Protocadherin Fat 3

Overview
NameProtocadherin Fat 3
Smed IDSMED30022857
Length (bp)2430
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin Fat 3 (SMED30022857) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin Fat 3 (SMED30022857) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin Fat 3 (SMED30022857) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin Fat 3 (SMED30022857) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022857

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30022857SMESG000003985.1 SmedASXL_014461SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30022857SMESG000003985.1 dd_Smed_v4_18595_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30022857SMESG000003985.1 dd_Smed_v6_18595_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin Fat 3 vs. Ensembl Zebrafish
Match: LO018022.1 (FAT atypical cadherin 4 [Source:NCBI gene;Acc:101882648])

HSP 1 Score: 51.6026 bits (122), Expect = 5.072e-6
Identity = 95/392 (24.23%), Postives = 167/392 (42.60%), Query Frame = 2
Query:  764 ETFYAIISDTT----AIIRNKKL-----LNYDIQNGYTLTLVLQYTDQTAGTLTLPANATVLITVIKSNNKPPFFEMSSYKFQTFTNATKNS-VFQVFPQPLKAYDGNLAINSTIIYKFATSIDFLYLDPLNGILSS----NASTLF----ASYFQTTIIAYNSK-------NISLQAYXXXXXXXXXXXXQ-FYQKFQSENLQENINFVDIQL-NFTSDKSKIVSFQMVP--EVGNFQIASN-GHVYLKNPLNFNIQSIFNFTITASDDIS---SDQMILVINVLKVLTYNPKFLMSPYYF--YGDISSGKF--NVTLSIINYNPNSTIKFDL--TDNYGVFKINPDSSSCYLYVATD-KVQSIRATVYSLIVNFTHSALPQVSDSVQVIV 1819
            E  Y IIS  T     I  + +L     L+ ++Q+ Y+L +V +  D+   +L+   N ++L+  I  N   P F  ++Y F       + + V +VF     A D +   NS + Y F T      L+ + G+L+S    +  +L     A+ F  T+++ +            +Q Y+           +  YQ   +E+ Q     + +   +   +K+ +V + +    E   F I SN G V L   L++     ++  I A D  S   S   +L I+VL     +P F  S        ++  G+   +VT +  +   N+ I + +  T+N+G F I+P++ S +L    D + QS+    Y L V    S  P  S S+ VI+
Sbjct: 1014 EIVYDIISGNTRDVFGIFPDGQLYIKADLDREVQDRYSLLVVAK--DRAVESLSASVNVSILLDDINDNR--PLFNSTNYVFHFEEEQERGALVGRVF-----AEDKDFGPNSEVRYSFETPQSNFELNAITGVLTSTLQLDRESLMRQRGAAVFSFTVLSSDQGLPKPLKDQAKVQVYIQDINDNPPKFTKDIYQASIAESAQNMTQLLRVSASDVDENKNGLVHYDITEGNEEKQFSIDSNSGQVTLVGKLDYETTPSYSLKIIAEDSGSVPLSSTCVLSISVLDDNDNSPSFPKSTLSVDVLENMRIGELVASVTATDSDSGSNADITYSISATNNHGTFSISPNTGSIFLVKKLDYETQSL----YKLNVTAKDSGRPSRSSSIPVII 1392          
BLAST of Protocadherin Fat 3 vs. Ensembl Zebrafish
Match: LO018022.1 (FAT atypical cadherin 4 [Source:NCBI gene;Acc:101882648])

HSP 1 Score: 51.6026 bits (122), Expect = 5.473e-6
Identity = 95/392 (24.23%), Postives = 167/392 (42.60%), Query Frame = 2
Query:  764 ETFYAIISDTT----AIIRNKKL-----LNYDIQNGYTLTLVLQYTDQTAGTLTLPANATVLITVIKSNNKPPFFEMSSYKFQTFTNATKNS-VFQVFPQPLKAYDGNLAINSTIIYKFATSIDFLYLDPLNGILSS----NASTLF----ASYFQTTIIAYNSK-------NISLQAYXXXXXXXXXXXXQ-FYQKFQSENLQENINFVDIQL-NFTSDKSKIVSFQMVP--EVGNFQIASN-GHVYLKNPLNFNIQSIFNFTITASDDIS---SDQMILVINVLKVLTYNPKFLMSPYYF--YGDISSGKF--NVTLSIINYNPNSTIKFDL--TDNYGVFKINPDSSSCYLYVATD-KVQSIRATVYSLIVNFTHSALPQVSDSVQVIV 1819
            E  Y IIS  T     I  + +L     L+ ++Q+ Y+L +V +  D+   +L+   N ++L+  I  N   P F  ++Y F       + + V +VF     A D +   NS + Y F T      L+ + G+L+S    +  +L     A+ F  T+++ +            +Q Y+           +  YQ   +E+ Q     + +   +   +K+ +V + +    E   F I SN G V L   L++     ++  I A D  S   S   +L I+VL     +P F  S        ++  G+   +VT +  +   N+ I + +  T+N+G F I+P++ S +L    D + QS+    Y L V    S  P  S S+ VI+
Sbjct: 1006 EIVYDIISGNTRDVFGIFPDGQLYIKADLDREVQDRYSLLVVAK--DRAVESLSASVNVSILLDDINDNR--PLFNSTNYVFHFEEEQERGALVGRVF-----AEDKDFGPNSEVRYSFETPQSNFELNAITGVLTSTLQLDRESLMRQRGAAVFSFTVLSSDQGLPKPLKDQAKVQVYIQDINDNPPKFTKDIYQASIAESAQNMTQLLRVSASDVDENKNGLVHYDITEGNEEKQFSIDSNSGQVTLVGKLDYETTPSYSLKIIAEDSGSVPLSSTCVLSISVLDDNDNSPSFPKSTLSVDVLENMRIGELVASVTATDSDSGSNADITYSISATNNHGTFSISPNTGSIFLVKKLDYETQSL----YKLNVTAKDSGRPSRSSSIPVII 1384          
BLAST of Protocadherin Fat 3 vs. Ensembl Xenopus
Match: brinp1 (bone morphogenetic protein/retinoic acid inducible neural-specific 1 [Source:Xenbase;Acc:XB-GENE-1011965])

