Protein pelota-like protein

Overview
NameProtein pelota-like protein
Smed IDSMED30022849
Length (bp)1361
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein pelota-like protein (SMED30022849) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein pelota-like protein (SMED30022849) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein pelota-like protein (SMED30022849) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein pelota-like protein (SMED30022849) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022849

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30022849SMESG000037614.1 SMESG000037611.1 SmedASXL_012753SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30022849SMESG000037614.1 SMESG000037611.1 SmedASXL_012753SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30022849SMESG000037614.1 SMESG000037611.1 dd_Smed_v4_6665_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022849SMESG000037614.1 SMESG000037611.1 dd_Smed_v4_6665_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022849SMESG000037614.1 SMESG000037611.1 dd_Smed_v4_6665_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein pelota-like protein vs. Ensembl Human
Match: PELO (pelota mRNA surveillance and ribosome rescue factor [Source:HGNC Symbol;Acc:HGNC:8829])

HSP 1 Score: 441.81 bits (1135), Expect = 2.021e-153
Identity = 200/370 (54.05%), Postives = 284/370 (76.76%), Query Frame = 1
Query:  130 MKLISKRIDKFRKGKITLIPENDEDMWIIYNLFEIGDIVHSSTLRKVQIEASTGSVSVKQVRTSLSIRVETINYDSDGCQISVKGKNVEENEYVKMGAYHSLNIILNNKFSLMKDEWDTIALELVKQCTDVSNHADLAAVIMQEGLAYICLITNSATTVKHKIDMNIPQKRKGCATNRDKAVEKFIEIIVNSMEKHIKFDVVKCIILASPGFLKEKLFENLMKISNEKTNKVFQENKGKFLLVHSSTGHKHSLREVLMDPIVQSKTANTKAAGETRALADFFKMLKSDPSRAFYGLKHILHAHQSNAIDKLLISDSLFRCKDYVQRKKYVDIVDSVKDSQGIVKIFSSCHVTGEQLDNLSGIAAILRFPV 1239
            MKL+ K I+K   G++TL+PE  EDMW  YNL ++GD + +ST+RKVQ E+STGSV   +VRT+L++ VE I++DS  CQ+ VKG N++ENEYVKMGAYH++ +  N +F+L K +WD++ LE ++Q  D +  AD+AAV+MQEGLA+ICL+T S T  + K+++NIP+KRKG  +  D+A+E+F E +V ++++HI FDVVKCI++ASPGF++E+  + L + + +  NK+  EN+ KFL VH+S+GHK+SL+E L DP V S+ ++TKAAGE +AL DF+KML+ +P RAFYGLK +  A+++ AID LLISD LFR +D   R +YV +VDSVK++ G V+IFSS HV+GEQL  L+G+AAILRFPV
Sbjct:    1 MKLVRKNIEKDNAGQVTLVPEEPEDMWHTYNLVQVGDSLRASTIRKVQTESSTGSVGSNRVRTTLTLCVEAIDFDSQACQLRVKGTNIQENEYVKMGAYHTIELEPNRQFTLAKKQWDSVVLERIEQACDPAWSADVAAVVMQEGLAHICLVTPSMTLTRAKVEVNIPRKRKGNCSQHDRALERFYEQVVQAIQRHIHFDVVKCILVASPGFVREQFCDYLFQQAVKTDNKLLLENRSKFLQVHASSGHKYSLKEALCDPTVASRLSDTKAAGEVKALDDFYKMLQHEPDRAFYGLKQVEKANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLHVSGEQLSQLTGVAAILRFPV 370          
BLAST of Protein pelota-like protein vs. Ensembl Celegans
Match: pelo-1 (pep chromosome:WBcel235:III:4202253:4204269:-1 gene:WBGene00011280.1 transcript:R74.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:pelo-1)

HSP 1 Score: 340.502 bits (872), Expect = 4.119e-114
Identity = 173/370 (46.76%), Postives = 254/370 (68.65%), Query Frame = 1
Query:  130 MKLISKRIDKFRKGKITLIPENDEDMWIIYNLFEIGDIVHSSTLRKVQIEASTGSVSVKQVRTSLSIRVETINYDSDGCQISVKGKNVEENEYVKMGAYHSLNIILNNKFSLMKDEWDTIALELVKQCTDVSNHADLAAVIMQEGLAYICLITNSATTVKHKIDMNIPQKRKGCATNRDKAVEKFIEIIVNSMEKHIKFDVVKCIILASPGFLKEKLFENLMKISNEKTNKVFQENKGKFLLVHSSTGHKHSLREVLMDPIVQSKTANTKAAGETRALADFFKMLKSDPSRAFYGLKHILHAHQSNAIDKLLISDSLFRCKDYVQRKKYVDIVDSVKDSQGIVKIFSSCHVTGEQLDNLSGIAAILRFPV 1239
            MK   + I++   G + L+ E  EDMW IYNL  IGDI+ +ST+RKV  E STG+ S ++V T L++ VE+I++D    ++ +KG+N+EEN+ VK+GAYH++++  N KF+L K EWD+I LE +    D +  AD+AAV++ EGLA +CLIT + T  + KIDM IP+KRKG  +  +K +EKF E +  +  +H+   VVKC+I+AS GF+K+   ++L+  ++    K   E + KF+L HSS+G KH+L+EVL  P V  + A+TKA GE +AL  F +++ ++P RAFYG  H+  A+Q  AI+ LL++DSLFR +D   R+KYV +V+SV++  G V IFSS HV+GEQL  L+G AAILRFP+
Sbjct:    1 MKQFKRGIERDGTGFVVLMAEEAEDMWHIYNLIRIGDIIKASTIRKVVSETSTGTTSSQRVHTMLTVSVESIDFDPGAQELHLKGRNIEENDIVKLGAYHTIDLEPNRKFTLQKTEWDSIDLERLNLALDPAQAADVAAVVLHEGLANVCLITPAMTLTRAKIDMTIPRKRKGFTSQHEKGLEKFYEAVSTAFMRHVNLQVVKCVIVASRGFVKDAFMQHLIAHADANGKKFTTEQRAKFMLTHSSSGFKHALKEVLETPQVALRLADTKAQGEVKALNQFLELMSTEPDRAFYGFNHVNRANQELAIETLLVADSLFRAQDIETRRKYVRLVESVREQNGKVHIFSSMHVSGEQLAQLTGCAAILRFPM 370          
BLAST of Protein pelota-like protein vs. Ensembl Fly
Match: pelo (gene:FBgn0011207 transcript:FBtr0079847)

HSP 1 Score: 435.647 bits (1119), Expect = 4.148e-151
Identity = 196/370 (52.97%), Postives = 284/370 (76.76%), Query Frame = 1
Query:  130 MKLISKRIDKFRKGKITLIPENDEDMWIIYNLFEIGDIVHSSTLRKVQIEASTGSVSVKQVRTSLSIRVETINYDSDGCQISVKGKNVEENEYVKMGAYHSLNIILNNKFSLMKDEWDTIALELVKQCTDVSNHADLAAVIMQEGLAYICLITNSATTVKHKIDMNIPQKRKGCATNRDKAVEKFIEIIVNSMEKHIKFDVVKCIILASPGFLKEKLFENLMKISNEKTNKVFQENKGKFLLVHSSTGHKHSLREVLMDPIVQSKTANTKAAGETRALADFFKMLKSDPSRAFYGLKHILHAHQSNAIDKLLISDSLFRCKDYVQRKKYVDIVDSVKDSQGIVKIFSSCHVTGEQLDNLSGIAAILRFPV 1239
            MKL+ K +DK  +G +TL+PE  EDMW  YNL   GD V S+T+RKVQ E +TGS +  +VRT+L+I VE+I++D+  C + +KG+N+EEN+YVKMGAYH+L++ LN KF L K EWDTIALE ++   D +  AD+AAV+MQEGLA++CLIT S T V+ KI+++IP+KRKG     +K + KF E ++ S+ +H+ FDVVKC+++ASPGF++++ ++ + + + +   K+  +NK KF+LVH+S+G KHSLRE+L DP V +K ++TKAAGE +AL  F+ ML+ +P++AFYG KH+L A +S AI+ LLISD+LFRC+D   RK+YV++V+S++D+ G VKIFSS H++GEQL  L+GIAA+LRFP+
Sbjct:    1 MKLLGKYVDKGMQGNVTLVPEESEDMWHAYNLIAKGDSVRSTTIRKVQNETATGSSTSSRVRTTLTIAVESIDFDTQACVLRLKGRNIEENQYVKMGAYHTLDLELNRKFELRKPEWDTIALERIEMACDPTQSADVAAVVMQEGLAHVCLITASMTLVRSKIEVSIPRKRKGSVQQHEKGLAKFYEQVMQSILRHVNFDVVKCVLIASPGFVRDQFYDYMFQQAVKMDYKLLLDNKSKFMLVHASSGFKHSLREILQDPAVLAKMSDTKAAGEVKALEQFYMMLQCEPAKAFYGKKHVLQAAESQAIETLLISDNLFRCQDVSLRKEYVNLVESIRDAGGEVKIFSSMHISGEQLAQLTGIAALLRFPM 370          
BLAST of Protein pelota-like protein vs. Ensembl Zebrafish
Match: pelo (pelota mRNA surveillance and ribosome rescue factor [Source:NCBI gene;Acc:394111])

