSWNSVIILMVLAVLSILPAIFQKKLKKK 276          
BLAST of Transmembrane protein 41A vs. Ensembl Xenopus
Match: dedd2 (death effector domain containing 2 [Source:Xenbase;Acc:XB-GENE-1004127])

HSP 1 Score: 148.288 bits (373), Expect = 3.237e-40
Identity = 78/232 (33.62%), Postives = 134/232 (57.76%), Query Frame = 3
Query:  177 CIVFIIFLI-ENRPSLSRDFDVPTMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYR 869
            C   I+FL+ ++ P LS +      + ++K P ++ + K + +VLS+YK      V++ + + Y+F Q+F IPGS  L+I +G L+  P+A FLV L +G+GA+ CYL+S   GR +V +Y   K  +  + +E +   L  Y++FLR+ P  PNW +NI SP+INVPL  FF   F G+ P +F+ ++ G  LY +++     +   +  +   A +++LP +  +  K +
Sbjct:   69 CAASIMFLVYKHFPQLSEE-----EREKIKVPRDMDDAKALGKVLSKYKDTFYVEVLVAYFTTYIFLQTFAIPGSIFLSILSGFLYPFPLALFLVCLCSGLGASFCYLLSYLVGRPVVYKYLSDKAIKWSQQVERHRDHLINYIIFLRITPFLPNWFINITSPVINVPLKVFFLGTFIGVAPPSFVAIKAGTTLYQLTTAGEAVSWNSVIILMVLAVLSILPAIFQKKLKKK 295          
BLAST of Transmembrane protein 41A vs. Ensembl Mouse
Match: Tmem41a (transmembrane protein 41a [Source:MGI Symbol;Acc:MGI:1913914])

HSP 1 Score: 207.994 bits (528), Expect = 3.264e-63
Identity = 109/205 (53.17%), Postives = 154/205 (75.12%), Query Frame = 3
Query:  264 FPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLI-RYSKYRQA 875
            FP++L E++++ +VL +Y+KEH  YV +LF SAY++KQ F IPGS  LN+ AGALFG  +   L  +LT VGAT CYL+S  FG++LV  YFP K++ L+K +E N + LFF+L+FLRLFPMTPNW LN+++P++N+P+  FFFSV  GL+PYNFICVQTG+IL  ++SLD++F+   + K+   A V L+PG LI ++S+ R A
Sbjct:   44 FPSDLAELRELSEVLREYRKEHQAYVFLLFCSAYLYKQGFAIPGSSFLNVLAGALFGPWLGLLLCCVLTSVGATGCYLLSSLFGKQLVISYFPDKVALLQKKVEENRNSLFFFLLFLRLFPMTPNWFLNLSAPILNIPIVQFFFSVLIGLIPYNFICVQTGSILSTLTSLDALFSWETVLKLLAIALVALVPGTLIKKFSQKRLA 248          
BLAST of Transmembrane protein 41A vs. Ensembl Mouse
Match: Tmem41b (transmembrane protein 41B [Source:MGI Symbol;Acc:MGI:1289225])

HSP 1 Score: 152.91 bits (385), Expect = 5.389e-42
Identity = 79/233 (33.91%), Postives = 136/233 (58.37%), Query Frame = 3
Query:  174 SCIVFIIFLI-ENRPSLSRDFDVPTMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYR 869
            SC  F++FL+ +N P LS +  V      +K P ++ + K + +VLS+YK      V++ + + Y+F Q+F IPGS  L+I +G L+  P+A FLV L +G+GA+ CY++S   GR +V +Y   K  +  + +E +   L  Y++FLR+ P  PNW +NI SP+INVPL  FF   F G+ P +F+ ++ G  L+ +++     + + +  +   A +++LP +  +  K +
Sbjct:   62 SCAAFVMFLVYKNFPQLSEEERV-----NMKVPRDMDDAKALGKVLSKYKDTFYVQVLVAYFATYIFLQTFAIPGSIFLSILSGFLYPFPLALFLVCLCSGLGASFCYMLSYLVGRPVVYKYLTEKAVKWSQQVERHREHLINYIIFLRITPFLPNWFINITSPVINVPLKVFFIGTFLGVAPPSFVAIKAGTTLHQLTTAGEAVSWSSVFILMVLALLSILPAIFQKQLKQK 289          
BLAST of Transmembrane protein 41A vs. Ensembl Mouse
Match: Tmem41b (transmembrane protein 41B [Source:MGI Symbol;Acc:MGI:1289225])

HSP 1 Score: 152.91 bits (385), Expect = 5.389e-42
Identity = 79/233 (33.91%), Postives = 136/233 (58.37%), Query Frame = 3
Query:  174 SCIVFIIFLI-ENRPSLSRDFDVPTMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYR 869
            SC  F++FL+ +N P LS +  V      +K P ++ + K + +VLS+YK      V++ + + Y+F Q+F IPGS  L+I +G L+  P+A FLV L +G+GA+ CY++S   GR +V +Y   K  +  + +E +   L  Y++FLR+ P  PNW +NI SP+INVPL  FF   F G+ P +F+ ++ G  L+ +++     + + +  +   A +++LP +  +  K +
Sbjct:   62 SCAAFVMFLVYKNFPQLSEEERV-----NMKVPRDMDDAKALGKVLSKYKDTFYVQVLVAYFATYIFLQTFAIPGSIFLSILSGFLYPFPLALFLVCLCSGLGASFCYMLSYLVGRPVVYKYLTEKAVKWSQQVERHREHLINYIIFLRITPFLPNWFINITSPVINVPLKVFFIGTFLGVAPPSFVAIKAGTTLHQLTTAGEAVSWSSVFILMVLALLSILPAIFQKQLKQK 289          
BLAST of Transmembrane protein 41A vs. Ensembl Mouse
Match: Tmem41b (transmembrane protein 41B [Source:MGI Symbol;Acc:MGI:1289225])