HSP 1 Score: 53.5286 bits (127), Expect = 1.978e-6
Identity = 83/362 (22.93%), Postives = 151/362 (41.71%), Query Frame = 2
Query:  821 LNYDIQNGYTLTLVLQYTDQTAGTLTLPAN-ATVLITVIKSNNKPPFFEMSSYKFQTFTNAT-KNSVFQVFPQPLKAYDGNLAINSTIIYKFATSIDFLYLDPLNGILSSNASTL----------FASYFQTTIIAYNSKNISLQA---YXXXXXXXXXXXXQFYQKFQSENLQENINFVDIQLNFTS---DKSKIVSFQMVPEVGN----FQIASNGH---VYLKNPLNFNIQSIFNFTITASDDISSDQMILVINVLKVLTYNPKFLMSPYYFYGDISSGK-FNVTLSII-----NYNPNSTIKFDLTDNYGVFKINPDSSSCYLYVATDKVQSIRATVYSLIVNFTHSALPQVSDSVQV 1813
            L+++ +  YTL    +   Q AG   L  N  T+ I V+  N+  P F  + ++     NA   +S+  +     +A D +   NS + YK         + P +  + ++A+                +   + A +  N SL A     +  + + +   +F Q+     L E+       L+ T+   D +  +++Q+    GN    + I++ G    + L  PL++  +  +  T+TASD I  D   + IN+    T+ P F  + Y    DI+  +    T+ II     +   N+ I + L DN   F+I+PD+ +  L    D    +    Y+L V    + +PQ SD+  V
Sbjct:  943 LDFETEREYTL----RVRAQDAGRPPLSNNTGTISIQVVDVNDHAPIFVSTPFQVSVLENAPLGHSIIHI-----QAIDADYGENSRVEYKLTG------MKPESPFVINSATGWITVSGPLDREMVEQYVFGVEARDHGNPSLSASAGVTITIMDVNDNRPEFTQREYFIRLNEDATVGTSVLSVTAIDRDVNSAITYQITG--GNTRNRYAISTQGGSGLITLSLPLDYKQERRYVLTVTASDRILHDNCYVHINITDANTHRPVFQSAHYPV--DINEDRPIGSTVVIISASDEDVGENARITYSLEDNIPQFRIDPDTGAITLRAMLDYEDQV---TYTLAVIAKDNGIPQKSDTTYV 1282          
BLAST of Protocadherin Fat 3 vs. Ensembl Xenopus
Match: brinp1 (bone morphogenetic protein/retinoic acid inducible neural-specific 1 [Source:Xenbase;Acc:XB-GENE-1011965])

HSP 1 Score: 52.7582 bits (125), Expect = 3.447e-6
Identity = 83/362 (22.93%), Postives = 151/362 (41.71%), Query Frame = 2
Query:  821 LNYDIQNGYTLTLVLQYTDQTAGTLTLPAN-ATVLITVIKSNNKPPFFEMSSYKFQTFTNAT-KNSVFQVFPQPLKAYDGNLAINSTIIYKFATSIDFLYLDPLNGILSSNASTL----------FASYFQTTIIAYNSKNISLQA---YXXXXXXXXXXXXQFYQKFQSENLQENINFVDIQLNFTS---DKSKIVSFQMVPEVGN----FQIASNGH---VYLKNPLNFNIQSIFNFTITASDDISSDQMILVINVLKVLTYNPKFLMSPYYFYGDISSGK-FNVTLSII-----NYNPNSTIKFDLTDNYGVFKINPDSSSCYLYVATDKVQSIRATVYSLIVNFTHSALPQVSDSVQV 1813
            L+++ +  YTL    +   Q AG   L  N  T+ I V+  N+  P F  + ++     NA   +S+  +     +A D +   NS + YK         + P +  + ++A+                +   + A +  N SL A     +  + + +   +F Q+     L E+       L+ T+   D +  +++Q+    GN    + I++ G    + L  PL++  +  +  T+TASD I  D   + IN+    T+ P F  + Y    DI+  +    T+ II     +   N+ I + L DN   F+I+PD+ +  L    D    +    Y+L V    + +PQ SD+  V
Sbjct:  438 LDFETEREYTL----RVRAQDAGRPPLSNNTGTISIQVVDVNDHAPIFVSTPFQVSVLENAPLGHSIIHI-----QAIDADYGENSRVEYKLTG------MKPESPFVINSATGWITVSGPLDREMVEQYVFGVEARDHGNPSLSASAGVTITIMDVNDNRPEFTQREYFIRLNEDATVGTSVLSVTAIDRDVNSAITYQITG--GNTRNRYAISTQGGSGLITLSLPLDYKQERRYVLTVTASDRILHDNCYVHINITDANTHRPVFQSAHYPV--DINEDRPIGSTVVIISASDEDVGENARITYSLEDNIPQFRIDPDTGAITLRAMLDYEDQV---TYTLAVIAKDNGIPQKSDTTYV 777          
BLAST of Protocadherin Fat 3 vs. Ensembl Xenopus
Match: brinp1 (bone morphogenetic protein/retinoic acid inducible neural-specific 1 [Source:Xenbase;Acc:XB-GENE-1011965])

HSP 1 Score: 52.7582 bits (125), Expect = 3.478e-6
Identity = 83/362 (22.93%), Postives = 151/362 (41.71%), Query Frame = 2
Query:  821 LNYDIQNGYTLTLVLQYTDQTAGTLTLPAN-ATVLITVIKSNNKPPFFEMSSYKFQTFTNAT-KNSVFQVFPQPLKAYDGNLAINSTIIYKFATSIDFLYLDPLNGILSSNASTL----------FASYFQTTIIAYNSKNISLQA---YXXXXXXXXXXXXQFYQKFQSENLQENINFVDIQLNFTS---DKSKIVSFQMVPEVGN----FQIASNGH---VYLKNPLNFNIQSIFNFTITASDDISSDQMILVINVLKVLTYNPKFLMSPYYFYGDISSGK-FNVTLSII-----NYNPNSTIKFDLTDNYGVFKINPDSSSCYLYVATDKVQSIRATVYSLIVNFTHSALPQVSDSVQV 1813
            L+++ +  YTL    +   Q AG   L  N  T+ I V+  N+  P F  + ++     NA   +S+  +     +A D +   NS + YK         + P +  + ++A+                +   + A +  N SL A     +  + + +   +F Q+     L E+       L+ T+   D +  +++Q+    GN    + I++ G    + L  PL++  +  +  T+TASD I  D   + IN+    T+ P F  + Y    DI+  +    T+ II     +   N+ I + L DN   F+I+PD+ +  L    D    +    Y+L V    + +PQ SD+  V
Sbjct:  452 LDFETEREYTL----RVRAQDAGRPPLSNNTGTISIQVVDVNDHAPIFVSTPFQVSVLENAPLGHSIIHI-----QAIDADYGENSRVEYKLTG------MKPESPFVINSATGWITVSGPLDREMVEQYVFGVEARDHGNPSLSASAGVTITIMDVNDNRPEFTQREYFIRLNEDATVGTSVLSVTAIDRDVNSAITYQITG--GNTRNRYAISTQGGSGLITLSLPLDYKQERRYVLTVTASDRILHDNCYVHINITDANTHRPVFQSAHYPV--DINEDRPIGSTVVIISASDEDVGENARITYSLEDNIPQFRIDPDTGAITLRAMLDYEDQV---TYTLAVIAKDNGIPQKSDTTYV 791          
BLAST of Protocadherin Fat 3 vs. Ensembl Xenopus
Match: brinp1 (bone morphogenetic protein/retinoic acid inducible neural-specific 1 [Source:Xenbase;Acc:XB-GENE-1011965])