HSP 1 Score: 430.254 bits (1105), Expect = 5.876e-149
Identity = 196/370 (52.97%), Postives = 281/370 (75.95%), Query Frame = 1
Query:  130 MKLISKRIDKFRKGKITLIPENDEDMWIIYNLFEIGDIVHSSTLRKVQIEASTGSVSVKQVRTSLSIRVETINYDSDGCQISVKGKNVEENEYVKMGAYHSLNIILNNKFSLMKDEWDTIALELVKQCTDVSNHADLAAVIMQEGLAYICLITNSATTVKHKIDMNIPQKRKGCATNRDKAVEKFIEIIVNSMEKHIKFDVVKCIILASPGFLKEKLFENLMKISNEKTNKVFQENKGKFLLVHSSTGHKHSLREVLMDPIVQSKTANTKAAGETRALADFFKMLKSDPSRAFYGLKHILHAHQSNAIDKLLISDSLFRCKDYVQRKKYVDIVDSVKDSQGIVKIFSSCHVTGEQLDNLSGIAAILRFPV 1239
            MKL+ K I+K   G++TLIP+  EDMW  YNL ++GD + +ST+RKVQ E+STGSV   +VRT+L++ VETI++DS  CQ+ VKG N++EN+YVKMGAYH++ + LN KF+L K  WD++ L+ ++Q  D +  AD+AAV+MQEGLA + L+T + T ++ K+++ IP+KRKG  T  DKA+E+F E ++  + +H  FDVVKCI++ASPGF+K++    L K +  +  K+  EN+ KF++VHSS+GHK+SL+EVL DP V ++ ++TKAAGE +AL DF+KML+ +P RAFYGL H+  A ++ AID LLISD+LFR +D   R +YV +VD+VK++ G V+IFSS HV+GEQL+ LSG+AAILRFP+
Sbjct:    1 MKLVHKDIEKDNAGQVTLIPDEAEDMWHTYNLLQVGDSLRASTIRKVQTESSTGSVGSSRVRTTLTLCVETIDFDSQACQLRVKGTNIQENQYVKMGAYHTIELELNRKFTLAKKVWDSVVLDRIEQACDPAQKADVAAVVMQEGLANLVLVTPAMTLLRAKVEVTIPRKRKGSCTQHDKALERFYEAVMQGILRHFNFDVVKCILVASPGFVKDQFISYLFKEAVRQDCKLLLENRSKFMVVHSSSGHKYSLKEVLCDPAVTARLSDTKAAGEVKALEDFYKMLQQEPDRAFYGLAHVERASEALAIDILLISDTLFRHQDVATRGRYVRLVDNVKENGGTVRIFSSLHVSGEQLNQLSGVAAILRFPI 370          
BLAST of Protein pelota-like protein vs. Ensembl Zebrafish
Match: pelo (pelota mRNA surveillance and ribosome rescue factor [Source:NCBI gene;Acc:394111])

HSP 1 Score: 202.986 bits (515), Expect = 7.244e-63
Identity = 90/178 (50.56%), Postives = 133/178 (74.72%), Query Frame = 1
Query:  265 KVQIEASTGSVSVKQVRTSLSIRVETINYDSDGCQISVKGKNVEENEYVKMGAYHSLNIILNNKFSLMKDEWDTIALELVKQCTDVSNHADLAAVIMQEGLAYICLITNSATTVKHKIDMNIPQKRKGCATNRDKAVEKFIEIIVNSMEKHIKFDVVKCIILASPGFLKEKLFENLMK 798
            KVQ E+STGSV   +VRT+L++ VETI++DS  CQ+ VKG N++EN+YVKMGAYH++ + LN KF+L K  WD++ L+ ++Q  D +  AD+AAV+MQEGLA + L+T + T ++ K+++ IP+KRKG  T  DKA+E+F E ++  + +H  FDVVKCI++ASPGF+K++    L K
Sbjct:   15 KVQTESSTGSVGSSRVRTTLTLCVETIDFDSQACQLRVKGTNIQENQYVKMGAYHTIELELNRKFTLAKKVWDSVVLDRIEQACDPAQKADVAAVVMQEGLANLVLVTPAMTLLRAKVEVTIPRKRKGSCTQHDKALERFYEAVMQGILRHFNFDVVKCILVASPGFVKDQFISYLFK 192          
BLAST of Protein pelota-like protein vs. Ensembl Xenopus
Match: pelo (pelota homolog [Source:NCBI gene;Acc:448078])

HSP 1 Score: 313.538 bits (802), Expect = 2.076e-104
Identity = 146/277 (52.71%), Postives = 209/277 (75.45%), Query Frame = 1
Query:  409 VKMGAYHSLNIILNNKFSLMKDEWDTIALELVKQCTDVSNHADLAAVIMQEGLAYICLITNSATTVKHKIDMNIPQKRKGCATNRDKAVEKFIEIIVNSMEKHIKFDVVKCIILASPGFLKEKLFENLMKISNEKTNKVFQENKGKFLLVHSSTGHKHSLREVLMDPIVQSKTANTKAAGETRALADFFKMLKSDPSRAFYGLKHILHAHQSNAIDKLLISDSLFRCKDYVQRKKYVDIVDSVKDSQGIVKIFSSCHVTGEQLDNLSGIAAILRFPV 1239
            V+MGAYH++ +  N KF+L K +WD++ LE ++Q  D +  AD+ AV+MQEGLA+ICL+T S T ++ KI+ +IP+KR+G  T  +KA+EKF E ++  + +HI FDVVK +++ASPGF++E+  E L   + ++  K+  EN+GKFL VHSS+GHK+SL EVL DP V ++ A+TKAA E +AL DF+KML+ +P RAFYG+K +  A+++ AID LL++D LFR +D   R +YV +VDSVKD+ G V+IFSS HV+GEQL+ L+G+AAILRFPV
Sbjct:    1 VQMGAYHTIELEPNRKFTLAKKQWDSVVLERIEQACDPAFSADVGAVVMQEGLAHICLVTPSMTLLRAKIETSIPRKRRGNCTQHEKALEKFYEQVMQGILRHINFDVVKVVLVASPGFVREQFCEFLFLRAVKQDIKLLLENRGKFLQVHSSSGHKYSLTEVLCDPAVTARLADTKAASEIKALGDFYKMLQHEPDRAFYGIKQVEKANEALAIDILLVTDELFRHQDVPTRTRYVRLVDSVKDNGGTVRIFSSLHVSGEQLNQLTGVAAILRFPV 277          
BLAST of Protein pelota-like protein vs. Ensembl Xenopus
Match: pelo (pelota homolog [Source:NCBI gene;Acc:448078])

HSP 1 Score: 188.348 bits (477), Expect = 3.258e-57
Identity = 87/177 (49.15%), Postives = 130/177 (73.45%), Query Frame = 1
Query:  409 VKMGAYHSLNIILNNKFSLMKDEWDTIALELVKQCTDVSNHADLAAVIMQEGLAYICLITNSATTVKHKIDMNIPQKRKGCATNRDKAVEKFIEIIVNSMEKHIKFDVVKCIILASPGFLKEKLFENLMKISNEKTNKVFQENKGKFLLVHSSTGHKHSLREVLMDPIVQSKTANTK 939
            V+MGAYH++ +  N KF+L K +WD++ LE ++Q  D +  AD+ AV+MQEGLA+ICL+T S T ++ KI+ +IP+KR+G  T  +KA+EKF E ++  + +HI FDVVK +++ASPGF++E+  E L   + ++  K+  EN+GKFL VHSS+GHK+SL EVL DP V ++ A+TK
Sbjct:    1 VQMGAYHTIELEPNRKFTLAKKQWDSVVLERIEQACDPAFSADVGAVVMQEGLAHICLVTPSMTLLRAKIETSIPRKRRGNCTQHEKALEKFYEQVMQGILRHINFDVVKVVLVASPGFVREQFCEFLFLRAVKQDIKLLLENRGKFLQVHSSSGHKYSLTEVLCDPAVTARLADTK 177          
BLAST of Protein pelota-like protein vs. Ensembl Mouse
Match: Pelo (pelota mRNA surveillance and ribosome rescue factor [Source:MGI Symbol;Acc:MGI:2145154])

HSP 1 Score: 437.958 bits (1125), Expect = 6.040e-152
Identity = 196/370 (52.97%), Postives = 284/370 (76.76%), Query Frame = 1
Query:  130 MKLISKRIDKFRKGKITLIPENDEDMWIIYNLFEIGDIVHSSTLRKVQIEASTGSVSVKQVRTSLSIRVETINYDSDGCQISVKGKNVEENEYVKMGAYHSLNIILNNKFSLMKDEWDTIALELVKQCTDVSNHADLAAVIMQEGLAYICLITNSATTVKHKIDMNIPQKRKGCATNRDKAVEKFIEIIVNSMEKHIKFDVVKCIILASPGFLKEKLFENLMKISNEKTNKVFQENKGKFLLVHSSTGHKHSLREVLMDPIVQSKTANTKAAGETRALADFFKMLKSDPSRAFYGLKHILHAHQSNAIDKLLISDSLFRCKDYVQRKKYVDIVDSVKDSQGIVKIFSSCHVTGEQLDNLSGIAAILRFPV 1239
            MKL+ K I+K   G++TL+PE  EDMW  +NL ++GD + +ST+RKVQ E+STGSV   +VRT+L++ VE I++DS  CQ+ VKG N++ENEYVKMGAYH++ +  N +F+L K +WD++ LE ++Q  D +  AD+AAV+MQEGLA++CL+T S T  + K+++NIP+KRKG  +  D+A+E+F E +V ++++HI F+VVKC+++ASPGF++E+  + + + + +  NKV  EN+ KFL VH+S+GHK+SL+E L DP V S+ ++TKAAGE +AL DF+KML+ +P RAFYGLK +  A+++ AID LLISD LFR +D   R +YV +VDSVK++ G V+IFSS HV+GEQL  L+G+AAILRFPV
Sbjct:    1 MKLVRKDIEKDNAGQVTLVPEEPEDMWHTFNLVQVGDSLRASTIRKVQTESSTGSVGSNRVRTTLTLCVEAIDFDSQACQLRVKGTNIQENEYVKMGAYHTIELEPNRQFTLAKKQWDSVVLERIEQACDPAWSADVAAVVMQEGLAHVCLVTPSMTLTRAKVEVNIPRKRKGNCSQHDRALERFYEQVVQAIQRHINFEVVKCVLVASPGFVREQFCDYMFQQAVKTDNKVLLENRSKFLQVHASSGHKYSLKEALCDPTVASRLSDTKAAGEVKALDDFYKMLQHEPDRAFYGLKQVERANEALAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLHVSGEQLGQLTGVAAILRFPV 370          
BLAST of Protein pelota-like protein vs. UniProt/SwissProt
Match: sp|Q9BRX2|PELO_HUMAN (Protein pelota homolog OS=Homo sapiens OX=9606 GN=PELO PE=1 SV=2)

