Synaptotagmin VIa

Overview
NameSynaptotagmin VIa
Smed IDSMED30022848
Length (bp)1451
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Synaptotagmin VIa (SMED30022848) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Synaptotagmin VIa (SMED30022848) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022848

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30022848SMESG000043595.1 dd_Smed_v4_12716_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022848SMESG000043595.1 dd_Smed_v4_12716_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30022848SMESG000043595.1 dd_Smed_v4_12716_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Synaptotagmin VIa vs. Ensembl Human
Match: SYT9 (synaptotagmin 9 [Source:HGNC Symbol;Acc:HGNC:19265])

HSP 1 Score: 75.8702 bits (185), Expect = 1.910e-14
Identity = 39/110 (35.45%), Postives = 67/110 (60.91%), Query Frame = 3
Query:  264 QGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYD 593
            +  G ++F+L+Y+   + L V I +  NL  KD  GTSDPY  I   P  +    ++T+V  KTLNPV++ VF+ F   + +L+  ++H ++YD+D++  H+ +G+V  D
Sbjct:  187 KACGKLNFILKYDCDLEQLIVKIHKAVNLPAKDFSGTSDPYVKIYLLPDRKTK--HQTKVHRKTLNPVFDEVFL-FPVPYNDLEARKLHFSVYDFDRFSRHDLIGQVVVD 293          
BLAST of Synaptotagmin VIa vs. Ensembl Human
Match: RPH3A (rabphilin 3A [Source:HGNC Symbol;Acc:HGNC:17056])

HSP 1 Score: 77.0258 bits (188), Expect = 3.172e-14
Identity = 37/112 (33.04%), Postives = 57/112 (50.89%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
            LG + F L Y+    +L+  I + K L   D  G +DPY  +   P        +T+    T NP+WN   V+   T E++ R  + I++ D DK+G +E +GE  + LKKL
Sbjct:  393 LGALEFSLLYDQDNSSLQCTIIKAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPIWNETLVYHGITDEDMQRKTLRISVCDEDKFGHNEFIGETRFSLKKL 504          

HSP 2 Score: 57.3806 bits (137), Expect = 3.984e-8
Identity = 31/93 (33.33%), Postives = 48/93 (51.61%), Query Frame = 3
Query:  273 GLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWD 551
            G I   L Y  Q   L V I +  +L   D  G SDP+  +   P       +KT++K KTLNP +N  F F++  H +L +  + I+++D+D
Sbjct:  552 GKILVSLMYSTQQGGLIVGIIRCVHLAAMDANGYSDPFVKLWLKPDMGKKAKHKTQIKKKTLNPEFNEEF-FYDIKHSDLAKKSLDISVWDYD 643          
BLAST of Synaptotagmin VIa vs. Ensembl Human
Match: RPH3A (rabphilin 3A [Source:HGNC Symbol;Acc:HGNC:17056])

HSP 1 Score: 77.0258 bits (188), Expect = 3.172e-14
Identity = 37/112 (33.04%), Postives = 57/112 (50.89%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
            LG + F L Y+    +L+  I + K L   D  G +DPY  +   P        +T+    T NP+WN   V+   T E++ R  + I++ D DK+G +E +GE  + LKKL
Sbjct:  393 LGALEFSLLYDQDNSSLQCTIIKAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPIWNETLVYHGITDEDMQRKTLRISVCDEDKFGHNEFIGETRFSLKKL 504          

HSP 2 Score: 57.3806 bits (137), Expect = 3.984e-8
Identity = 31/93 (33.33%), Postives = 48/93 (51.61%), Query Frame = 3
Query:  273 GLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWD 551
            G I   L Y  Q   L V I +  +L   D  G SDP+  +   P       +KT++K KTLNP +N  F F++  H +L +  + I+++D+D
Sbjct:  552 GKILVSLMYSTQQGGLIVGIIRCVHLAAMDANGYSDPFVKLWLKPDMGKKAKHKTQIKKKTLNPEFNEEF-FYDIKHSDLAKKSLDISVWDYD 643          
BLAST of Synaptotagmin VIa vs. Ensembl Human
Match: RPH3A (rabphilin 3A [Source:HGNC Symbol;Acc:HGNC:17056])