HSP 1 Score: 52.373 bits (124), Expect = 3.721e-6
Identity = 83/362 (22.93%), Postives = 151/362 (41.71%), Query Frame = 2
Query:  821 LNYDIQNGYTLTLVLQYTDQTAGTLTLPAN-ATVLITVIKSNNKPPFFEMSSYKFQTFTNAT-KNSVFQVFPQPLKAYDGNLAINSTIIYKFATSIDFLYLDPLNGILSSNASTL----------FASYFQTTIIAYNSKNISLQA---YXXXXXXXXXXXXQFYQKFQSENLQENINFVDIQLNFTS---DKSKIVSFQMVPEVGN----FQIASNGH---VYLKNPLNFNIQSIFNFTITASDDISSDQMILVINVLKVLTYNPKFLMSPYYFYGDISSGK-FNVTLSII-----NYNPNSTIKFDLTDNYGVFKINPDSSSCYLYVATDKVQSIRATVYSLIVNFTHSALPQVSDSVQV 1813
            L+++ +  YTL    +   Q AG   L  N  T+ I V+  N+  P F  + ++     NA   +S+  +     +A D +   NS + YK         + P +  + ++A+                +   + A +  N SL A     +  + + +   +F Q+     L E+       L+ T+   D +  +++Q+    GN    + I++ G    + L  PL++  +  +  T+TASD I  D   + IN+    T+ P F  + Y    DI+  +    T+ II     +   N+ I + L DN   F+I+PD+ +  L    D    +    Y+L V    + +PQ SD+  V
Sbjct:  438 LDFETEREYTL----RVRAQDAGRPPLSNNTGTISIQVVDVNDHAPIFVSTPFQVSVLENAPLGHSIIHI-----QAIDADYGENSRVEYKLTG------MKPESPFVINSATGWITVSGPLDREMVEQYVFGVEARDHGNPSLSASAGVTITIMDVNDNRPEFTQREYFIRLNEDATVGTSVLSVTAIDRDVNSAITYQITG--GNTRNRYAISTQGGSGLITLSLPLDYKQERRYVLTVTASDRILHDNCYVHINITDANTHRPVFQSAHYPV--DINEDRPIGSTVVIISASDEDVGENARITYSLEDNIPQFRIDPDTGAITLRAMLDYEDQV---TYTLAVIAKDNGIPQKSDTTYV 777          
BLAST of Protocadherin Fat 3 vs. Ensembl Xenopus
Match: brinp1 (bone morphogenetic protein/retinoic acid inducible neural-specific 1 [Source:Xenbase;Acc:XB-GENE-1011965])