HSP 1 Score: 441.81 bits (1135), Expect = 9.707e-153
Identity = 200/370 (54.05%), Postives = 284/370 (76.76%), Query Frame = 1
Query:  130 MKLISKRIDKFRKGKITLIPENDEDMWIIYNLFEIGDIVHSSTLRKVQIEASTGSVSVKQVRTSLSIRVETINYDSDGCQISVKGKNVEENEYVKMGAYHSLNIILNNKFSLMKDEWDTIALELVKQCTDVSNHADLAAVIMQEGLAYICLITNSATTVKHKIDMNIPQKRKGCATNRDKAVEKFIEIIVNSMEKHIKFDVVKCIILASPGFLKEKLFENLMKISNEKTNKVFQENKGKFLLVHSSTGHKHSLREVLMDPIVQSKTANTKAAGETRALADFFKMLKSDPSRAFYGLKHILHAHQSNAIDKLLISDSLFRCKDYVQRKKYVDIVDSVKDSQGIVKIFSSCHVTGEQLDNLSGIAAILRFPV 1239
            MKL+ K I+K   G++TL+PE  EDMW  YNL ++GD + +ST+RKVQ E+STGSV   +VRT+L++ VE I++DS  CQ+ VKG N++ENEYVKMGAYH++ +  N +F+L K +WD++ LE ++Q  D +  AD+AAV+MQEGLA+ICL+T S T  + K+++NIP+KRKG  +  D+A+E+F E +V ++++HI FDVVKCI++ASPGF++E+  + L + + +  NK+  EN+ KFL VH+S+GHK+SL+E L DP V S+ ++TKAAGE +AL DF+KML+ +P RAFYGLK +  A+++ AID LLISD LFR +D   R +YV +VDSVK++ G V+IFSS HV+GEQL  L+G+AAILRFPV
Sbjct:    1 MKLVRKNIEKDNAGQVTLVPEEPEDMWHTYNLVQVGDSLRASTIRKVQTESSTGSVGSNRVRTTLTLCVEAIDFDSQACQLRVKGTNIQENEYVKMGAYHTIELEPNRQFTLAKKQWDSVVLERIEQACDPAWSADVAAVVMQEGLAHICLVTPSMTLTRAKVEVNIPRKRKGNCSQHDRALERFYEQVVQAIQRHIHFDVVKCILVASPGFVREQFCDYLFQQAVKTDNKLLLENRSKFLQVHASSGHKYSLKEALCDPTVASRLSDTKAAGEVKALDDFYKMLQHEPDRAFYGLKQVEKANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLHVSGEQLSQLTGVAAILRFPV 370          
BLAST of Protein pelota-like protein vs. UniProt/SwissProt
Match: sp|Q58DV0|PELO_BOVIN (Protein pelota homolog OS=Bos taurus OX=9913 GN=PELO PE=2 SV=2)

HSP 1 Score: 441.81 bits (1135), Expect = 1.059e-152
Identity = 200/370 (54.05%), Postives = 284/370 (76.76%), Query Frame = 1
Query:  130 MKLISKRIDKFRKGKITLIPENDEDMWIIYNLFEIGDIVHSSTLRKVQIEASTGSVSVKQVRTSLSIRVETINYDSDGCQISVKGKNVEENEYVKMGAYHSLNIILNNKFSLMKDEWDTIALELVKQCTDVSNHADLAAVIMQEGLAYICLITNSATTVKHKIDMNIPQKRKGCATNRDKAVEKFIEIIVNSMEKHIKFDVVKCIILASPGFLKEKLFENLMKISNEKTNKVFQENKGKFLLVHSSTGHKHSLREVLMDPIVQSKTANTKAAGETRALADFFKMLKSDPSRAFYGLKHILHAHQSNAIDKLLISDSLFRCKDYVQRKKYVDIVDSVKDSQGIVKIFSSCHVTGEQLDNLSGIAAILRFPV 1239
            MKL+ K I+K   G++TL+PE  EDMW  YNL ++GD + +ST+RKVQ E+STGSV   +VRT+L++ VE I++DS  CQ+ VKG N++ENEYVKMGAYH++ +  N +F+L K +WD++ LE ++Q  D +  AD+AAV+MQEGLA+ICL+T S T  + K+++NIP+KRKG  +  D+A+E+F E +V ++++HI FDVVKC+++ASPGF++E+  + + + + +  NKV  EN+ KFL VH+S+GHK+SL+E L DP V S+ ++TKAAGE +AL DF+KML+ +P RAFYGLK +  A+++ AID LLISD LFR +D   R +YV +VDSVK++ G V+IFSS HV+GEQL  L+GIAAILRFPV
Sbjct:    1 MKLVRKDIEKDNAGQVTLVPEEPEDMWHTYNLVQVGDSLRASTIRKVQTESSTGSVGSNRVRTTLTLCVEAIDFDSQACQLRVKGTNIQENEYVKMGAYHTIELEPNRQFTLAKKQWDSVVLERIEQACDPAWSADVAAVVMQEGLAHICLVTPSMTLTRAKVEVNIPRKRKGNCSQHDRALERFYEQVVQAIQRHIHFDVVKCVLVASPGFVREQFCDYMFQQAVKTDNKVLLENRSKFLQVHASSGHKYSLKEALCDPTVASRLSDTKAAGEVKALDDFYKMLQHEPDRAFYGLKQVEKANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLHVSGEQLSQLTGIAAILRFPV 370          
BLAST of Protein pelota-like protein vs. UniProt/SwissProt
Match: sp|Q5RCE3|PELO_PONAB (Protein pelota homolog OS=Pongo abelii OX=9601 GN=PELO PE=2 SV=1)

HSP 1 Score: 441.81 bits (1135), Expect = 1.317e-152
Identity = 200/370 (54.05%), Postives = 284/370 (76.76%), Query Frame = 1
Query:  130 MKLISKRIDKFRKGKITLIPENDEDMWIIYNLFEIGDIVHSSTLRKVQIEASTGSVSVKQVRTSLSIRVETINYDSDGCQISVKGKNVEENEYVKMGAYHSLNIILNNKFSLMKDEWDTIALELVKQCTDVSNHADLAAVIMQEGLAYICLITNSATTVKHKIDMNIPQKRKGCATNRDKAVEKFIEIIVNSMEKHIKFDVVKCIILASPGFLKEKLFENLMKISNEKTNKVFQENKGKFLLVHSSTGHKHSLREVLMDPIVQSKTANTKAAGETRALADFFKMLKSDPSRAFYGLKHILHAHQSNAIDKLLISDSLFRCKDYVQRKKYVDIVDSVKDSQGIVKIFSSCHVTGEQLDNLSGIAAILRFPV 1239
            MKL+ K I+K   G++TL+PE  EDMW  YNL ++GD + +ST+RKVQ E+STGSV   +VRT+L++ VE I++DS  CQ+ VKG N++ENEYVKMGAYH++ +  N +F+L K +WD++ LE ++Q  D +  AD+AAV+MQEGLA+ICL+T S T  + K+++NIP+KRKG  +  D+A+E+F E +V ++++HI FDVVKCI++ASPGF++E+  + + + + +  NK+  EN+ KFL VH+S+GHK+SL+EVL DP V S+ ++TKAAGE +AL DF+KML+  P RAFYGLK +  A+++ AID LLISD LFR +D   R +YV +VDSVK++ G V+IFSS HV+GEQL  L+G+AAILRFPV
Sbjct:    1 MKLVRKNIEKDNAGQVTLVPEEPEDMWHTYNLVQVGDSLRASTIRKVQTESSTGSVGSNRVRTTLTLCVEAIDFDSQACQLRVKGTNIQENEYVKMGAYHTIELEPNRQFTLAKKQWDSVVLERIEQACDPAWSADVAAVVMQEGLAHICLVTPSMTLTRAKVEVNIPRKRKGNCSQHDRALERFYEQVVQAIQRHIHFDVVKCILVASPGFVREQFCDYMFQQAVKTDNKLLLENRSKFLQVHASSGHKYSLKEVLCDPTVASRLSDTKAAGEVKALDDFYKMLQHGPDRAFYGLKQVEKANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLHVSGEQLSQLTGVAAILRFPV 370          
BLAST of Protein pelota-like protein vs. UniProt/SwissProt
Match: sp|Q5XIP1|PELO_RAT (Protein pelota homolog OS=Rattus norvegicus OX=10116 GN=Pelo PE=1 SV=1)

HSP 1 Score: 441.425 bits (1134), Expect = 1.638e-152
Identity = 199/370 (53.78%), Postives = 285/370 (77.03%), Query Frame = 1
Query:  130 MKLISKRIDKFRKGKITLIPENDEDMWIIYNLFEIGDIVHSSTLRKVQIEASTGSVSVKQVRTSLSIRVETINYDSDGCQISVKGKNVEENEYVKMGAYHSLNIILNNKFSLMKDEWDTIALELVKQCTDVSNHADLAAVIMQEGLAYICLITNSATTVKHKIDMNIPQKRKGCATNRDKAVEKFIEIIVNSMEKHIKFDVVKCIILASPGFLKEKLFENLMKISNEKTNKVFQENKGKFLLVHSSTGHKHSLREVLMDPIVQSKTANTKAAGETRALADFFKMLKSDPSRAFYGLKHILHAHQSNAIDKLLISDSLFRCKDYVQRKKYVDIVDSVKDSQGIVKIFSSCHVTGEQLDNLSGIAAILRFPV 1239
            MKL+ K I+K   G++TL+PE  EDMW  YNL ++GD + +ST+RKVQ E+STGSV   +VRT+L++ VE I++DS  CQ+ VKG N++ENEYVKMGAYH++ +  N +F+L K +WD++ LE ++Q  D +  AD+AAV+MQEGLA++CL+T S T  + K+++NIP+KRKG  +  D+A+E+F E +V ++++HI F+VVKCI++ASPGF++E+  + + + + +  NKV  EN+ KFL VH+S+GHK+SL+EVL DP V S+ ++TKAAGE +AL DF+KML+ +P RAFYGLK +  A+++ AID LLISD LFR +D   R +YV +VDSVK++ G V+IFSS HV+GEQL  L+G+AAILRFPV
Sbjct:    1 MKLVRKDIEKDNAGQVTLVPEEPEDMWHTYNLVQVGDSLRASTIRKVQTESSTGSVGSNRVRTTLTLCVEAIDFDSQACQLRVKGTNIQENEYVKMGAYHTIELEPNRQFTLAKKQWDSVVLERIEQACDPAWSADVAAVVMQEGLAHVCLVTPSMTLTRAKVEVNIPRKRKGNCSQHDRALERFYEQVVQAIQRHINFEVVKCILVASPGFVREQFCDYMFQQAVKTDNKVLLENRSKFLQVHASSGHKYSLKEVLCDPTVASRLSDTKAAGEVKALDDFYKMLQHEPDRAFYGLKQVERANEALAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLHVSGEQLGQLTGVAAILRFPV 370          
BLAST of Protein pelota-like protein vs. UniProt/SwissProt
Match: sp|Q5ZK01|PELO_CHICK (Protein pelota homolog OS=Gallus gallus OX=9031 GN=PELO PE=2 SV=1)