HSP 1 Score: 77.0258 bits (188), Expect = 3.172e-14
Identity = 37/112 (33.04%), Postives = 57/112 (50.89%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
            LG + F L Y+    +L+  I + K L   D  G +DPY  +   P        +T+    T NP+WN   V+   T E++ R  + I++ D DK+G +E +GE  + LKKL
Sbjct:  393 LGALEFSLLYDQDNSSLQCTIIKAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPIWNETLVYHGITDEDMQRKTLRISVCDEDKFGHNEFIGETRFSLKKL 504          

HSP 2 Score: 57.3806 bits (137), Expect = 3.984e-8
Identity = 31/93 (33.33%), Postives = 48/93 (51.61%), Query Frame = 3
Query:  273 GLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWD 551
            G I   L Y  Q   L V I +  +L   D  G SDP+  +   P       +KT++K KTLNP +N  F F++  H +L +  + I+++D+D
Sbjct:  552 GKILVSLMYSTQQGGLIVGIIRCVHLAAMDANGYSDPFVKLWLKPDMGKKAKHKTQIKKKTLNPEFNEEF-FYDIKHSDLAKKSLDISVWDYD 643          
BLAST of Synaptotagmin VIa vs. Ensembl Human
Match: RPH3A (rabphilin 3A [Source:HGNC Symbol;Acc:HGNC:17056])

HSP 1 Score: 76.6406 bits (187), Expect = 3.734e-14
Identity = 37/112 (33.04%), Postives = 57/112 (50.89%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
            LG + F L Y+    +L+  I + K L   D  G +DPY  +   P        +T+    T NP+WN   V+   T E++ R  + I++ D DK+G +E +GE  + LKKL
Sbjct:  389 LGALEFSLLYDQDNSSLQCTIIKAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPIWNETLVYHGITDEDMQRKTLRISVCDEDKFGHNEFIGETRFSLKKL 500          

HSP 2 Score: 57.3806 bits (137), Expect = 4.372e-8
Identity = 31/93 (33.33%), Postives = 48/93 (51.61%), Query Frame = 3
Query:  273 GLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWD 551
            G I   L Y  Q   L V I +  +L   D  G SDP+  +   P       +KT++K KTLNP +N  F F++  H +L +  + I+++D+D
Sbjct:  548 GKILVSLMYSTQQGGLIVGIIRCVHLAAMDANGYSDPFVKLWLKPDMGKKAKHKTQIKKKTLNPEFNEEF-FYDIKHSDLAKKSLDISVWDYD 639          
BLAST of Synaptotagmin VIa vs. Ensembl Celegans
Match: snt-1 (Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:P34693])

HSP 1 Score: 65.4698 bits (158), Expect = 3.078e-11
Identity = 39/112 (34.82%), Postives = 60/112 (53.57%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
            LG I + L Y+ Q   L V + Q ++L G D  GTSDPY  +   P  +     +T+V  KTLNPV+N  F+ F     E+    +   +YD+D++  H+ +G+V   L K+
Sbjct:  160 LGRIQYKLDYDFQQGQLTVTVIQAEDLPGMDMSGTSDPYVKLYLLPEKKK--KVETKVHRKTLNPVFNETFI-FKVAFNEITAKTLVFAIYDFDRFSKHDQIGQVLIPLGKI 268          

HSP 2 Score: 55.0694 bits (131), Expect = 6.054e-8
Identity = 40/112 (35.71%), Postives = 55/112 (49.11%), Query Frame = 3
Query:  249 DPGIDQGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEV 584
            D   ++ LG I F LRY      L V I + KNL   D  G SDPY  I      +     KT +K  TLNP +N  F  F    E++ +  + IT+ D+DK G ++A+G  
Sbjct:  286 DKEAEKSLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIVLMQGGKRLKKKKTSIKKCTLNPYYNESFS-FEVPFEQIQKVSLMITVMDYDKLGSNDAIGRC 396          
BLAST of Synaptotagmin VIa vs. Ensembl Celegans
Match: snt-1 (Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:P34693])

HSP 1 Score: 65.0846 bits (157), Expect = 4.072e-11
Identity = 39/112 (34.82%), Postives = 60/112 (53.57%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
            LG I + L Y+ Q   L V + Q ++L G D  GTSDPY  +   P  +     +T+V  KTLNPV+N  F+ F     E+    +   +YD+D++  H+ +G+V   L K+
Sbjct:  160 LGRIQYKLDYDFQQGQLTVTVIQAEDLPGMDMSGTSDPYVKLYLLPEKKK--KVETKVHRKTLNPVFNETFI-FKVAFNEITAKTLVFAIYDFDRFSKHDQIGQVLIPLGKI 268          