HSP 1 Score: 52.373 bits (124), Expect = 4.116e-6
Identity = 83/362 (22.93%), Postives = 151/362 (41.71%), Query Frame = 2
Query:  821 LNYDIQNGYTLTLVLQYTDQTAGTLTLPAN-ATVLITVIKSNNKPPFFEMSSYKFQTFTNAT-KNSVFQVFPQPLKAYDGNLAINSTIIYKFATSIDFLYLDPLNGILSSNASTL----------FASYFQTTIIAYNSKNISLQA---YXXXXXXXXXXXXQFYQKFQSENLQENINFVDIQLNFTS---DKSKIVSFQMVPEVGN----FQIASNGH---VYLKNPLNFNIQSIFNFTITASDDISSDQMILVINVLKVLTYNPKFLMSPYYFYGDISSGK-FNVTLSII-----NYNPNSTIKFDLTDNYGVFKINPDSSSCYLYVATDKVQSIRATVYSLIVNFTHSALPQVSDSVQV 1813
            L+++ +  YTL    +   Q AG   L  N  T+ I V+  N+  P F  + ++     NA   +S+  +     +A D +   NS + YK         + P +  + ++A+                +   + A +  N SL A     +  + + +   +F Q+     L E+       L+ T+   D +  +++Q+    GN    + I++ G    + L  PL++  +  +  T+TASD I  D   + IN+    T+ P F  + Y    DI+  +    T+ II     +   N+ I + L DN   F+I+PD+ +  L    D    +    Y+L V    + +PQ SD+  V
Sbjct:  438 LDFETEREYTL----RVRAQDAGRPPLSNNTGTISIQVVDVNDHAPIFVSTPFQVSVLENAPLGHSIIHI-----QAIDADYGENSRVEYKLTG------MKPESPFVINSATGWITVSGPLDREMVEQYVFGVEARDHGNPSLSASAGVTITIMDVNDNRPEFTQREYFIRLNEDATVGTSVLSVTAIDRDVNSAITYQITG--GNTRNRYAISTQGGSGLITLSLPLDYKQERRYVLTVTASDRILHDNCYVHINITDANTHRPVFQSAHYPV--DINEDRPIGSTVVIISASDEDVGENARITYSLEDNIPQFRIDPDTGAITLRAMLDYEDQV---TYTLAVIAKDNGIPQKSDTTYV 777          
BLAST of Protocadherin Fat 3 vs. TrEMBL
Match: E9GJ66 (Uncharacterized protein (Fragment) OS=Daphnia pulex OX=6669 GN=DAPPUDRAFT_51223 PE=4 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 6.346e-12
Identity = 66/266 (24.81%), Postives = 119/266 (44.74%), Query Frame = 2
Query:  812 KKLLNYDIQNGYTLTLVLQYTDQTAGTLTLPANATVLITVIKSNNKPPFFEMSSYKFQTFTNATKNSVFQVFPQPLKAYDGNLAINSTIIYKFATSIDF--LYLDPLNGILSSNASTLFASYFQTTIIAYNSKNI------SLQAYXXXXXXXXXXXXQFYQKFQSENLQENINFVDIQLNFTSDKSKIVSFQMVPEVGN-----FQIASNGHVYLKNPLNFNIQSIFNFTITASDDISSDQMILVINVLKVLTYNPKFLMSPYYF 1570
            KK ++Y+    + + +  Q  DQ  G   L  +A V I V  S+++ P F  S Y       A K +  ++ P+P++A D +  IN++I Y +    ++   +LDPLNG +S N S       Q  I+   +  +      +L    V      +  +Q+ Q+  S  + EN+      L    +K    S + V E  N     F +   G + L+  L++  Q    F +  +D +++D   + + VL V  ++P+F ++ Y F
Sbjct:   84 KKAVDYETLKHFKIAIRAQ--DQ--GQPPLYTDAVVSIEVNDSDDQNPLFGQSRYWAHLPQPARKGTGLEIRPEPMRAVDQDAGINASIRYAWNAGAEYQDFFLDPLNGSVSLNRSLEDNELVQPVILVVKAHQVDNLDRYALTTLTVSRSWSFSPQLQYLQRRYSVQVLENVPVDTTILAMAINKPIDQSIRFVMESHNGTEQAFSVDKTGEIKLERSLDYETQMTHQFVVWVTDGLTNDTATVEVTVLDVNDWDPRFELAEYEF 345          
BLAST of Protocadherin Fat 3 vs. TrEMBL
Match: A0A443SIV3 (Fat-like cadherin-related tumor suppressor-like protein OS=Leptotrombidium deliense OX=299467 GN=B4U80_07007 PE=4 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.165e-10
Identity = 86/360 (23.89%), Postives = 163/360 (45.28%), Query Frame = 2
Query:  854 TLVLQYTDQTAGTLTLPANATVLITVIKSNNKPPFFEMSSYKFQTFTNATKNSVFQVFPQPLKAYDGNLAINSTIIYKFATSID-----FLYLDPLNGILSSNASTLFASYFQTTIIAYNSKNISLQAYXXXXXXX-XXXXXQFYQ--KFQSEN----LQENIN----FVDIQLNFTSDKSKIVSFQMV-PEVGNFQIASNGHVYLKNPLNFNIQSIFNFTITASDDISSDQMILVINVLKVLTYNPKFLMSPYYFYGDISSGKFNVTLSIINYNPNSTIKFDLTD--------------NYGVFKINP----DSSSCYL-YVATDKVQSIRATVYSLIVNFTHSALPQVSDSVQVIVDF 1825
            +++++  DQ  G   L A ATV + VI ++++ P F    Y  +   N  + S   V P+ ++A D +  INS I Y F  + D     + ++DP  G ++   S      F  T++   ++  +   Y +  +++     VQF    +FQ EN    + EN+      + +Q + + ++ + + FQ++  E G F I   G + LK  L++  +  ++F + ASD   SD   + ++VL V  ++P+F  + Y F+  +S G+   T  +       +   D  +              N G+ K+      ++S C+L  VATD  +  R++   + V F  + L   S ++  +  F
Sbjct:  174 SIIVRTQDQ--GEPPLTATATVTVNVIDADDQNPRFMDDKYNARLADNNREGSQLMVSPKSIRAVDPDTDINSPIEYSFNHAADSREYSYFHIDPKFGDITLKKSLPSTMTFPITLVIRATQVDNRDRYALTTLTVFNRKQVQFVPDIRFQRENYTASVLENVPPGQVLLTVQTSRSDNREESIQFQILDDENGYFGIRKTGEIVLKKMLDYEQRPWYSFRVMASDGKQSDVARINVSVLNVNDHDPQFSQNHYNFF--VSEGRLRNTSVVGEVRATDSDSGDAIELSVKGPFAKTFTVTNDGLIKVKSLKHLNTSQCHLIVVATDNGKPPRSSSVPVTVQFAPNVLKAFSRNIDDLESF 529          
BLAST of Protocadherin Fat 3 vs. TrEMBL
Match: A0A1D1UQZ9 (Uncharacterized protein OS=Ramazzottius varieornatus OX=947166 GN=RvY_03198 PE=4 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 1.557e-7
Identity = 76/359 (21.17%), Postives = 151/359 (42.06%), Query Frame = 2
Query:  635 NSINYFNGQISDNSPNNTIVNFDVSPKFNYTYSLGTFELILIDETFYAIISDTTAIIRNKKLLNYDIQNGYTLTLVLQYTDQTAGTLTLPANATVLITVIKSNNKPPFFEMSSYKFQTFTNATKNSVFQVFPQPLKAYDGNLAINSTIIYKFATSIDFLYLDPLNGILSSNASTLFASYFQTTIIAY---NSKNISLQAYXXXXXXXXXXXXQFYQKFQSENLQENINFVDIQLNFTSDKS--------KIVSFQMVPEVGNFQIASNGHVYLKNPLNFNIQSIFNFTITASDDISSDQMILVINVLKVLTYNPKFLMSPYYFYGDISS---------GKF--------NVTLSIINYN 1627
             SI Y N +  D    N +V++ + P    +Y       +  D++    +   TA       L+Y+    + +T+  +  DQ  G   L A   V ITV   ++  P F   SY       A +  V ++ P+ ++A D +  I++ I Y+     +F  ++   G +  N +      +  T+ A    N    +L    +      + P +F QK  ++ + ENI      ++  +            ++S ++VP   +F ++ +G + +  PL++ +   +   +  +D   +DQ  ++I++L +  ++P+F  + Y F  D+ +         GK         NVTLS++NY 
Sbjct:  168 GSIIYKNIRAEDGDATNNLVDYSIVPGPYSSY-------VRFDDSLSGNLVLATA-------LDYEALRAFNVTVAAR--DQ--GNPPLTATTNVEITVQDGDDYSPEFAYPSYTATLPREAPRGYVLKIRPESIRAVDKDAGISTPIEYRIVEGANFFDINKKTGQVFVNGTVASGGLYVLTVRASQVDNPSKFTLATLRITAERPNHNPPRFVQKEYAQKVPENIPVGSTVMSVRATDPDPDSTLAYSLLSAELVP---HFNLSISGDLMIARPLDYEVSRQYVMFVGVTDGEFTDQARVIIDILNINDHDPEFSQAEYSF--DVGADARVDGAILGKLQVTDRDGDNVTLSLLNYQ 503          
BLAST of Protocadherin Fat 3 vs. TrEMBL
Match: A0A1D1UM82 (Uncharacterized protein OS=Ramazzottius varieornatus OX=947166 GN=RvY_03198 PE=4 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 2.168e-7
Identity = 76/358 (21.23%), Postives = 151/358 (42.18%), Query Frame = 2
Query:  635 NSINYFNGQISDNSPNNTIVNFDVSPKFNYTYSLGTFELILIDETFYAIISDTTAIIRNKKLLNYDIQNGYTLTLVLQYTDQTAGTLTLPANATVLITVIKSNNKPPFFEMSSYKFQTFTNATKNSVFQVFPQPLKAYDGNLAINSTIIYKFATSIDFLYLDPLNGILSSNASTLFASYFQTTIIAY---NSKNISLQAYXXXXXXXXXXXXQFYQKFQSENLQENINFVDIQLNFTSDKS--------KIVSFQMVPEVGNFQIASNGHVYLKNPLNFNIQSIFNFTITASDDISSDQMILVINVLKVLTYNPKFLMSPYYFYGDISS---------GKF--------NVTLSIINY 1624
             SI Y N +  D    N +V++ + P    +Y       +  D++    +   TA       L+Y+    + +T+  +  DQ  G   L A   V ITV   ++  P F   SY       A +  V ++ P+ ++A D +  I++ I Y+     +F  ++   G +  N +      +  T+ A    N    +L    +      + P +F QK  ++ + ENI      ++  +            ++S ++VP   +F ++ +G + +  PL++ +   +   +  +D   +DQ  ++I++L +  ++P+F  + Y F  D+ +         GK         NVTLS++NY
Sbjct:  168 GSIIYKNIRAEDGDATNNLVDYSIVPGPYSSY-------VRFDDSLSGNLVLATA-------LDYEALRAFNVTVAAR--DQ--GNPPLTATTNVEITVQDGDDYSPEFAYPSYTATLPREAPRGYVLKIRPESIRAVDKDAGISTPIEYRIVEGANFFDINKKTGQVFVNGTVASGGLYVLTVRASQVDNPSKFTLATLRITAERPNHNPPRFVQKEYAQKVPENIPVGSTVMSVRATDPDPDSTLAYSLLSAELVP---HFNLSISGDLMIARPLDYEVSRQYVMFVGVTDGEFTDQARVIIDILNINDHDPEFSQAEYSF--DVGADARVDGAILGKLQVTDRDGDNVTLSLLNY 502          
BLAST of Protocadherin Fat 3 vs. TrEMBL
Match: A0A1V1FIP7 (Putative CTL9 OS=Reticulitermes speratus OX=60591 GN=CTL9 PE=2 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 5.391e-7
Identity = 81/359 (22.56%), Postives = 158/359 (44.01%), Query Frame = 2
Query:  812 KKLLNYDIQNGYTLTLVLQYTDQTAGTLTLPANATVLITVIKSNNKPPFFEMSSYKFQTFTNATKNSVFQVFPQPLKAYDGNLAINSTIIYKF-ATSIDFLY--LDPLNGILSSNASTLFASYFQTTIIAY------NSKNISLQAYXXXXXXXXXXXXQFYQKFQSENLQENINFVDIQLNFTSD--KSKIVSFQMVP--EVGNFQIASNGHVYLKNPLNFNIQSIFNFTITASDDISSDQMILVINVLKVLTYNPKFLMSPYYFY--------GDI---------SSGKFNVTLSIINYNPNSTIKFDLTDNYGVFKINP----DSSSCYLYVATDKVQSIRATVYSLIVNFTHSAL 1786
            +K L+Y+  + +++ +  Q  DQ  G+    ++  + + VI ++++ P F    Y      +  + +   + P+ + AYD +L IN+ I Y F +   D+ Y  +D  +G ++   S       Q   +        N    +L    V  +  I   +QF QK     + EN     I L   ++  + K + F +     +G F + S G ++L+ PL++ ++  ++F +  +D  ++D   + I+VL V  ++P+F    Y F+        GDI           G F + LS+    P + + FD++D   +  ++      S++  + VATD     R     +IV+F  S +
Sbjct:  203 RKALDYETLSNFSVDIRAQ--DQ--GSPPQHSDTVLYVNVIDADDQNPRFYDDRYTAVLPDSPVQGTRLHIQPRDIAAYDQDLGINAAIFYSFNSVGADYRYFDIDRTSGHVTIKRSIPDDELVQPATLVVRATQYDNQDRYALATLTVSRVGAIPRELQFLQKNYLVGVLENAPVNSILLTAVTNNPRDKRLRFWLEDNLHLGMFSVNSAGDIFLRQPLDYEVEDFYSFLVHVTDGRTNDTAKVNISVLNVNDWDPRFRYPQYEFFVTNPGVSAGDIVGRVEAADGDKGDF-INLSL--RGPGARM-FDISDMGDIILVDMTLLNGSTAHMVAVATDNGIPPRQATVPVIVHFPESVV 553          
BLAST of Protocadherin Fat 3 vs. Ensembl Medaka
Match: ENSORLT00000042802.1 (cadherin-related family member 5 [Source:NCBI gene;Acc:101172638])