HSP 1 Score: 438.343 bits (1126), Expect = 2.531e-151
Identity = 195/370 (52.70%), Postives = 285/370 (77.03%), Query Frame = 1
Query:  130 MKLISKRIDKFRKGKITLIPENDEDMWIIYNLFEIGDIVHSSTLRKVQIEASTGSVSVKQVRTSLSIRVETINYDSDGCQISVKGKNVEENEYVKMGAYHSLNIILNNKFSLMKDEWDTIALELVKQCTDVSNHADLAAVIMQEGLAYICLITNSATTVKHKIDMNIPQKRKGCATNRDKAVEKFIEIIVNSMEKHIKFDVVKCIILASPGFLKEKLFENLMKISNEKTNKVFQENKGKFLLVHSSTGHKHSLREVLMDPIVQSKTANTKAAGETRALADFFKMLKSDPSRAFYGLKHILHAHQSNAIDKLLISDSLFRCKDYVQRKKYVDIVDSVKDSQGIVKIFSSCHVTGEQLDNLSGIAAILRFPV 1239
            MKL+ K ++K   G++TLIPE  EDMW  YNL ++GD + +ST+RKVQ E+STGSV   ++RT+L++ VE I++DS  CQ+ VKG N++ENEYVKMGAYH++ +  N +F+L K +WD++ LE ++Q  D + +AD+AAV+MQEGLA++CL+T S T  + K+++NIP+KRKG  +  D+A+E+F E +V ++++HI F+VVKC+++ASPGF++E+  + + + + +  NK+  EN+ KFL VHSS+GHK+ L+E L DP V S+ ++TKAAGE +AL DF+KML+ +P RAFYGLKH+  A+++ AID LLISD LFR +D   R +YV +VDSV+++ G V+IFSS HV+GEQL  L+G+AAILRFPV
Sbjct:    1 MKLVRKDLEKDNAGQVTLIPEEPEDMWHTYNLLQVGDSLRASTIRKVQTESSTGSVGSNRIRTTLTLCVEAIDFDSQACQLRVKGTNIQENEYVKMGAYHTIELEPNRQFTLAKKQWDSVVLERIEQACDPAWNADVAAVVMQEGLAHVCLVTPSMTLTRAKVEVNIPRKRKGNCSQHDRALERFYEQVVQAIQRHINFEVVKCVLVASPGFVREQFCDYMFQQAVKTDNKLLLENRSKFLQVHSSSGHKYVLKEALCDPAVTSRLSDTKAAGEVKALDDFYKMLQHEPDRAFYGLKHVEKANEAMAIDTLLISDELFRHQDVATRARYVKLVDSVRENMGTVRIFSSLHVSGEQLGQLTGVAAILRFPV 370          
BLAST of Protein pelota-like protein vs. TrEMBL
Match: G7Y489 (Protein pelota homolog OS=Clonorchis sinensis OX=79923 GN=CLF_100787 PE=3 SV=1)

HSP 1 Score: 472.626 bits (1215), Expect = 3.443e-162
Identity = 214/371 (57.68%), Postives = 295/371 (79.51%), Query Frame = 1
Query:  130 MKLISKRIDKFRKGKITLIPENDEDMWIIYNLFEIGDIVHSSTLRKVQIEASTGSVSVKQVRTSLSIRVETINYDSDGCQISVKGKNVEENEYVKMGAYHSLNIILNNKFSLMKDEWDTIALELVKQCTDVSNHADLAAVIMQEGLAYICLITNSATTVKHKIDMNIPQKRKGCATNR-DKAVEKFIEIIVNSMEKHIKFDVVKCIILASPGFLKEKLFENLMKISNEKTNKVFQENKGKFLLVHSSTGHKHSLREVLMDPIVQSKTANTKAAGETRALADFFKMLKSDPSRAFYGLKHILHAHQSNAIDKLLISDSLFRCKDYVQRKKYVDIVDSVKDSQGIVKIFSSCHVTGEQLDNLSGIAAILRFPV 1239
            M++I K +DK+  G ITLI EN+EDMW+ YNL ++GD +  ST+RKVQ E++TGSV  KQVRT+L+I VE I++D  G  + +KG+NV EN++VKMGAYH+L++ L+ KF++ K EWD+IAL LV+Q  D + HADLAAVIM EGLAY+CL+T++ T V+ KI++NIP+KR G  T + +K + +F E I+ ++E+H++FD+VKC+ILASPGF++E+ F+ LM+ S ++  +VF ENKGKF+LVHSS+GHKH+L+EVLMD  +QSK ANTKAA E  AL DF++MLK D SRAFYG KH+  A  + AID LL+SD+LFR +D  +R++YV +VD+VK+ QG V+IFSS HV+GEQL+ LSG+AAILRFP+
Sbjct:    1 MRVIHKEVDKYSSGHITLIAENEEDMWLTYNLVQVGDQLRCSTVRKVQNESATGSVQTKQVRTNLTINVEKIDFDLQGSVLHLKGRNVAENQFVKMGAYHTLDLSLDEKFTIFKSEWDSIALMLVEQAADPTQHADLAAVIMHEGLAYVCLVTSTTTIVRAKIEINIPRKRPGLPTTQHEKGMTRFFEQIMQALERHVRFDIVKCVILASPGFVREQFFDYLMQTSTKQDKRVFLENKGKFVLVHSSSGHKHALKEVLMDSSIQSKLANTKAAAEVNALNDFYQMLKVDQSRAFYGYKHVKAASDALAIDTLLVSDALFRSRDLEERRRYVSLVDTVKEDQGTVRIFSSLHVSGEQLNQLSGVAAILRFPI 371          
BLAST of Protein pelota-like protein vs. TrEMBL
Match: A0A074ZJI8 (eRF1_1 domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_08609 PE=4 SV=1)

HSP 1 Score: 469.929 bits (1208), Expect = 9.286e-159
Identity = 214/369 (57.99%), Postives = 294/369 (79.67%), Query Frame = 1
Query:  136 LISKRIDKFRKGKITLIPENDEDMWIIYNLFEIGDIVHSSTLRKVQIEASTGSVSVKQVRTSLSIRVETINYDSDGCQISVKGKNVEENEYVKMGAYHSLNIILNNKFSLMKDEWDTIALELVKQCTDVSNHADLAAVIMQEGLAYICLITNSATTVKHKIDMNIPQKRKGCATNR-DKAVEKFIEIIVNSMEKHIKFDVVKCIILASPGFLKEKLFENLMKISNEKTNKVFQENKGKFLLVHSSTGHKHSLREVLMDPIVQSKTANTKAAGETRALADFFKMLKSDPSRAFYGLKHILHAHQSNAIDKLLISDSLFRCKDYVQRKKYVDIVDSVKDSQGIVKIFSSCHVTGEQLDNLSGIAAILRFPV 1239
            +I K +DK+  G ITLI EN+EDMW+ YNL +IGD +  ST+RKVQ E++TGSV  KQVRT+L+I VE I++D  G  + +KG+NV EN++VKMGAYH+L++ L+ KF++ K EWD+IAL LV+Q  D + HADLAAVIM EGLAY+CL+T++ T V+ KI++NIP+KR G  T + +K + +F E I+ ++E+H++FD+VKC+ILASPGF++E+ F+ LM+ S ++  +VF ENKGKF+LVHSS+GHKH+L+EVLMD  +QSK ANTKAA E  AL DF++MLK D SRAFYG KH+  A  + AID LL+SD+LFR +D  +R++YV++VD+VK+ QG V+IFSS HV+GEQL+ LSG+AAILRFP+
Sbjct:  168 IIHKEVDKYSSGHITLIAENEEDMWLTYNLVQIGDQLRCSTVRKVQNESATGSVQTKQVRTNLTINVEKIDFDLQGSVLHLKGRNVAENQFVKMGAYHTLDLTLDEKFTIFKSEWDSIALMLVEQAADPTQHADLAAVIMHEGLAYVCLVTSTTTIVRAKIEINIPRKRPGLPTTQHEKGMTRFFEQIMQALERHVRFDIVKCVILASPGFVREQFFDYLMQTSTKQDKRVFLENKGKFVLVHSSSGHKHALKEVLMDSSIQSKLANTKAAAEVNALNDFYQMLKVDQSRAFYGYKHVKAASDALAIDTLLVSDALFRSRDLEERRRYVNLVDTVKEDQGTVRIFSSLHVSGEQLNQLSGVAAILRFPI 536          
BLAST of Protein pelota-like protein vs. TrEMBL
Match: A0A3R7DP81 (Protein pelota-like protein OS=Clonorchis sinensis OX=79923 GN=Pelo PE=4 SV=1)