HSP 1 Score: 145.591 bits (366), Expect = 3.907e-40
Identity = 74/222 (33.33%), Postives = 128/222 (57.66%), Query Frame = 3
Query:  204 ENRPSLSRDFDVPTMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYR 869
            +N P LS +  V      +K P ++ + K + +VLS+YK      V++ + + Y+F Q+F IPGS  L+I +G L+  P+A FLV L +G+GA+ CY++S   GR +V +Y   K  +  + +E +   L  Y++FLR+ P  PNW +NI SP+INVPL  FF   F G+ P +F+ ++ G  L+ +++     + + +  +   A +++LP +  +  K +
Sbjct:    6 KNFPQLSEEERV-----NMKVPRDMDDAKALGKVLSKYKDTFYVQVLVAYFATYIFLQTFAIPGSIFLSILSGFLYPFPLALFLVCLCSGLGASFCYMLSYLVGRPVVYKYLTEKAVKWSQQVERHREHLINYIIFLRITPFLPNWFINITSPVINVPLKVFFIGTFLGVAPPSFVAIKAGTTLHQLTTAGEAVSWSSVFILMVLALLSILPAIFQKQLKQK 222          
BLAST of Transmembrane protein 41A vs. UniProt/SwissProt
Match: sp|Q502G2|T41AA_DANRE (Transmembrane protein 41A-A OS=Danio rerio OX=7955 GN=tmem41aa PE=2 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 1.612e-65
Identity = 117/234 (50.00%), Postives = 162/234 (69.23%), Query Frame = 3
Query:  204 ENRPSLSRDFDVP----TMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYRQANILPDG 893
            E   + ++D D P    T    +KFP++L E+K++ ++L  YK EH  YV++LF SAY++KQ+F IPGS  LNI AGALFG      L  +LT VGAT C+L+S+ FG+  + + FP K++ L+K +E N S LFF+L+FLR FPM+PNW LN+ SP++N+P+  FF +VF GLMPYNFICVQTG++L  ISSLD +F+ +V+ K+   A V LLPG LIR  KY   ++  DG
Sbjct:   37 EGETTDAKDGDEPSEMETASSRLKFPSDLDELKEMAELLQFYKTEHTGYVLLLFCSAYLYKQAFAIPGSSFLNILAGALFGTWFGLLLTCVLTTVGATLCFLLSQAFGKHHIVKLFPDKVAMLQKKVEENRSSLFFFLLFLRFFPMSPNWFLNMTSPILNIPVTLFFMAVFIGLMPYNFICVQTGSMLSQISSLDDLFSWSVVLKLLLTACVALLPGALIR--KYSTRHLHLDG 268          
BLAST of Transmembrane protein 41A vs. UniProt/SwissProt
Match: sp|Q08D99|TM41A_BOVIN (Transmembrane protein 41A OS=Bos taurus OX=9913 GN=TMEM41A PE=2 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 2.423e-63
Identity = 110/206 (53.40%), Postives = 155/206 (75.24%), Query Frame = 3
Query:  264 FPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYRQANI 881
            FP++L E++++ +VL +Y+KEH  YV +LF SAY++KQSF IPGS  LN+ AGALFG  +   L  +LT VGAT CYL+S  FG++LV  YFP K++ L+K +E N +GLFF+L+FLRLFPMTPNW LN+++P++N+P+  FFFSV  GL+PYNFICVQTG+IL  ++SLD++F+     K+   A V L+PG LI+  K+ Q ++
Sbjct:   44 FPSDLAELRELSEVLREYRKEHQVYVFLLFCSAYLYKQSFAIPGSSFLNVLAGALFGPWLGLLLCCVLTSVGATGCYLLSSVFGKQLVVFYFPDKVALLQKKVEENRNGLFFFLLFLRLFPMTPNWFLNLSAPILNIPIVQFFFSVLIGLIPYNFICVQTGSILSTLTSLDALFSWETAFKLLAIALVALVPGTLIK--KFSQKDL 247          
BLAST of Transmembrane protein 41A vs. UniProt/SwissProt
Match: sp|Q96HV5|TM41A_HUMAN (Transmembrane protein 41A OS=Homo sapiens OX=9606 GN=TMEM41A PE=1 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 4.635e-63
Identity = 114/246 (46.34%), Postives = 167/246 (67.89%), Query Frame = 3
Query:  150 IFGSSLVCSCIVFIIFLIENRPSLSRDFDVPTMK--YEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYRQANI 881
            + G  LV +   F ++L+  R    R            + FP++L E++++ +VL +Y+KEH  YV +LF  AY++KQ F IPGS  LN+ AGALFG  +   L  +LT VGATCCYL+S  FG++LV  YFP K++ L++ +E N + LFF+L+FLRLFPMTPNW LN+++P++N+P+  FFFSV  GL+PYNFICVQTG+IL  ++SLD++F+   + K+   A V L+PG LI+  K+ Q ++
Sbjct:    4 LLGLLLVFAGCTFALYLLSTRLPRGRRLGSTEEAGGRSLWFPSDLAELRELSEVLREYRKEHQAYVFLLFCGAYLYKQGFAIPGSSFLNVLAGALFGPWLGLLLCCVLTSVGATCCYLLSSIFGKQLVVSYFPDKVALLQRKVEENRNSLFFFLLFLRLFPMTPNWFLNLSAPILNIPIVQFFFSVLIGLIPYNFICVQTGSILSTLTSLDALFSWDTVFKLLAIAMVALIPGTLIK--KFSQKHL 247          
BLAST of Transmembrane protein 41A vs. UniProt/SwissProt
Match: sp|Q9D8U2|TM41A_MOUSE (Transmembrane protein 41A OS=Mus musculus OX=10090 GN=Tmem41a PE=2 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 2.283e-62
Identity = 109/205 (53.17%), Postives = 154/205 (75.12%), Query Frame = 3
Query:  264 FPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLI-RYSKYRQA 875
            FP++L E++++ +VL +Y+KEH  YV +LF SAY++KQ F IPGS  LN+ AGALFG  +   L  +LT VGAT CYL+S  FG++LV  YFP K++ L+K +E N + LFF+L+FLRLFPMTPNW LN+++P++N+P+  FFFSV  GL+PYNFICVQTG+IL  ++SLD++F+   + K+   A V L+PG LI ++S+ R A
Sbjct:   44 FPSDLAELRELSEVLREYRKEHQAYVFLLFCSAYLYKQGFAIPGSSFLNVLAGALFGPWLGLLLCCVLTSVGATGCYLLSSLFGKQLVISYFPDKVALLQKKVEENRNSLFFFLLFLRLFPMTPNWFLNLSAPILNIPIVQFFFSVLIGLIPYNFICVQTGSILSTLTSLDALFSWETVLKLLAIALVALVPGTLIKKFSQKRLA 248          
BLAST of Transmembrane protein 41A vs. UniProt/SwissProt
Match: sp|Q6NV38|T41AB_DANRE (Transmembrane protein 41A-B OS=Danio rerio OX=7955 GN=tmem41ab PE=2 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 5.840e-55
Identity = 110/212 (51.89%), Postives = 150/212 (70.75%), Query Frame = 3
Query:  234 DVPTMK-YEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLI-RYSK 863
            D P  K   +KFP++L E++++ ++L  YK EH  YV ILF SAY++KQSF IPGS  LN+ +GALFG      +   LT VG+T CYL+SR FG+  + R FP K++ L++++E N S LFF+L+FLR FPMTPNW LN+ SP++N+P+  FFFS+  GL+PYNFICV TG +L +I+SLD +F+   L ++   A V LLPG LI RYSK
Sbjct:   44 DEPEEKVLRLKFPSDLEELRELAELLKFYKTEHTGYVFILFCSAYLYKQSFAIPGSSFLNMLSGALFGPLHGLIIACTLTTVGSTNCYLLSRTFGKRHIVRLFPEKVAMLQRMVEENRSSLFFFLLFLRFFPMTPNWFLNVTSPILNIPIPIFFFSILIGLIPYNFICVHTGAVLSEINSLDDIFSWFTLLQLLLIACVALLPGALIRRYSK 255          
BLAST of Transmembrane protein 41A vs. TrEMBL
Match: A0A1W2WG71 (transmembrane protein 41A-A-like OS=Ciona intestinalis OX=7719 GN=LOC100181666 PE=4 SV=1)