HSP 1 Score: 50.8322 bits (120), Expect = 5.139e-6
Identity = 45/170 (26.47%), Postives = 68/170 (40.00%), Query Frame = 2
Query:  695 NFDVSPKFNYTYSLGTFELILIDETFYAIISDTTAIIRNKKLLNYDIQNGYTLTLVLQYTDQTAGTL--TLPANATVLITVIKSNNKPPFF--------------EMSSYKFQTFTNATKNSVFQVFPQPLKAYDGNLAINSTIIYKFATSIDFLYLDPLNGILSSNAST 1156
            + D  P+  YT +       L   T  AI+ D T        LNY+    Y L LV+Q T   +  +  +  A AT+ I++   +N+PP+F              E + Y      N  +     + P P+ A DG+  IN  I Y F +  D        G+ + N ST
Sbjct:  154 DLDQHPQLYYTLTSEPSAFKLQSPTIPAIMVDAT--------LNYEKVREYQLKLVVQDTPLASAPVGPSFSATATIQISISDGDNRPPWFQPCTKYEVGGAVICESAGYTGTVNLNEQQTGALSLKPGPVHAIDGDTGINEEITYTFLSGND-------EGLFAINPST 308          
BLAST of Protocadherin Fat 3 vs. Ensembl Medaka
Match: ENSORLT00000034588.1 (cadherin-related family member 5 [Source:NCBI gene;Acc:101172638])

HSP 1 Score: 50.447 bits (119), Expect = 6.657e-6
Identity = 45/170 (26.47%), Postives = 68/170 (40.00%), Query Frame = 2
Query:  695 NFDVSPKFNYTYSLGTFELILIDETFYAIISDTTAIIRNKKLLNYDIQNGYTLTLVLQYTDQTAGTL--TLPANATVLITVIKSNNKPPFF--------------EMSSYKFQTFTNATKNSVFQVFPQPLKAYDGNLAINSTIIYKFATSIDFLYLDPLNGILSSNAST 1156
            + D  P+  YT +       L   T  AI+ D T        LNY+    Y L LV+Q T   +  +  +  A AT+ I++   +N+PP+F              E + Y      N  +     + P P+ A DG+  IN  I Y F +  D        G+ + N ST
Sbjct:  154 DLDQHPQLYYTLTSEPSAFKLQSPTIPAIMVDAT--------LNYEKVREYQLKLVVQDTPLASAPVGPSFSATATIQISISDGDNRPPWFQPCTKYEVGGAVICESAGYTGTVNLNEQQTGALSLKPGPVHAIDGDTGINEEITYTFLSGND-------EGLFAINPST 308          
BLAST of Protocadherin Fat 3 vs. Planmine SMEST
Match: SMESG000003985.1 (SMESG000003985.1)

HSP 1 Score: 1227.62 bits (3175), Expect = 0.000e+0
Identity = 666/669 (99.55%), Postives = 667/669 (99.70%), Query Frame = 2
Query:  305 YSDQSSCSLPSDLGIARVATNNEIGSPIYKYTMFQTADILSTDVLSPNDIYFAFNVSTLQLISKIVLDGKVTSNYNLRLFMTCSDVTAKIFEQXXXXXXXXXXQVSWIFQNSINYFNGQISDNSPNNTIVNFDVSPKFNYTYSLGTFELILIDETFYAIISDTTAIIRNKKLLNYDIQNGYTLTLVLQYTDQTAGTLTLPANATVLITVIKSNNKPPFFEMSSYKFQTFTNATKNSVFQVFPQPLKAYDGNLAINSTIIYKFATSIDFLYLDPLNGILSSNASTLFASYFQTTIIAYNSKNISLQAYXXXXXXXXXXXXQFYQKFQSENLQENINFVDIQLNFTSDKSKIVSFQMVPEVGNFQIASNGHVYLKNPLNFNIQSIFNFTITASDDISSDQMILVINVLKVLTYNPKFLMSPYYFYGDISSGKFNVTLSIINYNPNSTIKFDLTDNYGVFKINPDSSSCYLYVATDKVQSIRATVYSLIVNFTHSALPQVSDSVQVIVDFSTTISTTTVNSRIKDEXXXXXXXXXXXXXXXXXXXXXXXYYKKRLRVMTNKINEKNRENNTTIIATNNSVNTQDTLHQIPSDNVQSSTDHVGNPIVHHPAVLTSLHCSENLPGQKYSMKVIFKFMTYIAVTALSGSYNKKSNLEPSYPERNPEKISPAESMK 2311
            YSDQSSCSLPSDLGIARVATNNEIGSPIY YTMFQTADILSTDVLSPNDIYFAFNVSTLQLISKIVLDGKVTSNYNLRLFMTCSDVTAKIFEQIINIISLNNNQVSWIFQNSINYFNGQISDNSPNNTIVNFDVSPKFNYT SLGTFELILIDETFYAIISDTTAIIRNKKLLNYDIQNGYTLTLVLQYTDQTAGTLTLPANATVLITVIKSNNKPPFFEMSSYKFQTFTNATKNSVFQVFPQPLKAYDGNLAINSTIIYKFATSIDFLYLDPLNGILSSNASTLFASYFQTTIIAYNSKNISLQAYVVVNISIINVPVQFYQKFQSENLQENINFVDIQLNFTSDKSKIVSFQMVPEVGNFQIASNGHVYLKNPLNFNIQSIFNFTITASDDISSDQMILVINVLKVLTYNPKFLMSPYYFYGDISSGKFNVTLSIINYNPNSTIKFDLTDNYGVFKINPDSS+CYLYVATDKVQSIRATVYSLIVNFTHSALPQVSDSVQVIVDFSTTISTTTVNSRIKDEILIICILLPILFLFLLIFPILLCYYKKRLRVMTNKINEKNRENNTTIIATNNSVNTQDTLHQIPSDNVQSSTDHVGNPIVHHPAVLTSLHCSENLPGQKYSMKVIFKFMTYIAVTALSGSYNKKSNLEPSYPERNPEKISPAESMK
Sbjct:   15 YSDQSSCSLPSDLGIARVATNNEIGSPIYNYTMFQTADILSTDVLSPNDIYFAFNVSTLQLISKIVLDGKVTSNYNLRLFMTCSDVTAKIFEQIINIISLNNNQVSWIFQNSINYFNGQISDNSPNNTIVNFDVSPKFNYTSSLGTFELILIDETFYAIISDTTAIIRNKKLLNYDIQNGYTLTLVLQYTDQTAGTLTLPANATVLITVIKSNNKPPFFEMSSYKFQTFTNATKNSVFQVFPQPLKAYDGNLAINSTIIYKFATSIDFLYLDPLNGILSSNASTLFASYFQTTIIAYNSKNISLQAYVVVNISIINVPVQFYQKFQSENLQENINFVDIQLNFTSDKSKIVSFQMVPEVGNFQIASNGHVYLKNPLNFNIQSIFNFTITASDDISSDQMILVINVLKVLTYNPKFLMSPYYFYGDISSGKFNVTLSIINYNPNSTIKFDLTDNYGVFKINPDSSNCYLYVATDKVQSIRATVYSLIVNFTHSALPQVSDSVQVIVDFSTTISTTTVNSRIKDEILIICILLPILFLFLLIFPILLCYYKKRLRVMTNKINEKNRENNTTIIATNNSVNTQDTLHQIPSDNVQSSTDHVGNPIVHHPAVLTSLHCSENLPGQKYSMKVIFKFMTYIAVTALSGSYNKKSNLEPSYPERNPEKISPAESMK 683          
BLAST of Protocadherin Fat 3 vs. Planmine SMEST
Match: SMESG000003985.1 (SMESG000003985.1)