HSP 1 Score: 471.47 bits (1212), Expect = 1.662e-158
Identity = 214/371 (57.68%), Postives = 295/371 (79.51%), Query Frame = 1
Query:  130 MKLISKRIDKFRKGKITLIPENDEDMWIIYNLFEIGDIVHSSTLRKVQIEASTGSVSVKQVRTSLSIRVETINYDSDGCQISVKGKNVEENEYVKMGAYHSLNIILNNKFSLMKDEWDTIALELVKQCTDVSNHADLAAVIMQEGLAYICLITNSATTVKHKIDMNIPQKRKGCATNR-DKAVEKFIEIIVNSMEKHIKFDVVKCIILASPGFLKEKLFENLMKISNEKTNKVFQENKGKFLLVHSSTGHKHSLREVLMDPIVQSKTANTKAAGETRALADFFKMLKSDPSRAFYGLKHILHAHQSNAIDKLLISDSLFRCKDYVQRKKYVDIVDSVKDSQGIVKIFSSCHVTGEQLDNLSGIAAILRFPV 1239
            M++I K +DK+  G ITLI EN+EDMW+ YNL ++GD +  ST+RKVQ E++TGSV  KQVRT+L+I VE I++D  G  + +KG+NV EN++VKMGAYH+L++ L+ KF++ K EWD+IAL LV+Q  D + HADLAAVIM EGLAY+CL+T++ T V+ KI++NIP+KR G  T + +K + +F E I+ ++E+H++FD+VKC+ILASPGF++E+ F+ LM+ S ++  +VF ENKGKF+LVHSS+GHKH+L+EVLMD  +QSK ANTKAA E  AL DF++MLK D SRAFYG KH+  A  + AID LL+SD+LFR +D  +R++YV +VD+VK+ QG V+IFSS HV+GEQL+ LSG+AAILRFP+
Sbjct:   29 MRVIHKEVDKYSSGHITLIAENEEDMWLTYNLVQVGDQLRCSTVRKVQNESATGSVQTKQVRTNLTINVEKIDFDLQGSVLHLKGRNVAENQFVKMGAYHTLDLSLDEKFTIFKSEWDSIALMLVEQAADPTQHADLAAVIMHEGLAYVCLVTSTTTIVRAKIEINIPRKRPGLPTTQHEKGMTRFFEQIMQALERHVRFDIVKCVILASPGFVREQFFDYLMQTSTKQDKRVFLENKGKFVLVHSSSGHKHALKEVLMDSSIQSKLANTKAAAEVNALNDFYQMLKVDQSRAFYGYKHVKAASDALAIDTLLVSDALFRSRDLEERRRYVSLVDTVKEDQGTVRIFSSLHVSGEQLNQLSGVAAILRFPI 399          
BLAST of Protein pelota-like protein vs. TrEMBL
Match: A0A5K3EHK0 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 460.685 bits (1184), Expect = 1.488e-157
Identity = 212/371 (57.14%), Postives = 292/371 (78.71%), Query Frame = 1
Query:  130 MKLISKRIDKFRKGKITLIPENDEDMWIIYNLFEIGDIVHSSTLRKVQIEASTGSVSVKQVRTSLSIRVETINYDSDGCQISVKGKNVEENEYVKMGAYHSLNIILNNKFSLMKDEWDTIALELVKQCTDVSNHADLAAVIMQEGLAYICLITNSATTVKHKIDMNIPQKRKGCATNR-DKAVEKFIEIIVNSMEKHIKFDVVKCIILASPGFLKEKLFENLMKISNEKTNKVFQENKGKFLLVHSSTGHKHSLREVLMDPIVQSKTANTKAAGETRALADFFKMLKSDPSRAFYGLKHILHAHQSNAIDKLLISDSLFRCKDYVQRKKYVDIVDSVKDSQGIVKIFSSCHVTGEQLDNLSGIAAILRFPV 1239
            M+++SK ID++  G ITLI EN+EDMW+IYNL +IGD    ST+RKVQ E+STGSV+ K VRT+L+I +ETI++D+ G  + +KG+N+ EN++VK+GAYH+L I + +KF++ K EWD++AL LV Q  D +  AD+A VIM EGLAY+CLITNS T V+ KI+  IP+KR    T + DK V KF + I+ ++E+H++FDVVKC+I+ASPGFLK++ FE L +++ ++  +VF ENKGKF+LVHSS+GHKH+L+E+L DP+V SK  NTKAAGE  AL DF++MLK D SRAFYG+KH+  A  + A++ LLISD+LFR +D  +R+KYV +VD+VK++ G V+IFSS HV+GEQL+ LSGIAAILRFP+
Sbjct:    1 MRILSKSIDRYSSGSITLIAENEEDMWLIYNLVQIGDSFCCSTVRKVQTESSTGSVASKTVRTTLTIEIETIDFDTHGSVLHLKGRNIVENQFVKLGAYHTLQIGIQDKFTVSKQEWDSVALLLVDQAGDPTQQADVATVIMHEGLAYVCLITNSTTVVRAKIESTIPRKRPNLPTAQHDKGVTKFFDQIIQAIERHVRFDVVKCVIVASPGFLKDQFFEYLCQVATKEEKRVFLENKGKFMLVHSSSGHKHALKEILADPMVVSKIVNTKAAGEITALNDFYQMLKVDSSRAFYGIKHVETAVAAFAVETLLISDALFRSRDLSERRKYVSLVDTVKENMGTVRIFSSLHVSGEQLNQLSGIAAILRFPI 371          
BLAST of Protein pelota-like protein vs. TrEMBL
Match: A0A0X3P7L8 (Protein pelota homolog OS=Schistocephalus solidus OX=70667 GN=TR87229 PE=3 SV=1)

HSP 1 Score: 457.988 bits (1177), Expect = 3.745e-156
Identity = 204/371 (54.99%), Postives = 292/371 (78.71%), Query Frame = 1
Query:  130 MKLISKRIDKFRKGKITLIPENDEDMWIIYNLFEIGDIVHSSTLRKVQIEASTGSVSVKQVRTSLSIRVETINYDSDGCQISVKGKNVEENEYVKMGAYHSLNIILNNKFSLMKDEWDTIALELVKQCTDVSNHADLAAVIMQEGLAYICLITNSATTVKHKIDMNIPQKRKGCATNR-DKAVEKFIEIIVNSMEKHIKFDVVKCIILASPGFLKEKLFENLMKISNEKTNKVFQENKGKFLLVHSSTGHKHSLREVLMDPIVQSKTANTKAAGETRALADFFKMLKSDPSRAFYGLKHILHAHQSNAIDKLLISDSLFRCKDYVQRKKYVDIVDSVKDSQGIVKIFSSCHVTGEQLDNLSGIAAILRFPV 1239
            MKL+SK ID++  G ITL+ EN+EDMW+ YNL ++GD    ST+RKVQ E++TGSV+ KQ+R +L++ VETI++D+ G  + +KG+N+EEN+YVKMGAYH+L I + +KF++ K EWD+++L LV+Q  D +  AD+A V+M EGLAY+CL+T+S   V+ KI+  IP+KR    T + DK + +F + I+ ++E+H++FDVVKC+I+ASPGFL+E+ FE L +++ ++  +VF +NK KF+L+HSS+GHKH+L+EVL DP+V SK +NTKAA E  AL DF++MLK D SRAFYG+KH+  A ++ A++ LLISD+LFR KD   RK++V +VDSVK++QG V+IFSS HV+GEQL+ LSGIAAILRFP+
Sbjct:    1 MKLLSKNIDRYASGSITLVAENEEDMWLTYNLVQVGDSFRCSTVRKVQTESATGSVASKQIRMNLTVAVETIDFDTQGSALHLKGRNMEENQYVKMGAYHTLTIGVKDKFTIAKQEWDSVSLMLVEQAADPTQQADVATVVMHEGLAYVCLLTSSTMHVRAKIECTIPRKRPNLPTTQHDKGIARFFDQIIQAIERHVRFDVVKCVIVASPGFLREQFFEYLFQMATKEEKRVFLDNKSKFMLIHSSSGHKHALKEVLSDPLVLSKISNTKAAAEITALNDFYQMLKVDSSRAFYGVKHVEAAVEAFAVETLLISDALFRSKDLTARKRFVGLVDSVKENQGTVRIFSSLHVSGEQLNQLSGIAAILRFPI 371          
BLAST of Protein pelota-like protein vs. Ensembl Cavefish
Match: pelo (pelota mRNA surveillance and ribosome rescue factor [Source:NCBI gene;Acc:103034842])

HSP 1 Score: 424.476 bits (1090), Expect = 9.039e-147
Identity = 194/370 (52.43%), Postives = 276/370 (74.59%), Query Frame = 1
Query:  130 MKLISKRIDKFRKGKITLIPENDEDMWIIYNLFEIGDIVHSSTLRKVQIEASTGSVSVKQVRTSLSIRVETINYDSDGCQISVKGKNVEENEYVKMGAYHSLNIILNNKFSLMKDEWDTIALELVKQCTDVSNHADLAAVIMQEGLAYICLITNSATTVKHKIDMNIPQKRKGCATNRDKAVEKFIEIIVNSMEKHIKFDVVKCIILASPGFLKEKLFENLMKISNEKTNKVFQENKGKFLLVHSSTGHKHSLREVLMDPIVQSKTANTKAAGETRALADFFKMLKSDPSRAFYGLKHILHAHQSNAIDKLLISDSLFRCKDYVQRKKYVDIVDSVKDSQGIVKIFSSCHVTGEQLDNLSGIAAILRFPV 1239
            MKL+ K I+K   G++TLIPE  EDMW  YNL ++GD + +ST+RKVQ E+STGSV   +VRT+L++ VETI++DS  CQ+ VKG N++EN+YVKMGAYH++ + LN KF+L K  WD++ L+ ++Q  D +  AD+AAV+MQEGLA + L+T + T ++ K+++ IP+KR+G     +KA+E+F E ++  + +H  FDVVKCI++ SPGF+K++    L K +  +  KV  EN+ KF+LVHSS+GHK+SL+E+L DP V S+ ++TKAAGE +AL DF+KML+ +P RAFYG+ H+  A ++ AID LLISD LFR +D   R +YV +VD+V+D+ G V+IFSS HV GEQL  LSG+AAILRFP+
Sbjct:    1 MKLLHKDIEKDNAGQVTLIPEEAEDMWHTYNLLQVGDSLRASTIRKVQTESSTGSVGSSRVRTTLTVCVETIDFDSQACQLRVKGTNIQENQYVKMGAYHTIELELNRKFTLAKKVWDSVVLDRIEQACDPAQKADVAAVVMQEGLANLVLVTPAMTLLRAKVEVTIPRKRRGSCAQHEKALERFYEAVMQGILRHFNFDVVKCILVGSPGFVKDQFIAYLFKEAVRQDCKVLLENRPKFMLVHSSSGHKYSLKEILSDPAVTSRLSDTKAAGEVKALEDFYKMLQHEPDRAFYGVAHVEKAAEALAIDILLISDKLFRHQDIATRSRYVRLVDNVRDNGGTVRIFSSLHVFGEQLSQLSGVAAILRFPI 370          
BLAST of Protein pelota-like protein vs. Ensembl Cavefish
Match: pelo (pelota mRNA surveillance and ribosome rescue factor [Source:NCBI gene;Acc:103034842])