HSP 1 Score: 231.491 bits (589), Expect = 3.333e-69
Identity = 111/216 (51.39%), Postives = 149/216 (68.98%), Query Frame = 3
Query:  219 LSRDFDVPTMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIR-YSK 863
            LS  FD  +  + V FP N  ++K +  +L  Y+++H   VI+LF SAY++KQ+F IPGS  +NI  GAL G   +F LV  L+ VGA+CCYL+S+YFG +LV+R FP K+   +  ++ NE  LFF+L+  RLFPM+PNW LNI SP+I VP+H FF SVF GLMPYNFICVQTG+IL  + S+D VF+ +    M   A V LLPG+L+R Y+K
Sbjct:   25 LSTQFD--SKDFVVHFPQNFEDLKSLSSMLKSYQEDHFKLVILLFVSAYIYKQTFAIPGSVFMNILGGALLGTWTSFPLVCFLSAVGASCCYLLSKYFGSQLVKRKFPEKVRSFQSKVKENEDRLFFFLLSARLFPMSPNWFLNITSPIIGVPIHLFFVSVFIGLMPYNFICVQTGSILASVKSMDDVFSMSTFIGMLLVAVVALLPGILLRSYTK 238          
BLAST of Transmembrane protein 41A vs. TrEMBL
Match: A0A482X7D6 (Uncharacterized protein OS=Laodelphax striatellus OX=195883 GN=LSTR_LSTR000290 PE=4 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 4.889e-68
Identity = 114/228 (50.00%), Postives = 155/228 (67.98%), Query Frame = 3
Query:  213 PSLSRDFDVPTMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYRQANILPDGR 896
            P L  D DV      +KFP++  E+KQI  +L  Y  ++  YV+ILF SAY++KQSF IPGS  +N+  GA+FGV I F L  +LT  GA+ C+LMSR FG+  ++ YFP KI  LR  ++ N + L ++L+FLRLFPMTPNWL+N+  P+++VPLH FF SVFFGLMPYN++CVQ G +L  +SSLD VF+   L ++A  A+V L+P +L R  K R  NIL   +
Sbjct:   26 PQLGTDDDV-----SLKFPSSFDELKQIANLLKLYYDKNWLYVVILFSSAYLYKQSFMIPGSVFMNVLGGAIFGVLIGFPLCCILTAFGASFCFLMSRAFGKSTLQYYFPSKIQFLRSKVDENPNNLIYFLLFLRLFPMTPNWLINVLCPIVDVPLHLFFISVFFGLMPYNYLCVQAGGMLASLSSLDEVFSLRTLLQLAAMASVALVPSLLFR--KQRSENILKSAK 246          
BLAST of Transmembrane protein 41A vs. TrEMBL
Match: H2Z2V4 (Uncharacterized protein OS=Ciona savignyi OX=51511 PE=4 SV=1)