HSP 1 Score: 980.704 bits (2534), Expect = 0.000e+0
Identity = 548/551 (99.46%), Postives = 549/551 (99.64%), Query Frame = 2
Query:  305 YSDQSSCSLPSDLGIARVATNNEIGSPIYKYTMFQTADILSTDVLSPNDIYFAFNVSTLQLISKIVLDGKVTSNYNLRLFMTCSDVTAKIFEQXXXXXXXXXXQVSWIFQNSINYFNGQISDNSPNNTIVNFDVSPKFNYTYSLGTFELILIDETFYAIISDTTAIIRNKKLLNYDIQNGYTLTLVLQYTDQTAGTLTLPANATVLITVIKSNNKPPFFEMSSYKFQTFTNATKNSVFQVFPQPLKAYDGNLAINSTIIYKFATSIDFLYLDPLNGILSSNASTLFASYFQTTIIAYNSKNISLQAYXXXXXXXXXXXXQFYQKFQSENLQENINFVDIQLNFTSDKSKIVSFQMVPEVGNFQIASNGHVYLKNPLNFNIQSIFNFTITASDDISSDQMILVINVLKVLTYNPKFLMSPYYFYGDISSGKFNVTLSIINYNPNSTIKFDLTDNYGVFKINPDSSSCYLYVATDKVQSIRATVYSLIVNFTHSALPQVSDSVQVIVDFSTTISTTTVNSRIKDEXXXXXXXXXXXXXXXXXXXXXXXYYKKR 1957
            YSDQSSCSLPSDLGIARVATNNEIGSPIY YTMFQTADILSTDVLSPNDIYFAFNVSTLQLISKIVLDGKVTSNYNLRLFMTCSDVTAKIFEQIINIISLNNNQVSWIFQNSINYFNGQISDNSPNNTIVNFDVSPKFNYT SLGTFELILIDETFYAIISDTTAIIRNKKLLNYDIQNGYTLTLVLQYTDQTAGTLTLPANATVLITVIKSNNKPPFFEMSSYKFQTFTNATKNSVFQVFPQPLKAYDGNLAINSTIIYKFATSIDFLYLDPLNGILSSNASTLFASYFQTTIIAYNSKNISLQAYVVVNISIINVPVQFYQKFQSENLQENINFVDIQLNFTSDKSKIVSFQMVPEVGNFQIASNGHVYLKNPLNFNIQSIFNFTITASDDISSDQMILVINVLKVLTYNPKFLMSPYYFYGDISSGKFNVTLSIINYNPNSTIKFDLTDNYGVFKINPDSS+CYLYVATDKVQSIRATVYSLIVNFTHSALPQVSDSVQVIVDFSTTISTTTVNSRIKDEILIICILLPILFLFLLIFPILLCYYKKR
Sbjct:   15 YSDQSSCSLPSDLGIARVATNNEIGSPIYNYTMFQTADILSTDVLSPNDIYFAFNVSTLQLISKIVLDGKVTSNYNLRLFMTCSDVTAKIFEQIINIISLNNNQVSWIFQNSINYFNGQISDNSPNNTIVNFDVSPKFNYTSSLGTFELILIDETFYAIISDTTAIIRNKKLLNYDIQNGYTLTLVLQYTDQTAGTLTLPANATVLITVIKSNNKPPFFEMSSYKFQTFTNATKNSVFQVFPQPLKAYDGNLAINSTIIYKFATSIDFLYLDPLNGILSSNASTLFASYFQTTIIAYNSKNISLQAYVVVNISIINVPVQFYQKFQSENLQENINFVDIQLNFTSDKSKIVSFQMVPEVGNFQIASNGHVYLKNPLNFNIQSIFNFTITASDDISSDQMILVINVLKVLTYNPKFLMSPYYFYGDISSGKFNVTLSIINYNPNSTIKFDLTDNYGVFKINPDSSNCYLYVATDKVQSIRATVYSLIVNFTHSALPQVSDSVQVIVDFSTTISTTTVNSRIKDEILIICILLPILFLFLLIFPILLCYYKKR 565          

HSP 2 Score: 228.794 bits (582), Expect = 1.716e-64
Identity = 108/109 (99.08%), Postives = 109/109 (100.00%), Query Frame = 1
Query: 2092 PCGESYCPPSGRANQSSLFGEFTGSKIFDESNFQIYDLYSGDGLVRQLQQEIKLRTFISREESRKNITSRKYEIDSNEIKEVTVPKDENVLCNDTDMLSDKYTDLKVTV 2418
            PCGESYCPPSGRANQSSLFGEFTGSKIFDESNFQIYDLYSGDGLVRQLQQEIKLRTFISREESRKNITSRKYEIDSNEIKEVTVPKDENVLCNDTDMLSDKYTDLKVT+
Sbjct:  566 PCGESYCPPSGRANQSSLFGEFTGSKIFDESNFQIYDLYSGDGLVRQLQQEIKLRTFISREESRKNITSRKYEIDSNEIKEVTVPKDENVLCNDTDMLSDKYTDLKVTL 674          
BLAST of Protocadherin Fat 3 vs. Planmine SMEST
Match: SMESG000003985.1 (SMESG000003985.1)