HSP 1 Score: 402.519 bits (1033), Expect = 3.561e-138
Identity = 186/370 (50.27%), Postives = 269/370 (72.70%), Query Frame = 1
Query:  130 MKLISKRIDKFRKGKITLIPENDEDMWIIYNLFEIGDIVHSSTLRKVQIEASTGSVSVKQVRTSLSIRVETINYDSDGCQISVKGKNVEENEYVKMGAYHSLNIILNNKFSLMKDEWDTIALELVKQCTDVSNHADLAAVIMQEGLAYICLITNSATTVKHKIDMNIPQKRKGCATNRDKAVEKFIEIIVNSMEKHIKFDVVKCIILASPGFLKEKLFENLMKISNEKTNKVFQENKGKFLLVHSSTGHKHSLREVLMDPIVQSKTANTKAAGETRALADFFKMLKSDPSRAFYGLKHILHAHQSNAIDKLLISDSLFRCKDYVQRKKYVDIVDSVKDSQGIVKIFSSCHVTGEQLDNLSGIAAILRFPV 1239
            MKL+ K I+K   G++TLIPE  EDMW  YNL ++GD + +ST+RKVQ E+STGSV   +VRT+L++ VETI++DS  CQ+ VKG N++EN+YVKMGAYH++ + LN KF+L K  WD++ L+ ++Q  D +  AD+AAV+MQEGLA + L+T + T ++ K+++ IP+KR+G     +KA+E+F E ++  + +H  FDVVKCI++ SPGF+K++    L K +  +  KV  EN+ KF+LVHSS+GHK+SL+E+L DP V S+ ++TKAAGE +AL DF+KML+ +P RAFYG+ H+  A ++ AID LLISD LFR +D   R +YV +VD+V+D+ G     S  H +  +L  LSG+AAILRFP+
Sbjct:    1 MKLLHKDIEKDNAGQVTLIPEEAEDMWHTYNLLQVGDSLRASTIRKVQTESSTGSVGSSRVRTTLTVCVETIDFDSQACQLRVKGTNIQENQYVKMGAYHTIELELNRKFTLAKKVWDSVVLDRIEQACDPAQKADVAAVVMQEGLANLVLVTPAMTLLRAKVEVTIPRKRRGSCAQHEKALERFYEAVMQGILRHFNFDVVKCILVGSPGFVKDQFIAYLFKEAVRQDCKVLLENRPKFMLVHSSSGHKYSLKEILSDPAVTSRLSDTKAAGEVKALEDFYKMLQHEPDRAFYGVAHVEKAAEALAIDILLISDKLFRHQDIATRSRYVRLVDNVRDNGGTADCLSFSHFS--ELSQLSGVAAILRFPI 368          
BLAST of Protein pelota-like protein vs. Ensembl Yeast
Match: DOM34 (Protein that facilitates ribosomal subunit dissociation; Dom34-Hbs1 complex and Rli1p have roles in dissociating inactive ribosomes to facilitate translation restart, particularly ribosomes stalled in 3' UTRs; required for RNA cleavage in no-go decay, but reports conflict on endonuclease activity; Pelota ortholog; protein abundance increases in response to DNA replication stress; DOM34 has a paralog, YCL001W-B, that arose from the whole genome duplication [Source:SGD;Acc:S000004946])

HSP 1 Score: 216.853 bits (551), Expect = 1.124e-66
Identity = 122/380 (32.11%), Postives = 220/380 (57.89%), Query Frame = 1
Query:  130 MKLISKRIDKFRKGK--ITLIPENDEDMWIIYNLFEIGDIV-----HSSTLRKVQIEASTGSVS--VKQVRTSLSIRVETINYDSDGCQISVKGKNVEENEYVKMGAYHSLNIILNNKFSLMKDEWDTIALELVKQCTDVSNHADLAAVIMQEGLAYICLITNSATTVKHKIDMNIPQKRKGCATNR-DKAVEKFIEIIVNSMEKHIKFDVVKCIILASPGFLKEKLFENLMKISNEKTNKVFQENKGKFLLVHSSTGHKHSLREVLMDPIVQSKTANTKAAGETRALADFFKMLKSDPSRAFYGLKHILHAHQSNAIDKLLISDSLFRCKDYVQRKKYVDIVDSVKDSQGIVKIFSSCHVTGEQLDNLSGIAAILRFPV 1239
            MK+IS + D F KG   ITL+PE+ ED++ +Y + +  D +      +S L +   + ST  V   +K +     ++ E + Y      ++V  ++   N  + +G Y S  +     F+++K  ++    +L+ +  ++   +D AAV++QEG+A++CL+T+S+T +K KI+ ++P+K++     + D+  EKF + I ++M+K + FD +K IIL SPGF  + L + + + + E+ NK   +NKG F + H STG+   + EVL +P+  SK  +TK + E   + +F   L  D  +A+YG K ++ A +  AI  LL++D +    +  QR++Y+ ++DSV+ + G   + S+ H  GE+LD L+GIA IL++P+
Sbjct:    1 MKVISLKKDSFNKGGAVITLLPEDKEDLFTVYQIVDKDDELIFKKKFTSKLDEAGKKKSTDLVKLKIKVISEDFDMKDEYLKYKG----VTVTDESGASNVDIPVGKYLSFTLDYVYPFTIIKQNFNKFMQKLLNEACNIEYKSDTAAVVLQEGIAHVCLVTSSSTILKQKIEYSMPKKKRTTDVLKFDEKTEKFYKAIYSAMKKDLNFDKLKTIILCSPGFYAKILMDKIFQYAEEEHNKKILDNKGMFFIAHCSTGYLQGINEVLKNPLYASKLQDTKYSKEIMVMDEFLLHLNKDDDKAWYGEKEVVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDSVESNGGKALVLSTLHSLGEELDQLTGIACILKYPL 376          
BLAST of Protein pelota-like protein vs. Ensembl Yeast
Match: YCL001W-B_mRNA (Putative protein of unknown function; present in a region duplicated between chromosomes XIV and III; YCL001W-B has a paralog, DOM34, that arose from the whole genome duplication [Source:SGD;Acc:S000007596])

HSP 1 Score: 55.4546 bits (132), Expect = 1.816e-10
Identity = 25/81 (30.86%), Postives = 50/81 (61.73%), Query Frame = 1
Query:  961 LADFFKMLKSDPSRAFYGLKHILHAHQSNAIDKLLISDSLFRCKDYVQRKKYVDIVDSVKDSQGIVKIFSSCHVTGEQLDN 1203
            + DF + L  D ++A+YG +    A + +AI+ LLI+DS+ +  D  +R+KY+D++++  ++ G + + S+  +T   L N
Sbjct:    1 MDDFLEHLSKDDNKAWYGAEETERAAKLDAIETLLITDSVLKRNDVKKREKYLDLIENSGNNNGKIFVLSTSKITVSNLTN 81          
BLAST of Protein pelota-like protein vs. Ensembl Nematostella
Match: EDO37683 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF30])

HSP 1 Score: 357.836 bits (917), Expect = 4.495e-121
Identity = 163/372 (43.82%), Postives = 258/372 (69.35%), Query Frame = 1
Query:  130 MKLISKRIDKFRKGKITLIPENDEDMWIIYNLFEIGDIVHSSTLRKVQIEASTGSVSVKQVRTSLSIRVETINYDSDGCQISVKGKNVEENEYVKMGAYHSLNIILNNKFSLMKDEWDTIALELVKQCTDVSNHADLAAVIMQEGLAYICLITNSATTVKHKIDMNIPQKRKGCATNRDKAVEKFIEIIVNSMEKHIKFDVVKCIILASPGFLKEKLFENLMKISNEKTNKVFQENKGKFLLVHSSTGHKHSLREVLMDPIVQSKTANTKAAGETRALADFFKMLKSDPSRAFYGLKHILHAHQSNAIDKLLISDSLFRCKDYVQRKKYVDIVDSVKDSQGIVKIFSSCHVTG--EQLDNLSGIAAILRFPV 1239
            MKL+++ ++K   G IT+IPE  EDMW  YNL  +GD + ++T+R+VQ E++TGS S  +VRT L++ VE +++D+  C + VKG+N EEN+YVKMGAYH++++ LN KF+L+K  WD+IALE V    D + HADLAA+I+ EGL +ICL+T+  T V+ KI++NIP+KRK   +  DK + KF + I+  + +HI FDVVKC+++ SPGF+K++  E + + + +   KV  +NK KFL+VH+S+GHKH+L+E+L DP + S+ A+TKA+ E +AL  F+ ML+++P RA+YG+ H+  A+++  I+ LL++D LF       ++ Y+ + D++  +    +   +  +     +L  LSG+AA LRFP+
Sbjct:    1 MKLVNRNLEKDGSGHITMIPEQAEDMWHAYNLIAVGDRLRATTIRRVQTESATGSTSSSKVRTMLTVAVEAVDFDTQACTLRVKGRNCEENQYVKMGAYHTIDLELNRKFTLVKHFWDSIALERVDMACDPTQHADLAAIILHEGLCHICLVTSCMTIVRAKIEINIPRKRKNFCSQHDKGLLKFYDAIIQGVLRHINFDVVKCVLVGSPGFVKDQFCEYMFQQATKMDWKVILDNKSKFLMVHASSGHKHALKEILSDPAIASRLADTKASSEVKALDTFYNMLQNEPERAYYGINHVEKANEAMGIETLLVTDELFSHFPVATKEDYLLVADTLGVNPSTARGSKNSFLVALPSELGQLSGVAATLRFPM 372          
BLAST of Protein pelota-like protein vs. Ensembl Medaka
Match: pelo (pelota mRNA surveillance and ribosome rescue factor [Source:NCBI gene;Acc:101171202])