HSP 1 Score: 226.868 bits (577), Expect = 1.656e-67
Identity = 107/199 (53.77%), Postives = 140/199 (70.35%), Query Frame = 3
Query:  258 VKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIR 854
            V FP N  ++K +  +L  Y++EH   V+I+F SAYV+KQ+F IPGS  +NI  GAL G  ++F +V  L+  GA+CCYL+S++FG  LV   FP ++  LR  ++ANE  LFF+L+  RLFPMTPNWLLNI SP+I VP+H FFFSV  GLMPYNFICVQTG+IL  + SLD VF+ +    M   A V LLPG+L+R
Sbjct:   32 VHFPQNFEDLKSLSSMLRTYQEEHFQLVMIMFVSAYVYKQTFAIPGSVFMNILGGALLGTWVSFPIVCFLSATGASCCYLLSKHFGSSLVVWKFPTQVYSLRSRVKANEDRLFFFLLSARLFPMTPNWLLNITSPIIGVPIHLFFFSVAVGLMPYNFICVQTGSILASVKSLDDVFSLSTFMGMLLVAMVALLPGILVR 230          
BLAST of Transmembrane protein 41A vs. TrEMBL
Match: K1RNR3 (Transmembrane protein 41A OS=Crassostrea gigas OX=29159 GN=CGI_10012423 PE=4 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 1.346e-66
Identity = 116/218 (53.21%), Postives = 159/218 (72.94%), Query Frame = 3
Query:  198 LIENRPSLSRDFDVPTMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLI 851
            L  N P L+ +    T+K E+KFPT+L ++K +  +L  YK EH  YV++LF SAY++KQ+F IPGS  +N+ AGALFGV  +F LV  LT  GATCCY +S+YFG++ V RYFP K+  +++ +E N   LFF+L+FLR FPM+PNW LN++SP++N+P+H FFFSVF GLMPYNFICVQTG++L  ISS++ VFT   L K+A  A V L+P  ++
Sbjct:   21 LSTNIPELAAN---STLKGELKFPTSLEDIKSVSDLLMMYKDEHFLYVLVLFCSAYIYKQTFAIPGSVFMNLLAGALFGVWKSFPLVCFLTATGATCCYNLSKYFGKQYVIRYFPEKVKFMQEKVENNYDSLFFFLLFLRFFPMSPNWFLNVSSPILNIPVHMFFFSVFIGLMPYNFICVQTGSMLSQISSMEDVFTSGTLLKLAAIALVALVPSFIM 235          
BLAST of Transmembrane protein 41A vs. TrEMBL
Match: A0A2G8JGT2 (Putative transmembrane protein OS=Stichopus japonicus OX=307972 GN=BSL78_28258 PE=4 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 8.523e-66
Identity = 102/236 (43.22%), Postives = 160/236 (67.80%), Query Frame = 3
Query:  174 SCIVFIIFLIENRPSL-SRDFDVPTMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYRQAN 878
            +   ++  L  N PSL S + D P    E+ FP +L ++  + +++ +YK +H  Y+ +LF SAY++KQ+F IPGS  +N+  GA+FG+  AF L  +L+ VGA+ C+ +S++FG+ L+ +YF  K+   +K+++ N   LFF+L+ +R+FPMTPNW +N+ASP+++VPL  FFFSV  GLMPYNF+CVQTG+IL +I+S+  V T +V+ K    A   LLPG+L +Y K  ++ 
Sbjct:   16 AATAWLYLLAANLPSLPSTEKDEPDSGMELHFPKDLEDLSDMAEMMKRYKSDHFGYITLLFCSAYLYKQTFAIPGSVFMNLLGGAIFGIWQAFPLCCVLSAVGASFCFCLSKFFGKVLIMKYFADKLEPFQKMVQENLESLFFFLLSIRIFPMTPNWFINMASPILDVPLIQFFFSVLIGLMPYNFVCVQTGSILSEITSVKDVMTTSVMVKFGLVAVAMLLPGLLAKYLKQSRSK 251          
BLAST of Transmembrane protein 41A vs. Ensembl Cavefish
Match: tmem41ab (transmembrane protein 41A-B-like [Source:NCBI gene;Acc:103032240])

HSP 1 Score: 209.92 bits (533), Expect = 3.524e-64
Identity = 107/213 (50.23%), Postives = 154/213 (72.30%), Query Frame = 3
Query:  255 EVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYRQANILPDG 893
             + FP++L E++++ ++L  YK++H  YV++L+ SAY++KQSF IPGS  LN+ AGALFG     F+  +LT VG+T CYL+SR FG+  + R FP K++ L++  E N S +FF+L+FLR FPMTPNW LNI SP++N+P+  FFFSV  GL+PYNFICV+TG IL +I+SLD +F+   L ++   A + LLPG LIR  +Y Q+++  DG
Sbjct:   21 RLHFPSDLDELRELAELLKFYKRQHTGYVLLLYCSAYLYKQSFAIPGSSFLNMLAGALFGPWHGLFIACILTTVGSTNCYLLSRTFGKRHIVRLFPDKVALLQRKAEDNRSSMFFFLLFLRFFPMTPNWFLNITSPILNIPIPIFFFSVLIGLIPYNFICVRTGAILSEITSLDDIFSWRTLLQLLLIACMALLPGALIR--RYSQSHLKLDG 231          
BLAST of Transmembrane protein 41A vs. Ensembl Cavefish
Match: tmem41ab (transmembrane protein 41A-B-like [Source:NCBI gene;Acc:103032240])

HSP 1 Score: 209.534 bits (532), Expect = 1.426e-63
Identity = 107/213 (50.23%), Postives = 154/213 (72.30%), Query Frame = 3
Query:  255 EVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYRQANILPDG 893
             + FP++L E++++ ++L  YK++H  YV++L+ SAY++KQSF IPGS  LN+ AGALFG     F+  +LT VG+T CYL+SR FG+  + R FP K++ L++  E N S +FF+L+FLR FPMTPNW LNI SP++N+P+  FFFSV  GL+PYNFICV+TG IL +I+SLD +F+   L ++   A + LLPG LIR  +Y Q+++  DG
Sbjct:   62 RLHFPSDLDELRELAELLKFYKRQHTGYVLLLYCSAYLYKQSFAIPGSSFLNMLAGALFGPWHGLFIACILTTVGSTNCYLLSRTFGKRHIVRLFPDKVALLQRKAEDNRSSMFFFLLFLRFFPMTPNWFLNITSPILNIPIPIFFFSVLIGLIPYNFICVRTGAILSEITSLDDIFSWRTLLQLLLIACMALLPGALIR--RYSQSHLKLDG 272          
BLAST of Transmembrane protein 41A vs. Ensembl Cavefish
Match: tmem41aa (transmembrane protein 41A-A [Source:NCBI gene;Acc:103028368])

HSP 1 Score: 195.282 bits (495), Expect = 1.533e-58
Identity = 111/227 (48.90%), Postives = 160/227 (70.48%), Query Frame = 3
Query:  213 PSLSRDFDVPTMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYRQANILPDG 893
            PS       P     +KFP++L E+++   +L  Y++EH  YV++LF SAY++KQ+F IPGS LLNI AGALFG  +   L  +LT VGAT C+L+S+ FG++ + R FP K++ L++ +E N S LFF+L+FLR FPM+PNW LN++SP+ N+P+  FF SVF GLMPYNF+CVQTG++L D++SLD +F+ ++L K+  AA   LLP  +IR+  Y  A++  DG
Sbjct:   26 PSAHLGDGEPEAGTGLKFPSDLEELREQAALLRHYQQEHSGYVLLLFCSAYIYKQAFAIPGSSLLNILAGALFGPWLGLLLACVLTTVGATLCFLLSQAFGKQHIVRLFPDKVTLLQRKVEENRSSLFFFLLFLRFFPMSPNWFLNMSSPIANIPVSLFFLSVFIGLMPYNFVCVQTGSVLSDLTSLDVLFSWSILLKLLLAAGAALLPAAIIRH--YSHAHLKLDG 250          
BLAST of Transmembrane protein 41A vs. Ensembl Sea Lamprey
Match: tmem41aa (transmembrane protein 41aa [Source:NCBI gene;Acc:553803])