HSP 1 Score: 917.531 bits (2370), Expect = 0.000e+0
Identity = 517/519 (99.61%), Postives = 518/519 (99.81%), Query Frame = 2
Query:  401 MFQTADILSTDVLSPNDIYFAFNVSTLQLISKIVLDGKVTSNYNLRLFMTCSDVTAKIFEQXXXXXXXXXXQVSWIFQNSINYFNGQISDNSPNNTIVNFDVSPKFNYTYSLGTFELILIDETFYAIISDTTAIIRNKKLLNYDIQNGYTLTLVLQYTDQTAGTLTLPANATVLITVIKSNNKPPFFEMSSYKFQTFTNATKNSVFQVFPQPLKAYDGNLAINSTIIYKFATSIDFLYLDPLNGILSSNASTLFASYFQTTIIAYNSKNISLQAYXXXXXXXXXXXXQFYQKFQSENLQENINFVDIQLNFTSDKSKIVSFQMVPEVGNFQIASNGHVYLKNPLNFNIQSIFNFTITASDDISSDQMILVINVLKVLTYNPKFLMSPYYFYGDISSGKFNVTLSIINYNPNSTIKFDLTDNYGVFKINPDSSSCYLYVATDKVQSIRATVYSLIVNFTHSALPQVSDSVQVIVDFSTTISTTTVNSRIKDEXXXXXXXXXXXXXXXXXXXXXXXYYKKR 1957
            MFQTADILSTDVLSPNDIYFAFNVSTLQLISKIVLDGKVTSNYNLRLFMTCSDVTAKIFEQIINIISLNNNQVSWIFQNSINYFNGQISDNSPNNTIVNFDVSPKFNYT SLGTFELILIDETFYAIISDTTAIIRNKKLLNYDIQNGYTLTLVLQYTDQTAGTLTLPANATVLITVIKSNNKPPFFEMSSYKFQTFTNATKNSVFQVFPQPLKAYDGNLAINSTIIYKFATSIDFLYLDPLNGILSSNASTLFASYFQTTIIAYNSKNISLQAYVVVNISIINVPVQFYQKFQSENLQENINFVDIQLNFTSDKSKIVSFQMVPEVGNFQIASNGHVYLKNPLNFNIQSIFNFTITASDDISSDQMILVINVLKVLTYNPKFLMSPYYFYGDISSGKFNVTLSIINYNPNSTIKFDLTDNYGVFKINPDSS+CYLYVATDKVQSIRATVYSLIVNFTHSALPQVSDSVQVIVDFSTTISTTTVNSRIKDEILIICILLPILFLFLLIFPILLCYYKKR
Sbjct:    1 MFQTADILSTDVLSPNDIYFAFNVSTLQLISKIVLDGKVTSNYNLRLFMTCSDVTAKIFEQIINIISLNNNQVSWIFQNSINYFNGQISDNSPNNTIVNFDVSPKFNYTSSLGTFELILIDETFYAIISDTTAIIRNKKLLNYDIQNGYTLTLVLQYTDQTAGTLTLPANATVLITVIKSNNKPPFFEMSSYKFQTFTNATKNSVFQVFPQPLKAYDGNLAINSTIIYKFATSIDFLYLDPLNGILSSNASTLFASYFQTTIIAYNSKNISLQAYVVVNISIINVPVQFYQKFQSENLQENINFVDIQLNFTSDKSKIVSFQMVPEVGNFQIASNGHVYLKNPLNFNIQSIFNFTITASDDISSDQMILVINVLKVLTYNPKFLMSPYYFYGDISSGKFNVTLSIINYNPNSTIKFDLTDNYGVFKINPDSSNCYLYVATDKVQSIRATVYSLIVNFTHSALPQVSDSVQVIVDFSTTISTTTVNSRIKDEILIICILLPILFLFLLIFPILLCYYKKR 519          