HSP 2 Score: 55.4546 bits (132), Expect = 4.392e-8
Identity = 42/116 (36.21%), Postives = 59/116 (50.86%), Query Frame = 3
Query:  249 DPGIDQGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDD----WLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEV 584
            D   ++ LG I F LRY      L V I + KNL   D  G SDPY  ++    F +D       KT +K KTLNP +N  FVF      ++ +  + IT+ D+DK G ++A+G  
Sbjct:  286 DKEAEKSLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKLEM---FGEDRKRLKKKKTNIKRKTLNPYFNESFVFDKLPLHKMKKVSLMITVMDYDKLGSNDAIGRC 398          

HSP 3 Score: 49.2914 bits (116), Expect = 4.375e-6
Identity = 47/161 (29.19%), Postives = 74/161 (45.96%), Query Frame = 3
Query:  945 IEIKKNLQALPNSRSA---YGEILVSLDYVIRNRTLNVKIIKARNMIDPTKRALV-PYCVLRHLFIGNDREKTKSIHRTSYRFYTDTPVWNEEFPL-KVPPKKLKQTAVEIQVFHSTSESKPKDDELGLIRLGLKTYPAQKAHYIEFLGNIGKPIENWHLI 1412
            IE  K++   P+ + A    G+I  SL YV     L V I++A+N+       L  PY  L     G DR++ K       R  T  P +NE F   K+P  K+K+ ++ I V     +    +D +G   LG     A+  H+++ L +  +PI  WH +
Sbjct:  274 IEEWKDIAPPPDDKEAEKSLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKLE--MFGEDRKRLKKKKTNIKR-KTLNPYFNESFVFDKLPLHKMKKVSLMITVMDY--DKLGSNDAIGRCLLGCNGTGAELRHWMDMLASPRRPIAQWHTL 429          
BLAST of Synaptotagmin VIa vs. Ensembl Celegans
Match: snt-3 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5])

HSP 1 Score: 62.3882 bits (150), Expect = 1.303e-10
Identity = 35/112 (31.25%), Postives = 60/112 (53.57%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
            LG + + L Y+    +L V I Q + L   D  GTSDPY  +   P  +     +T+V+ K+LNPV+N  F  F     E+    + + ++D+D++G H+ +G++   L K+
Sbjct:   16 LGRLQYKLDYDFDKNSLTVVIIQAEELPAMDLGGTSDPYVKLFLLPDKKKKL--QTKVQRKSLNPVFNESFT-FKIPFNEIGGQTLVLNVFDFDRFGKHDQIGQISIPLGKV 124          

HSP 2 Score: 55.4546 bits (132), Expect = 2.561e-8
Identity = 40/105 (38.10%), Postives = 57/105 (54.29%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEV 584
            LG +   LRY      L V + + KNL   D  G SDPY  I      +     KT +KMKTLNP +N  F F + T E++ R  +H+T+ D+D+ G +E +G+V
Sbjct:  144 LGEVCLALRYVPNKNKLSVVVMECKNLKKMDVLGLSDPYVKIYLMMGTKRLEKKKTTIKMKTLNPYYNESFSF-DVTSEKMQRVHLHVTVSDYDRVGSNERIGQV 247          
BLAST of Synaptotagmin VIa vs. Ensembl Celegans
Match: snt-3 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5])

HSP 1 Score: 62.3882 bits (150), Expect = 1.303e-10
Identity = 35/112 (31.25%), Postives = 60/112 (53.57%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
            LG + + L Y+    +L V I Q + L   D  GTSDPY  +   P  +     +T+V+ K+LNPV+N  F  F     E+    + + ++D+D++G H+ +G++   L K+
Sbjct:   16 LGRLQYKLDYDFDKNSLTVVIIQAEELPAMDLGGTSDPYVKLFLLPDKKKKL--QTKVQRKSLNPVFNESFT-FKIPFNEIGGQTLVLNVFDFDRFGKHDQIGQISIPLGKV 124          