HSP 1 Score: 427.943 bits (1099), Expect = 3.298e-148
Identity = 192/370 (51.89%), Postives = 281/370 (75.95%), Query Frame = 1
Query:  130 MKLISKRIDKFRKGKITLIPENDEDMWIIYNLFEIGDIVHSSTLRKVQIEASTGSVSVKQVRTSLSIRVETINYDSDGCQISVKGKNVEENEYVKMGAYHSLNIILNNKFSLMKDEWDTIALELVKQCTDVSNHADLAAVIMQEGLAYICLITNSATTVKHKIDMNIPQKRKGCATNRDKAVEKFIEIIVNSMEKHIKFDVVKCIILASPGFLKEKLFENLMKISNEKTNKVFQENKGKFLLVHSSTGHKHSLREVLMDPIVQSKTANTKAAGETRALADFFKMLKSDPSRAFYGLKHILHAHQSNAIDKLLISDSLFRCKDYVQRKKYVDIVDSVKDSQGIVKIFSSCHVTGEQLDNLSGIAAILRFPV 1239
            MKL+ K I+K   G++TL+PE  EDMW  YNL ++GD + +ST+RKVQ E++TGSV   +VRT+L++ VETI++D+  C++ VKG N+EEN++VKMGAYH++ + LN KF+L K  WD++ L+ ++Q  D S  AD+AAV+MQEGLA I L+T++ T ++ K+++ IP+KRKG  +  +KA+E+F E ++ ++ +HI FDVVKCI++ SPGF+K++    + K +  + NK+  EN+ KF+LVHSS+GHK+SL+E+L DP V S+ ++TKAAGE +AL DF+KML+ +P+RAFYG+ H+  A  + A+D LLISD LFR +D   R +YV +VDSV+D+ G V+IFSS HV+GEQL  L G+AAILRFP+
Sbjct:    1 MKLLQKDIEKDNAGQVTLVPEEAEDMWHTYNLLQVGDSLRASTIRKVQTESATGSVGSSRVRTTLTLCVETIDFDTQACRLRVKGTNLEENQFVKMGAYHTIELELNRKFTLAKKSWDSVVLDRIEQACDPSQKADVAAVVMQEGLANIVLVTSAMTLLRAKVEVTIPRKRKGSCSQHEKALERFYEAVMQAILRHINFDVVKCILVGSPGFVKDQFISYMFKEAVRQDNKLLLENRPKFMLVHSSSGHKYSLKEILCDPTVTSRLSDTKAAGEVKALEDFYKMLQHEPNRAFYGVAHVEKAADALAVDTLLISDKLFRHQDVPTRSRYVRLVDSVRDNGGTVRIFSSLHVSGEQLTQLGGVAAILRFPM 370          
BLAST of Protein pelota-like protein vs. Ensembl Medaka
Match: pelo (pelota mRNA surveillance and ribosome rescue factor [Source:NCBI gene;Acc:101171202])

HSP 1 Score: 384.415 bits (986), Expect = 3.401e-131
Identity = 180/372 (48.39%), Postives = 270/372 (72.58%), Query Frame = 1
Query:  130 MKLISKRIDKFRKGKITLIPENDEDMWIIYNLFEIGDIVHSSTLRKVQIEASTGSVSVKQVRTSLSIRVETINYDSDGCQISVKGKNVEENEYVKMGAYHSLNIILNNKFSLMKDEWDTIALELVKQCTDVSNHADLAAVIMQEGLAYICLITNSATTVKHKIDMNIPQKRKGCATNRDKAVEKFIEIIVNSMEKHIKFDVVKCIILASPGFLKEKLFENLMKISNEKTNKVFQENKGKFLLVHSSTGHKHSLREVLMDPIVQS--KTANTKAAGETRALADFFKMLKSDPSRAFYGLKHILHAHQSNAIDKLLISDSLFRCKDYVQRKKYVDIVDSVKDSQGIVKIFSSCHVTGEQLDNLSGIAAILRFPV 1239
            MKL+ K I+K   G++TL+PE  EDMW  YNL ++GD + +ST+RKVQ E++TGSV   +VRT+L++ VETI++D+  C++ VKG N+EEN++VKMGAYH++ + LN KF+L K  WD++ L+ ++Q  D S  AD+AAV+MQEGLA I L+T++ T ++ K+++ IP+KRKG  +  +KA+E+F E ++ ++ +HI FDVVKCI++ SPGF+K++    + K +  + NK+  EN+ KF+LVHSS+GHK+SL+      +VQ+   T N +AAGE +AL DF+KML+ +P+RAFYG+ H+  A  + A+D LLISD LFR +D   R +YV +VDSV+D+ G +  +  CH+   +L  L G+AAILRFP+
Sbjct:    1 MKLLQKDIEKDNAGQVTLVPEEAEDMWHTYNLLQVGDSLRASTIRKVQTESATGSVGSSRVRTTLTLCVETIDFDTQACRLRVKGTNLEENQFVKMGAYHTIELELNRKFTLAKKSWDSVVLDRIEQACDPSQKADVAAVVMQEGLANIVLVTSAMTLLRAKVEVTIPRKRKGSCSQHEKALERFYEAVMQAILRHINFDVVKCILVGSPGFVKDQFISYMFKEAVRQDNKLLLENRPKFMLVHSSSGHKYSLK------VVQTVFSTCNPQAAGEVKALEDFYKMLQHEPNRAFYGVAHVEKAADALAVDTLLISDKLFRHQDVPTRSRYVRLVDSVRDNGGTLCFY--CHL---ELTQLGGVAAILRFPM 361          
BLAST of Protein pelota-like protein vs. Planmine SMEST
Match: SMESG000037614.1 (SMESG000037614.1)

HSP 1 Score: 607.446 bits (1565), Expect = 0.000e+0
Identity = 294/295 (99.66%), Postives = 295/295 (100.00%), Query Frame = 1
Query:  130 MKLISKRIDKFRKGKITLIPENDEDMWIIYNLFEIGDIVHSSTLRKVQIEASTGSVSVKQVRTSLSIRVETINYDSDGCQISVKGKNVEENEYVKMGAYHSLNIILNNKFSLMKDEWDTIALELVKQCTDVSNHADLAAVIMQEGLAYICLITNSATTVKHKIDMNIPQKRKGCATNRDKAVEKFIEIIVNSMEKHIKFDVVKCIILASPGFLKEKLFENLMKISNEKTNKVFQENKGKFLLVHSSTGHKHSLREVLMDPIVQSKTANTKAAGETRALADFFKMLKSDPSRAFYG 1014
            MKLISKRIDKFRKGKITLIPENDEDMWIIYNLFEIGDIVHSSTLRKVQIEASTGSVSVKQVRTSLSIRVETINYDSDGCQISVKGKNVEENEYVKMGAYHSLNIILNNKFSLMKDEWDTIALELVKQCTDVSNHADLAAVIMQEGLAYICLITNSATTVKHKIDMNIPQKRKGCATNRDKAVEKFIEIIVNSMEKHIKFDVVKC+ILASPGFLKEKLFENLMKISNEKTNKVFQENKGKFLLVHSSTGHKHSLREVLMDPIVQSKTANTKAAGETRALADFFKMLKSDPSRAFYG
Sbjct:    1 MKLISKRIDKFRKGKITLIPENDEDMWIIYNLFEIGDIVHSSTLRKVQIEASTGSVSVKQVRTSLSIRVETINYDSDGCQISVKGKNVEENEYVKMGAYHSLNIILNNKFSLMKDEWDTIALELVKQCTDVSNHADLAAVIMQEGLAYICLITNSATTVKHKIDMNIPQKRKGCATNRDKAVEKFIEIIVNSMEKHIKFDVVKCVILASPGFLKEKLFENLMKISNEKTNKVFQENKGKFLLVHSSTGHKHSLREVLMDPIVQSKTANTKAAGETRALADFFKMLKSDPSRAFYG 295          
BLAST of Protein pelota-like protein vs. Planmine SMEST
Match: SMESG000011932.1 (SMESG000011932.1)

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 267/370 (72.16%), Postives = 324/370 (87.57%), Query Frame = 1
Query:  130 MKLISKRIDKFRKGKITLIPENDEDMWIIYNLFEIGDIVHSSTLRKVQIEASTGSVSVKQVRTSLSIRVETINYDSDGCQISVKGKNVEENEYVKMGAYHSLNIILNNKFSLMKDEWDTIALELVKQCTDVSNHADLAAVIMQEGLAYICLITNSATTVKHKIDMNIPQKRKGCATNRDKAVEKFIEIIVNSMEKHIKFDVVKCIILASPGFLKEKLFENLMKISNEKTNKVFQENKGKFLLVHSSTGHKHSLREVLMDPIVQSKTANTKAAGETRALADFFKMLKSDPSRAFYGLKHILHAHQSNAIDKLLISDSLFRCKDYVQRKKYVDIVDSVKDSQGIVKIFSSCHVTGEQLDNLSGIAAILRFPV 1239
            MKLI K IDK++ GKITL+PENDEDMW+ YNLFE GD + +STLRKV  E++TGSV+ KQ+RT+L+I +E+I+YDS GCQI V+G+NVEENE+VKMGAYHSL+II NNK+SL K EWDTIAL+LV+QCTDV+N ADLAAVIMQEGLAYICLITNSAT V+ KI+MNIPQKRKG  T  DKA+EKFI+ I   +E+HIKFDV+KC+ILASPGFLKEKLF+++ +++  +  K+FQ+N+ KFLLVHSSTGHKHSLREVL DPIVQSK ANTKAAGE R L DF+K LK+DPSRAFYG+KH+L A +SNAI+ LLISDSLFR K++++R+KYV+IVDSVK++QG VKIFSS HV+GEQLD LSGIAAILRFP+
Sbjct:    1 MKLIHKNIDKYKSGKITLVPENDEDMWVTYNLFEQGDRLRASTLRKVMNESTTGSVNAKQIRTNLTIEIESIDYDSQGCQICVRGRNVEENEFVKMGAYHSLSIIANNKYSLYKAEWDTIALDLVEQCTDVANQADLAAVIMQEGLAYICLITNSATFVRSKIEMNIPQKRKGVPTQHDKAIEKFIDQIAQGIERHIKFDVIKCVILASPGFLKEKLFDHIKRLAVVQEKKIFQDNRSKFLLVHSSTGHKHSLREVLSDPIVQSKAANTKAAGEIRILDDFYKSLKTDPSRAFYGIKHVLFAQESNAIETLLISDSLFRSKNHLERRKYVNIVDSVKENQGTVKIFSSSHVSGEQLDALSGIAAILRFPL 370          
BLAST of Protein pelota-like protein vs. Planmine SMEST
Match: SMESG000037611.1 (SMESG000037611.1)