HSP 2 Score: 159.073 bits (401), Expect = 1.195e-40
Identity = 81/109 (74.31%), Postives = 82/109 (75.23%), Query Frame = 1
Query: 2092 PCGESYCPPSGRANQSSLFGEFTGSKIFDESNFQIYDLYSGDGLVRQLQQEIKLRTFISREESRKNITSRKYEIDSNEIKEVTVPKDENVLCNDTDMLSDKYTDLKVTV 2418
            PCGESYCPPSGRANQSSLFGEFTGSKIFDE                           ISREESRKNITSRKYEIDSNEIKEVTVPKDENVLCNDTDMLSDKYTDLKVT+
Sbjct:  520 PCGESYCPPSGRANQSSLFGEFTGSKIFDE--------------------------IISREESRKNITSRKYEIDSNEIKEVTVPKDENVLCNDTDMLSDKYTDLKVTL 602          
The following BLAST results are available for this feature:
BLAST of Protocadherin Fat 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin Fat 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin Fat 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin Fat 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
LO018022.15.072e-624.23FAT atypical cadherin 4 [Source:NCBI gene;Acc:1018... [more]
LO018022.15.473e-624.23FAT atypical cadherin 4 [Source:NCBI gene;Acc:1018... [more]
back to top
BLAST of Protocadherin Fat 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
brinp11.978e-622.93bone morphogenetic protein/retinoic acid inducible... [more]
brinp13.447e-622.93bone morphogenetic protein/retinoic acid inducible... [more]
brinp13.478e-622.93bone morphogenetic protein/retinoic acid inducible... [more]
brinp13.721e-622.93bone morphogenetic protein/retinoic acid inducible... [more]
brinp14.116e-622.93bone morphogenetic protein/retinoic acid inducible... [more]
back to top
BLAST of Protocadherin Fat 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin Fat 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin Fat 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E9GJ666.346e-1224.81Uncharacterized protein (Fragment) OS=Daphnia pule... [more]
A0A443SIV31.165e-1023.89Fat-like cadherin-related tumor suppressor-like pr... [more]
A0A1D1UQZ91.557e-721.17Uncharacterized protein OS=Ramazzottius varieornat... [more]
A0A1D1UM822.168e-721.23Uncharacterized protein OS=Ramazzottius varieornat... [more]
A0A1V1FIP75.391e-722.56Putative CTL9 OS=Reticulitermes speratus OX=60591 ... [more]
back to top
BLAST of Protocadherin Fat 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin Fat 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin Fat 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin Fat 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin Fat 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000042802.15.139e-626.47cadherin-related family member 5 [Source:NCBI gene... [more]
ENSORLT00000034588.16.657e-626.47cadherin-related family member 5 [Source:NCBI gene... [more]
back to top
BLAST of Protocadherin Fat 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000003985.10.000e+099.55SMESG000003985.1[more]
SMESG000003985.11.716e-6499.46SMESG000003985.1[more]
SMESG000003985.11.195e-4099.61SMESG000003985.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022857 ID=SMED30022857|Name=Protocadherin Fat 3|organism=Schmidtea mediterranea sexual|type=transcript|length=2430bp
CTTGTAATGTAGCTCCATTGTCATTATCAAATCTCTCTCTCCTCCCCGCA
TCTCGCAGTTTCGGCTTGAATCATAATAAATGAATAAATAATTATATTTT
AACCAATCAGCCAATCTGCATAAATAATGCGACAGTGTCATCAGGATTCA
GTGACATGACACCCATCGCAAATCTGATAAAAGCCTGACAACAGAATCAA
ATAAATTTACTTACAATATTGCTCCACCCGAGAGAAAAAAAATCAAATTG
TATATTTGAGAAATGTTAAAAATTGTTTTAATATTAATAATAAACTTGCT
TAAATATTCCGACCAAAGCTCTTGTTCTCTCCCCTCCGATCTTGGAATAG
CAAGGGTGGCTACAAATAATGAAATTGGTTCTCCCATATACAAATATACA
ATGTTCCAAACAGCTGATATCCTTTCCACCGATGTCCTTTCTCCTAATGA
CATTTATTTCGCCTTCAATGTCTCAACTCTTCAACTTATAAGTAAAATCG
TGTTGGATGGCAAGGTTACGAGCAATTATAATTTGAGATTGTTCATGACT
TGCTCGGATGTGACGGCGAAAATCTTTGAACAAATTATAAATATTATTTC
TTTAAATAATAATCAAGTGTCTTGGATATTTCAAAATTCTATCAACTACT
TTAATGGACAAATTTCTGATAACTCTCCAAATAATACAATTGTTAATTTC
GATGTTTCACCTAAATTTAATTATACTTACTCGCTAGGCACTTTTGAACT
CATTTTAATAGATGAAACGTTTTATGCCATAATAAGTGACACAACGGCAA
TTATTCGAAACAAAAAGTTATTAAATTATGATATTCAAAATGGCTATACA
CTGACTTTAGTCCTTCAGTACACCGACCAAACGGCGGGGACTTTGACGTT
ACCTGCCAATGCCACAGTTTTGATAACGGTTATCAAATCTAATAATAAAC
CTCCATTTTTCGAGATGTCCTCCTACAAGTTTCAAACCTTTACTAACGCA
ACAAAAAATTCAGTATTTCAAGTCTTTCCGCAGCCTTTGAAAGCATACGA
CGGAAATCTGGCAATTAACTCAACTATTATTTATAAATTTGCAACGTCAA
TTGATTTCCTTTATCTCGACCCCCTCAATGGAATTCTAAGTTCGAATGCA
TCAACATTGTTTGCTAGTTATTTTCAAACAACAATCATTGCCTATAATAG
CAAGAATATCAGTCTGCAAGCATATGTAGTTGTAAATATTAGCATAATAA
ATGTTCCAGTGCAATTTTATCAAAAATTCCAGTCAGAAAATCTCCAAGAA
AATATTAATTTTGTTGATATTCAACTGAATTTTACTTCGGATAAAAGCAA
AATTGTTTCTTTCCAAATGGTTCCGGAAGTGGGGAACTTTCAAATTGCGT
CGAATGGGCATGTATATTTAAAGAACCCATTAAATTTCAATATTCAGAGT
ATTTTTAATTTTACTATTACTGCTTCTGATGATATTTCGAGTGACCAAAT
GATTCTTGTAATAAATGTTTTAAAAGTTTTGACTTACAATCCAAAATTTT
TGATGTCTCCATATTATTTCTACGGGGACATCAGCAGTGGAAAATTCAAC
GTAACGCTTAGCATTATTAATTATAATCCGAACAGCACTATCAAGTTTGA
TTTGACTGACAACTACGGAGTATTCAAAATAAATCCAGATTCATCCAGCT
GTTATTTATATGTGGCAACAGACAAGGTACAGAGCATCAGGGCGACCGTC
TATTCCCTAATTGTCAATTTCACACATTCAGCCCTACCTCAAGTTTCAGA
CTCGGTCCAAGTAATTGTAGACTTTTCAACAACAATTTCAACGACGACAG
TCAACAGCCGTATCAAAGATGAAATACTTATAATATGCATTCTTTTGCCA
ATTCTCTTTTTATTCCTTCTGATTTTCCCCATTTTATTGTGTTATTACAA
AAAACGTCTACGAGTTATGACAAACAAAATAAATGAAAAAAACCGAGAAA
ATAATACAACAATTATTGCGACAAATAATTCTGTAAATACTCAAGACACT
CTCCACCAAATTCCTTCGGATAACGTACAATCTTCCACTGACCATGTGGG
GAATCCTATTGTCCACCATCCGGCCGTGCTAACCAGTCTTCATTGTTCGG
AGAATTTACCGGGTCAAAAATATTCGATGAAAGTAATTTTCAAATTTATG
ACCTATATAGCGGTGACGGCCTTGTCAGGCAGTTACAACAAGAAATCAAA
CTTAGAACCTTCATATCCAGAGAGGAATCCAGAAAAAATATCACCAGCCG
AAAGTATGAAATAGATTCGAACGAAATCAAGGAAGTTACCGTACCAAAAG
ACGAGAATGTCCTGTGTAATGATACTGATATGCTTTCTGATAAATACACA
GACTTAAAAGTTACCGTACCAAAAGACGAG
back to top

protein sequence of SMED30022857-orf-1

>SMED30022857-orf-1 ID=SMED30022857-orf-1|Name=SMED30022857-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=684bp
MLKIVLILIINLLKYSDQSSCSLPSDLGIARVATNNEIGSPIYKYTMFQT
ADILSTDVLSPNDIYFAFNVSTLQLISKIVLDGKVTSNYNLRLFMTCSDV
TAKIFEQIINIISLNNNQVSWIFQNSINYFNGQISDNSPNNTIVNFDVSP
KFNYTYSLGTFELILIDETFYAIISDTTAIIRNKKLLNYDIQNGYTLTLV
LQYTDQTAGTLTLPANATVLITVIKSNNKPPFFEMSSYKFQTFTNATKNS
VFQVFPQPLKAYDGNLAINSTIIYKFATSIDFLYLDPLNGILSSNASTLF
ASYFQTTIIAYNSKNISLQAYVVVNISIINVPVQFYQKFQSENLQENINF
VDIQLNFTSDKSKIVSFQMVPEVGNFQIASNGHVYLKNPLNFNIQSIFNF
TITASDDISSDQMILVINVLKVLTYNPKFLMSPYYFYGDISSGKFNVTLS
IINYNPNSTIKFDLTDNYGVFKINPDSSSCYLYVATDKVQSIRATVYSLI
VNFTHSALPQVSDSVQVIVDFSTTISTTTVNSRIKDEILIICILLPILFL
FLLIFPILLCYYKKRLRVMTNKINEKNRENNTTIIATNNSVNTQDTLHQI
PSDNVQSSTDHVGNPIVHHPAVLTSLHCSENLPGQKYSMKVIFKFMTYIA
VTALSGSYNKKSNLEPSYPERNPEKISPAESMK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR015919Cadherin-like_sf
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
GO:0007275multicellular organism development
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 334..437
e-value: 3.3E-5
score: 26.3
coord: 122..241
e-value: 6.9E-7
score: 31.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 662..683
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 184..561
NoneNo IPR availablePANTHERPTHR24028:SF274CADHERIN 96CB, ISOFORM Dcoord: 184..561
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 126..233
score: 9.804
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 365..420
e-value: 0.00233357
score: 35.7522
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.614
NoneNo IPR availableTMHMMTMhelixcoord: 540..562
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 367..436
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 227..329