HSP 1 Score: 207.223 bits (526), Expect = 2.628e-64
Identity = 107/212 (50.47%), Postives = 147/212 (69.34%), Query Frame = 3
Query:  258 VKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYRQANILPDG 893
            + FP+NL E++Q+ +VL+ YK E   YV++LF SAY++KQ+F IPGS  LN+  GALFG      L  LLT  GATCCYL+SR FG++++   FP K+  L+K +E N   LFF+L+FLR FPM+PNW LNI +P+IN+P+ +FF SV  GL+PYNFICVQ G IL ++SSLD VF+ A + ++   A   L+PG LI+   +R+   L  G
Sbjct:    1 ISFPSNLEELQQLAKVLNSYKAEQTGYVLLLFCSAYLYKQTFAIPGSVFLNVLGGALFGFWRGLPLCCLLTACGATCCYLLSRVFGKQIIISKFPSKVEALQKKVEENRESLFFFLLFLRFFPMSPNWFLNITAPIINIPIKHFFCSVLIGLLPYNFICVQAGCILSEVSSLDDVFSWATMLQLLAIALAALMPGALIQRCSHRRLKPLAGG 212          
BLAST of Transmembrane protein 41A vs. Ensembl Nematostella
Match: EDO48921 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHV7])

HSP 1 Score: 205.297 bits (521), Expect = 1.242e-62
Identity = 109/240 (45.42%), Postives = 164/240 (68.33%), Query Frame = 3
Query:  183 VFIIFLIENRPSLSRDF--------DVPTMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYRQAN 878
            +++ FL +  P L+R+         +    + E+ FP+++ E+K +  +L  YKKE+  YV +LF SAY++KQ+F IPGS  +NI AGA+FG+  AF L   LT  GA+CCYL+SR FGR L+ +YFP +++ L+  +  N   LFF+L+FLRLFPM+PNW LN+ SP+++VPL  FF SVF GLMPYNF+C QTG +L  + SL+ +FT +V+ K+A  A V ++PG++++   ++Q N
Sbjct:   27 LYLYFLSKWLPPLAREMVSEDDLNSNTTNQRAELYFPSSIEELKALASILKMYKKENSGYVALLFCSAYLYKQTFAIPGSVFMNILAGAIFGIWKAFPLTCFLTACGASCCYLLSRTFGRSLLVQYFPERVAALQAKVHENLDRLFFFLLFLRLFPMSPNWFLNMTSPILDVPLPQFFVSVFIGLMPYNFLCCQTGCLLSQLKSLNDLFTASVMFKLAAMAFVAMVPGLVVK-RLHKQHN 265          
BLAST of Transmembrane protein 41A vs. Ensembl Nematostella
Match: EDO36860 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHB7])

HSP 1 Score: 137.502 bits (345), Expect = 1.312e-37
Identity = 72/210 (34.29%), Postives = 117/210 (55.71%), Query Frame = 3
Query:  240 PTMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYR 869
            P  + ++K P N+ + K + + LS Y  E+   V++ F   ++F Q+F IPGS   +I +G LF  P+A F+V L + VGA+ CYL+S      LV+ YFP ++ +    +  ++  L  Y++FLR+ P  PNW +NI SP+I VPL  FF   F G+ P +F  +  G  LY +S+   + +   +  +   A ++LLP +  R  K +
Sbjct:   13 PNDRAKIKLPRNMDDAKGLGRALSNYTDEYFTQVLLGFIVVFIFLQTFAIPGSIFGSILSGFLFPFPLALFVVCLCSSVGASFCYLLSYLVAGGLVKHYFPERVEKWCTQVSHHQDDLLSYIIFLRITPFLPNWFINITSPVIGVPLMPFFIGTFIGVAPPSFGFISAGVELYVLSTTGDLISGKSIMIVIVCAIISLLPVIFKRQLKNK 222          
BLAST of Transmembrane protein 41A vs. Ensembl Medaka
Match: tmem41aa (transmembrane protein 41A [Source:NCBI gene;Acc:101171038])

HSP 1 Score: 207.994 bits (528), Expect = 3.855e-63
Identity = 106/209 (50.72%), Postives = 151/209 (72.25%), Query Frame = 3
Query:  255 EVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYRQANI 881
             +KFP++L +++++ ++L  YK EH  YV++LF SAY++KQSF IPGS  LNI AGA+FG      L  +LT VG+T CYL+S+ FG+  +   FP K+S L+K +E N+  LFF+L+FLR FPMTPNW LN+++P++N+PL +FF SVF GL+PYNFICVQTG +L ++SSLD +F+   L ++   A V+LLPG LIR   +R   +
Sbjct:   55 RLKFPSDLEDLRELAELLQFYKTEHTGYVLLLFCSAYLYKQSFAIPGSSFLNILAGAIFGPYKGLLLACVLTTVGSTMCYLLSQAFGKRYIVHLFPSKVSMLQKKVEENQDCLFFFLLFLRFFPMTPNWFLNMSAPIVNIPLTFFFLSVFIGLLPYNFICVQTGVMLSEVSSLDDLFSWERLLQLLAIACVSLLPGALIRSYSHRHLKV 263          
BLAST of Transmembrane protein 41A vs. Ensembl Medaka
Match: tmem41ab (transmembrane protein 41A-B [Source:NCBI gene;Acc:101174769])