HSP 1 Score: 169.088 bits (427), Expect = 2.658e-51
Identity = 105/105 (100.00%), Postives = 105/105 (100.00%), Query Frame = 1
Query: 1015 LKHILHAHQSNAIDKLLISDSLFRCKDYVQRKKYVDIVDSVKDSQGIVKIFSSCHVTGEQLDNLSGIAAILRFPVXXXXXXXXXXXXXXXXXXXFYERLSKPKKI 1329
            LKHILHAHQSNAIDKLLISDSLFRCKDYVQRKKYVDIVDSVKDSQGIVKIFSSCHVTGEQLDNLSGIAAILRFPVDEPESDDDSDDTDSEVDYDFYERLSKPKKI
Sbjct:    3 LKHILHAHQSNAIDKLLISDSLFRCKDYVQRKKYVDIVDSVKDSQGIVKIFSSCHVTGEQLDNLSGIAAILRFPVDEPESDDDSDDTDSEVDYDFYERLSKPKKI 107          
The following BLAST results are available for this feature:
BLAST of Protein pelota-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
PELO2.021e-15354.05pelota mRNA surveillance and ribosome rescue facto... [more]
back to top
BLAST of Protein pelota-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pelo-14.119e-11446.76pep chromosome:WBcel235:III:4202253:4204269:-1 gen... [more]
back to top
BLAST of Protein pelota-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pelo4.148e-15152.97gene:FBgn0011207 transcript:FBtr0079847[more]
back to top
BLAST of Protein pelota-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pelo5.876e-14952.97pelota mRNA surveillance and ribosome rescue facto... [more]
pelo7.244e-6350.56pelota mRNA surveillance and ribosome rescue facto... [more]
back to top
BLAST of Protein pelota-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pelo2.076e-10452.71pelota homolog [Source:NCBI gene;Acc:448078][more]
pelo3.258e-5749.15pelota homolog [Source:NCBI gene;Acc:448078][more]
back to top
BLAST of Protein pelota-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Pelo6.040e-15252.97pelota mRNA surveillance and ribosome rescue facto... [more]
back to top
BLAST of Protein pelota-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BRX2|PELO_HUMAN9.707e-15354.05Protein pelota homolog OS=Homo sapiens OX=9606 GN=... [more]
sp|Q58DV0|PELO_BOVIN1.059e-15254.05Protein pelota homolog OS=Bos taurus OX=9913 GN=PE... [more]
sp|Q5RCE3|PELO_PONAB1.317e-15254.05Protein pelota homolog OS=Pongo abelii OX=9601 GN=... [more]
sp|Q5XIP1|PELO_RAT1.638e-15253.78Protein pelota homolog OS=Rattus norvegicus OX=101... [more]
sp|Q5ZK01|PELO_CHICK2.531e-15152.70Protein pelota homolog OS=Gallus gallus OX=9031 GN... [more]
back to top
BLAST of Protein pelota-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7Y4893.443e-16257.68Protein pelota homolog OS=Clonorchis sinensis OX=7... [more]
A0A074ZJI89.286e-15957.99eRF1_1 domain-containing protein OS=Opisthorchis v... [more]
A0A3R7DP811.662e-15857.68Protein pelota-like protein OS=Clonorchis sinensis... [more]
A0A5K3EHK01.488e-15757.14Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0X3P7L83.745e-15654.99Protein pelota homolog OS=Schistocephalus solidus ... [more]
back to top
BLAST of Protein pelota-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pelo9.039e-14752.43pelota mRNA surveillance and ribosome rescue facto... [more]
pelo3.561e-13850.27pelota mRNA surveillance and ribosome rescue facto... [more]
back to top
BLAST of Protein pelota-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein pelota-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
DOM341.124e-6632.11Protein that facilitates ribosomal subunit dissoci... [more]
YCL001W-B_mRNA1.816e-1030.86Putative protein of unknown function; present in a... [more]
back to top
BLAST of Protein pelota-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO376834.495e-12143.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein pelota-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pelo3.298e-14851.89pelota mRNA surveillance and ribosome rescue facto... [more]
pelo3.401e-13148.39pelota mRNA surveillance and ribosome rescue facto... [more]
back to top
BLAST of Protein pelota-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000037614.10.000e+099.66SMESG000037614.1[more]
SMESG000011932.10.000e+072.16SMESG000011932.1[more]
SMESG000037611.12.658e-51100.00SMESG000037611.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022849 ID=SMED30022849|Name=Protein pelota-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1361bp
AACCATTTGTTTTAAATATTTTATAAACTTTCTCTTTGCTTATTGAATAC
ATTTTTTGACCGAATTTGTAATTTAATACAAATAAAAAAGATTAACTAAA
TTTTGGAAAATTAACATTTATATTTTGCAATGAAGTTGATTTCCAAGCGA
ATAGATAAGTTTAGGAAAGGGAAAATTACCCTCATTCCTGAAAATGACGA
AGATATGTGGATAATTTATAACTTATTTGAAATTGGCGATATTGTTCATT
CTTCAACACTTAGGAAAGTTCAAATTGAAGCATCAACTGGTTCAGTATCA
GTTAAACAAGTTCGAACATCTTTAAGCATTCGAGTGGAAACTATAAATTA
TGATTCTGATGGTTGTCAAATAAGTGTCAAAGGTAAAAATGTTGAGGAAA
ATGAATACGTGAAAATGGGTGCCTATCACAGTTTGAATATAATACTTAAT
AATAAGTTTTCATTGATGAAAGACGAATGGGACACTATAGCATTAGAACT
TGTTAAACAATGTACCGATGTTTCGAATCACGCTGATCTCGCTGCGGTTA
TAATGCAAGAAGGTCTGGCTTATATTTGTTTGATTACGAACTCGGCAACA
ACTGTCAAACATAAAATCGATATGAATATCCCTCAGAAACGAAAGGGCTG
TGCAACTAATCGTGATAAAGCTGTCGAAAAATTTATTGAAATAATCGTAA
ATTCAATGGAAAAACACATAAAGTTTGATGTGGTAAAATGTATCATTCTC
GCCAGTCCGGGATTTCTCAAGGAGAAACTTTTTGAAAATTTAATGAAAAT
ATCGAATGAGAAAACCAATAAAGTATTTCAAGAAAATAAAGGAAAATTTC
TATTAGTCCATTCAAGTACTGGGCACAAGCATTCATTGCGGGAGGTTTTA
ATGGATCCGATTGTACAGAGCAAAACTGCGAATACAAAGGCGGCTGGTGA
GACGAGAGCTCTAGCCGACTTCTTTAAAATGCTCAAATCCGATCCTAGTC
GAGCATTTTATGGACTGAAGCACATTTTGCACGCCCACCAATCAAATGCA
ATCGATAAGCTGCTGATCAGTGACTCCCTTTTTCGGTGCAAGGATTATGT
CCAGAGGAAAAAATATGTCGATATTGTCGATTCCGTGAAAGACAGTCAAG
GAATAGTGAAAATATTTTCCAGTTGTCATGTTACTGGTGAACAATTGGAT
AATCTGTCTGGAATAGCTGCAATATTGAGATTTCCCGTGGACGAGCCGGA
GTCAGATGATGACAGCGATGACACAGATTCTGAAGTTGATTATGATTTTT
ATGAACGTCTTTCAAAACCTAAGAAAATATAAATACATTTTCTTTTTTTG
TTAAAAAAAAA
back to top

protein sequence of SMED30022849-orf-1

>SMED30022849-orf-1 ID=SMED30022849-orf-1|Name=SMED30022849-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=401bp
MKLISKRIDKFRKGKITLIPENDEDMWIIYNLFEIGDIVHSSTLRKVQIE
ASTGSVSVKQVRTSLSIRVETINYDSDGCQISVKGKNVEENEYVKMGAYH
SLNIILNNKFSLMKDEWDTIALELVKQCTDVSNHADLAAVIMQEGLAYIC
LITNSATTVKHKIDMNIPQKRKGCATNRDKAVEKFIEIIVNSMEKHIKFD
VVKCIILASPGFLKEKLFENLMKISNEKTNKVFQENKGKFLLVHSSTGHK
HSLREVLMDPIVQSKTANTKAAGETRALADFFKMLKSDPSRAFYGLKHIL
HAHQSNAIDKLLISDSLFRCKDYVQRKKYVDIVDSVKDSQGIVKIFSSCH
VTGEQLDNLSGIAAILRFPVDEPESDDDSDDTDSEVDYDFYERLSKPKKI
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR038069Pelota/DOM34_N
IPR042226eFR1_2_sf
IPR004405Transl-rel_pelota
IPR005140eRF1_1_Pelota
IPR005141eRF1_2
IPR029064L30e-like
IPR005142eRF1_3
Vocabulary: biological process
TermDefinition
GO:0071025RNA surveillance
GO:0090305nucleic acid phosphodiester bond hydrolysis
GO:0070481nuclear-transcribed mRNA catabolic process, non-stop decay
GO:0070966nuclear-transcribed mRNA catabolic process, no-go decay
Vocabulary: molecular function
TermDefinition
GO:0004518nuclease activity
GO:0004519endonuclease activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005140eRF1 domain 1/Pelota-likeSMARTSM01194eRF1_1_2coord: 1..130
e-value: 3.1E-47
score: 172.9
IPR005140eRF1 domain 1/Pelota-likePFAMPF03463eRF1_1coord: 1..128
e-value: 4.8E-41
score: 139.8
IPR038069Pelota/DOM34, N-terminal domainGENE3DG3DSA:2.30.30.870coord: 1..132
e-value: 2.0E-43
score: 149.2
IPR038069Pelota/DOM34, N-terminal domainSUPERFAMILYSSF159065Dom34/Pelota N-terminal domain-likecoord: 1..130
IPR042226eRF1, domain 2 superfamilyGENE3DG3DSA:3.30.420.60coord: 135..266
e-value: 3.9E-47
score: 161.7
IPR02906450S ribosomal protein L30e-likeGENE3DG3DSA:3.30.1330.30coord: 267..385
e-value: 4.9E-43
score: 147.8
IPR02906450S ribosomal protein L30e-likeSUPERFAMILYSSF55315L30e-likecoord: 262..371
IPR005142eRF1 domain 3PFAMPF03465eRF1_3coord: 272..370
e-value: 8.3E-23
score: 81.0
IPR004405Translation release factor pelotaTIGRFAMTIGR00111TIGR00111coord: 9..370
e-value: 3.0E-76
score: 255.0
IPR004405Translation release factor pelotaPANTHERPTHR10853PELOTAcoord: 1..375
IPR005141eRF1 domain 2PFAMPF03464eRF1_2coord: 137..265
e-value: 2.5E-29
score: 102.3
NoneNo IPR availablePANTHERPTHR10853:SF0PROTEIN PELOTA HOMOLOGcoord: 1..375
NoneNo IPR availableSUPERFAMILYSSF53137Translational machinery componentscoord: 132..271