HSP 1 Score: 196.438 bits (498), Expect = 9.979e-59
Identity = 105/227 (46.26%), Postives = 152/227 (66.96%), Query Frame = 3
Query:  213 PSLSRDFDVPTMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYRQANILPDG 893
            P  +   D   + + +KFP++L  ++++   L  YK+E+  YV++LF SAY++KQSF IPGS  LN+ AGA+FG      L  LL   G+T C+L+S  FG++ V   FP K++ L++ +E N S LFF L+FLR FPMTPNW LNI  P++N+P+  FFFSV  GL+PYNFICV+TG+IL  ISSLD +F+   LA++   A V L+PG +I++  Y + ++  DG
Sbjct:   33 PPDTEGADAQELDFRLKFPSDLESLRELADTLKFYKRENYGYVLLLFCSAYLYKQSFAIPGSSFLNMLAGAIFGPWEGLLLACLLATSGSTFCFLLSSVFGKQYVVHLFPEKVALLQRKVEENRSSLFFLLLFLRFFPMTPNWFLNITCPVLNIPISIFFFSVLIGLIPYNFICVRTGSILSQISSLDDIFSWGTLAQLLAIALVALVPGAMIKH--YSKTHLKVDG 257          
BLAST of Transmembrane protein 41A vs. Ensembl Medaka
Match: tmem41b (transmembrane protein 41B [Source:NCBI gene;Acc:101159568])

HSP 1 Score: 153.68 bits (387), Expect = 9.058e-43
Identity = 78/223 (34.98%), Postives = 132/223 (59.19%), Query Frame = 3
Query:  174 SCIVFIIFLI-ENRPSLSRDFDVPTMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLP 839
            +C   +++L+ +N P L  D     M+ ++K P ++ + K +  VLS+YK  +   V++ + + YVF Q+F IPGS  L+I +G L+  P+A FLV L +G+GA+ CY++S   GR +V +Y   K+ +  + ++ +   L  Y++FLR+ P  PNW +NI SP+INVPL  FF   F G+ P +F+ +  G  LY +++     +   LA +   A +++LP
Sbjct:   38 ACSASVMYLVYKNFPELPDD----EME-KIKIPKDMDDAKALGTVLSKYKDTYYTQVLVAYFATYVFLQTFAIPGSIFLSILSGYLYPFPLALFLVCLCSGLGASFCYMLSYLVGRPVVYKYLTEKVQKWSQQVDKHRDHLINYIIFLRITPFLPNWFINITSPVINVPLGIFFIGTFLGVAPPSFVAINAGTTLYKLTTAGEAVSWNSLAVLGVLAVLSILP 255          
BLAST of Transmembrane protein 41A vs. Ensembl Medaka
Match: tmem41b (transmembrane protein 41B [Source:NCBI gene;Acc:101159568])

HSP 1 Score: 153.68 bits (387), Expect = 1.296e-42
Identity = 78/223 (34.98%), Postives = 132/223 (59.19%), Query Frame = 3
Query:  174 SCIVFIIFLI-ENRPSLSRDFDVPTMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLP 839
            +C   +++L+ +N P L  D     M+ ++K P ++ + K +  VLS+YK  +   V++ + + YVF Q+F IPGS  L+I +G L+  P+A FLV L +G+GA+ CY++S   GR +V +Y   K+ +  + ++ +   L  Y++FLR+ P  PNW +NI SP+INVPL  FF   F G+ P +F+ +  G  LY +++     +   LA +   A +++LP
Sbjct:   48 ACSASVMYLVYKNFPELPDD----EME-KIKIPKDMDDAKALGTVLSKYKDTYYTQVLVAYFATYVFLQTFAIPGSIFLSILSGYLYPFPLALFLVCLCSGLGASFCYMLSYLVGRPVVYKYLTEKVQKWSQQVDKHRDHLINYIIFLRITPFLPNWFINITSPVINVPLGIFFIGTFLGVAPPSFVAINAGTTLYKLTTAGEAVSWNSLAVLGVLAVLSILP 265          
BLAST of Transmembrane protein 41A vs. Planmine SMEST
Match: SMESG000016189.1 (SMESG000016189.1)

HSP 1 Score: 563.148 bits (1450), Expect = 0.000e+0
Identity = 278/278 (100.00%), Postives = 278/278 (100.00%), Query Frame = 3
Query:   96 MLSFYVMKKLTSSTYFKLIFGSSLVCSCIVFIIFLIENRPSLSRDFDVPTMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYRQANILPDGRIVPDSQEIKID 929
            MLSFYVMKKLTSSTYFKLIFGSSLVCSCIVFIIFLIENRPSLSRDFDVPTMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYRQANILPDGRIVPDSQEIKID
Sbjct:    1 MLSFYVMKKLTSSTYFKLIFGSSLVCSCIVFIIFLIENRPSLSRDFDVPTMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYRQANILPDGRIVPDSQEIKID 278          
BLAST of Transmembrane protein 41A vs. Planmine SMEST
Match: SMESG000016189.1 (SMESG000016189.1)

HSP 1 Score: 563.148 bits (1450), Expect = 0.000e+0
Identity = 278/278 (100.00%), Postives = 278/278 (100.00%), Query Frame = 3
Query:   96 MLSFYVMKKLTSSTYFKLIFGSSLVCSCIVFIIFLIENRPSLSRDFDVPTMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYRQANILPDGRIVPDSQEIKID 929
            MLSFYVMKKLTSSTYFKLIFGSSLVCSCIVFIIFLIENRPSLSRDFDVPTMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYRQANILPDGRIVPDSQEIKID
Sbjct:    1 MLSFYVMKKLTSSTYFKLIFGSSLVCSCIVFIIFLIENRPSLSRDFDVPTMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYRQANILPDGRIVPDSQEIKID 278          
BLAST of Transmembrane protein 41A vs. Planmine SMEST
Match: SMESG000016189.1 (SMESG000016189.1)

HSP 1 Score: 551.206 bits (1419), Expect = 0.000e+0
Identity = 272/272 (100.00%), Postives = 272/272 (100.00%), Query Frame = 3
Query:  114 MKKLTSSTYFKLIFGSSLVCSCIVFIIFLIENRPSLSRDFDVPTMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYRQANILPDGRIVPDSQEIKID 929
            MKKLTSSTYFKLIFGSSLVCSCIVFIIFLIENRPSLSRDFDVPTMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYRQANILPDGRIVPDSQEIKID
Sbjct:    1 MKKLTSSTYFKLIFGSSLVCSCIVFIIFLIENRPSLSRDFDVPTMKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYRQANILPDGRIVPDSQEIKID 272          
BLAST of Transmembrane protein 41A vs. Planmine SMEST
Match: SMESG000016189.1 (SMESG000016189.1)

HSP 1 Score: 463.766 bits (1192), Expect = 7.663e-164
Identity = 227/227 (100.00%), Postives = 227/227 (100.00%), Query Frame = 3
Query:  249 KYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYRQANILPDGRIVPDSQEIKID 929
            KYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYRQANILPDGRIVPDSQEIKID
Sbjct:    9 KYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGVLIRYSKYRQANILPDGRIVPDSQEIKID 235          
BLAST of Transmembrane protein 41A vs. Planmine SMEST
Match: SMESG000036871.1 (SMESG000036871.1)

HSP 1 Score: 117.472 bits (293), Expect = 3.550e-30
Identity = 62/197 (31.47%), Postives = 113/197 (57.36%), Query Frame = 3
Query:  249 KYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPGSFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPRKISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFFSVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLP 839
            K+ +KFP  + ++K +  +LS YK ++   V+I     Y+  QSF IPGS + +I  G L+    A  ++SL + VGA+ C+ + +  G  ++++ FP+ +        + ++ +F Y+  LRL P  PNW +NI +P   VPL +FF   FFG++P + + V+ G  L +++S D++ + + L  M   + +++LP
Sbjct:    9 KHSIKFPKTVEDLKSLGLILSNYKTKYHWQVLISIILVYITLQSFMIPGSVVFSILLGYLYTFFEAIVVISLCSSVGASICFSIFKVIGENIIKKIFPKPLELFESHTASYKNCMFVYIFALRLAPFIPNWSVNITAPFFKVPLIHFFIGTFFGVIPLSIVFVKAGKTLQELTSFDTL-SSSSLIFMVILSILSILP 204          
The following BLAST results are available for this feature:
BLAST of Transmembrane protein 41A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TMEM41A9.651e-6446.34transmembrane protein 41A [Source:HGNC Symbol;Acc:... [more]
TMEM41B2.126e-4033.91transmembrane protein 41B [Source:HGNC Symbol;Acc:... [more]
TMEM41B2.126e-4033.91transmembrane protein 41B [Source:HGNC Symbol;Acc:... [more]
TMEM41B2.126e-4033.91transmembrane protein 41B [Source:HGNC Symbol;Acc:... [more]
TMEM41B1.181e-1737.40transmembrane protein 41B [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Transmembrane protein 41A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Y71A12C.21.353e-4942.08pep chromosome:WBcel235:I:14046234:14048017:-1 gen... [more]
bus-192.294e-4942.42pep chromosome:WBcel235:V:12878516:12882108:1 gene... [more]
tag-1752.390e-4136.94Transmembrane protein 41 homolog [Source:UniProtK... [more]
back to top
BLAST of Transmembrane protein 41A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
stas2.355e-4737.86gene:FBgn0030850 transcript:FBtr0074487[more]
back to top
BLAST of Transmembrane protein 41A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmem41aa2.135e-6650.00transmembrane protein 41aa [Source:NCBI gene;Acc:5... [more]
tmem41ab1.184e-5651.89transmembrane protein 41ab [Source:NCBI gene;Acc:4... [more]
tmem41ab3.472e-5651.89transmembrane protein 41ab [Source:NCBI gene;Acc:4... [more]
tmem41ab7.736e-5651.89transmembrane protein 41ab [Source:NCBI gene;Acc:4... [more]
tmem41b2.633e-4136.14transmembrane protein 41B [Source:NCBI gene;Acc:56... [more]
back to top
BLAST of Transmembrane protein 41A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cfap1572.257e-6245.20cilia and flagella associated protein 157 [Source:... [more]
dedd27.705e-4133.62death effector domain containing 2 [Source:Xenbase... [more]
dedd27.733e-4133.62death effector domain containing 2 [Source:Xenbase... [more]
dedd29.365e-4133.62death effector domain containing 2 [Source:Xenbase... [more]
dedd23.237e-4033.62death effector domain containing 2 [Source:Xenbase... [more]
back to top
BLAST of Transmembrane protein 41A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Tmem41a3.264e-6353.17transmembrane protein 41a [Source:MGI Symbol;Acc:M... [more]
Tmem41b5.389e-4233.91transmembrane protein 41B [Source:MGI Symbol;Acc:M... [more]
Tmem41b5.389e-4233.91transmembrane protein 41B [Source:MGI Symbol;Acc:M... [more]
Tmem41b3.907e-4033.33transmembrane protein 41B [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Transmembrane protein 41A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q502G2|T41AA_DANRE1.612e-6550.00Transmembrane protein 41A-A OS=Danio rerio OX=7955... [more]
sp|Q08D99|TM41A_BOVIN2.423e-6353.40Transmembrane protein 41A OS=Bos taurus OX=9913 GN... [more]
sp|Q96HV5|TM41A_HUMAN4.635e-6346.34Transmembrane protein 41A OS=Homo sapiens OX=9606 ... [more]
sp|Q9D8U2|TM41A_MOUSE2.283e-6253.17Transmembrane protein 41A OS=Mus musculus OX=10090... [more]
sp|Q6NV38|T41AB_DANRE5.840e-5551.89Transmembrane protein 41A-B OS=Danio rerio OX=7955... [more]
back to top
BLAST of Transmembrane protein 41A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1W2WG713.333e-6951.39transmembrane protein 41A-A-like OS=Ciona intestin... [more]
A0A482X7D64.889e-6850.00Uncharacterized protein OS=Laodelphax striatellus ... [more]
H2Z2V41.656e-6753.77Uncharacterized protein OS=Ciona savignyi OX=51511... [more]
K1RNR31.346e-6653.21Transmembrane protein 41A OS=Crassostrea gigas OX=... [more]
A0A2G8JGT28.523e-6643.22Putative transmembrane protein OS=Stichopus japoni... [more]
back to top
BLAST of Transmembrane protein 41A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tmem41ab3.524e-6450.23transmembrane protein 41A-B-like [Source:NCBI gene... [more]
tmem41ab1.426e-6350.23transmembrane protein 41A-B-like [Source:NCBI gene... [more]
tmem41aa1.533e-5848.90transmembrane protein 41A-A [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Transmembrane protein 41A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem41aa2.628e-6450.47transmembrane protein 41aa [Source:NCBI gene;Acc:5... [more]
back to top
BLAST of Transmembrane protein 41A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 41A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO489211.242e-6245.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO368601.312e-3734.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transmembrane protein 41A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tmem41aa3.855e-6350.72transmembrane protein 41A [Source:NCBI gene;Acc:10... [more]
tmem41ab9.979e-5946.26transmembrane protein 41A-B [Source:NCBI gene;Acc:... [more]
tmem41b9.058e-4334.98transmembrane protein 41B [Source:NCBI gene;Acc:10... [more]
tmem41b1.296e-4234.98transmembrane protein 41B [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Transmembrane protein 41A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016189.10.000e+0100.00SMESG000016189.1[more]
SMESG000016189.10.000e+0100.00SMESG000016189.1[more]
SMESG000016189.10.000e+0100.00SMESG000016189.1[more]
SMESG000016189.17.663e-164100.00SMESG000016189.1[more]
SMESG000036871.13.550e-3031.47SMESG000036871.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022880 ID=SMED30022880|Name=Transmembrane protein 41A|organism=Schmidtea mediterranea sexual|type=transcript|length=1533bp
TAAGCATAAGTCCAGAATTCGAGTGATTCACATAAATTTTGTCATGTATA
AAGTTGAGTTGATGTCACATTTTCAATTACAACATCCAACTAGAAATGCT
GTCATTTTATGTAATGAAAAAGTTAACCTCGTCAACTTATTTCAAATTAA
TATTCGGCAGCAGCTTAGTTTGTTCGTGTATCGTTTTCATCATATTTCTC
ATTGAAAACCGTCCGAGCTTGTCGAGAGATTTCGACGTGCCCACTATGAA
ATATGAGGTCAAATTCCCTACAAATCTGCCGGAAGTCAAACAAATTGTCC
AAGTATTATCCCAATATAAAAAAGAACATATGAATTATGTCATCATTCTT
TTCGGAAGTGCCTACGTTTTCAAACAATCGTTTGGAATTCCTGGCTCTTT
TCTCTTGAATATCACTGCTGGTGCCCTATTTGGTGTACCAATTGCATTTT
TCCTCGTTTCACTATTGACCGGTGTCGGTGCCACGTGCTGTTATCTCATG
AGCAGATATTTCGGCCGAGAATTGGTCGAACGATATTTTCCTAGAAAAAT
ATCTCAGTTGAGAAAGCTGATCGAAGCGAATGAATCCGGACTATTTTTCT
ATCTGATGTTCCTGCGGCTGTTTCCGATGACTCCCAATTGGCTGCTGAAC
ATTGCGAGCCCTCTCATTAATGTTCCGCTGCATTATTTCTTTTTCTCGGT
TTTTTTCGGCCTGATGCCGTACAATTTCATCTGCGTCCAGACCGGAAACA
TCCTATACGACATATCAAGTCTCGACTCGGTATTCACCCCGGCGGTGCTG
GCCAAGATGGCGTGTGCCGCTACAGTGACCTTGTTGCCGGGCGTCCTCAT
CAGATACTCCAAATACCGGCAAGCAAATATCCTCCCCGACGGCCGCATCG
TTCCAGACAGCCAGGAAATCAAAATCGATTGAGAAAGTTTATTTCTGAGA
ATTTTTTTGTACAATACAATATTATTTCACTTGTTCTGTTTTGAATTATT
GATTAATATTTATTGGAACCGCTGGTAGCACCCGGTGGAGGGGAAGGAAT
GTGATTTCGGTTATTAATAATTATTATAATTTTGAGATAACTCGTAATGG
AGCATGCGAGACAAAGGCAGTCGTTCATTACTTTATGTTTCTATGACTAC
CATATTGTTTACCGGATTTTTCCAAAAACCAATTGATAATGTTTATTGTG
GTAATATTTTTTACAATGCCAACCGAGTTTTTGAAGGCAGTGCTTCCACC
CATGAAATACCCATTTCTAGTAATTTTATTTTGCAGGACTGAATATTTCT
ATTGCTGGATTGCTTTTGCCATTGAATTTTATTGTAGTTAGATTGTAATT
CTGATATAAAATGAAAGTCAACAAAAATAACTAGGTCATGCGAAATTTCT
CCCAGCTGCAACCATTGGCGACTAACAAATTCTATTAACCTTGCTGATTG
TCATTGCAAACGGACATTTTGGACAGATACTTAATTTTTATTCATAATAA
ATTAGAAATTATTTTATTTAAATATAATGTCAA
back to top

protein sequence of SMED30022880-orf-1

>SMED30022880-orf-1 ID=SMED30022880-orf-1|Name=SMED30022880-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=279bp
MLSFYVMKKLTSSTYFKLIFGSSLVCSCIVFIIFLIENRPSLSRDFDVPT
MKYEVKFPTNLPEVKQIVQVLSQYKKEHMNYVIILFGSAYVFKQSFGIPG
SFLLNITAGALFGVPIAFFLVSLLTGVGATCCYLMSRYFGRELVERYFPR
KISQLRKLIEANESGLFFYLMFLRLFPMTPNWLLNIASPLINVPLHYFFF
SVFFGLMPYNFICVQTGNILYDISSLDSVFTPAVLAKMACAATVTLLPGV
LIRYSKYRQANILPDGRIVPDSQEIKID*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000204ovary
PLANA:0000208testis
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR032816SNARE_assoc
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR032816SNARE associated Golgi proteinPFAMPF09335SNARE_assoccoord: 98..218
e-value: 4.4E-19
score: 69.1
NoneNo IPR availablePANTHERPTHR43220:SF2TRANSMEMBRANE PROTEIN 41Acoord: 20..258
NoneNo IPR availablePANTHERPTHR43220FAMILY NOT NAMEDcoord: 20..258
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableTMHMMTMhelixcoord: 114..136
NoneNo IPR availableTMHMMTMhelixcoord: 82..104
NoneNo IPR availableTMHMMTMhelixcoord: 229..251
NoneNo IPR availableTMHMMTMhelixcoord: 197..219