HSP 2 Score: 55.4546 bits (132), Expect = 2.561e-8
Identity = 40/105 (38.10%), Postives = 57/105 (54.29%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEV 584
            LG +   LRY      L V + + KNL   D  G SDPY  I      +     KT +KMKTLNP +N  F F + T E++ R  +H+T+ D+D+ G +E +G+V
Sbjct:  144 LGEVCLALRYVPNKNKLSVVVMECKNLKKMDVLGLSDPYVKIYLMMGTKRLEKKKTTIKMKTLNPYYNESFSF-DVTSEKMQRVHLHVTVSDYDRVGSNERIGQV 247          
BLAST of Synaptotagmin VIa vs. Ensembl Celegans
Match: rbf-1 (Rabphilin-1 [Source:UniProtKB/Swiss-Prot;Acc:P41885])

HSP 1 Score: 63.929 bits (154), Expect = 1.844e-10
Identity = 42/128 (32.81%), Postives = 63/128 (49.22%), Query Frame = 3
Query:  249 DPGIDQGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKLHGKDHEEKE 632
            +PG    LG I   L Y    K LK+++ + KNL   D  G SDPY      P         ++   KTLNP WN    ++  T ++ ++  + +T+ D D+ G  + LGE    LKKL+  D+E K+
Sbjct:  746 EPG---SLGSITLTLTYHSADKKLKMHLIRAKNLKAMDSNGFSDPYVKFHLLPGNTKATKLTSKTIEKTLNPEWNEEMSYYGITEDDKEKKILRVTVLDRDRIGS-DFLGETRIALKKLN--DNEMKK 867          

HSP 2 Score: 59.6918 bits (143), Expect = 3.599e-9
Identity = 35/99 (35.35%), Postives = 49/99 (49.49%), Query Frame = 3
Query:  273 GLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHE 569
            G I+  L+Y +Q  +L +NI +   LVG D  G SDPY  +   P        KT  K +TLNP WN    F     ++L +  + I +YD D  G H+
Sbjct:  891 GKINVGLQYNIQQGSLFININRCVELVGMDSTGFSDPYCKVSLTPITSKAHRAKTSTKKRTLNPEWNEQLQFV-VPFKDLPKKTLQIGVYDHD-LGKHD 987          
BLAST of Synaptotagmin VIa vs. Ensembl Fly
Match: Syt7 (gene:FBgn0039900 transcript:FBtr0305658)

HSP 1 Score: 85.1149 bits (209), Expect = 1.026e-17
Identity = 43/121 (35.54%), Postives = 70/121 (57.85%), Query Frame = 3
Query:  243 NIDPGIDQGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
            + DP   + +G IHF L Y+ Q  TL + + QGK L  KD  GTSDPY  +   P  +     +T++K +TLNP WN  F F  F  ++L    +H+ ++D+D++   +++GEV+  L ++
Sbjct:  141 STDP--SENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLSGTSDPYVRVTLLPDKKHR--LETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDRFSRDDSIGEVFLPLCQV 257          
BLAST of Synaptotagmin VIa vs. Ensembl Fly
Match: Syt7 (gene:FBgn0039900 transcript:FBtr0089139)

HSP 1 Score: 83.5741 bits (205), Expect = 1.242e-17
Identity = 43/121 (35.54%), Postives = 70/121 (57.85%), Query Frame = 3
Query:  243 NIDPGIDQGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
            + DP   + +G IHF L Y+ Q  TL + + QGK L  KD  GTSDPY  +   P  +     +T++K +TLNP WN  F F  F  ++L    +H+ ++D+D++   +++GEV+  L ++
Sbjct:    8 STDPS--ENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLSGTSDPYVRVTLLPDKKHR--LETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDRFSRDDSIGEVFLPLCQV 124          
BLAST of Synaptotagmin VIa vs. Ensembl Fly
Match: Syt7 (gene:FBgn0039900 transcript:FBtr0089134)

HSP 1 Score: 84.3445 bits (207), Expect = 1.389e-17
Identity = 43/121 (35.54%), Postives = 70/121 (57.85%), Query Frame = 3
Query:  243 NIDPGIDQGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
            + DP   + +G IHF L Y+ Q  TL + + QGK L  KD  GTSDPY  +   P  +     +T++K +TLNP WN  F F  F  ++L    +H+ ++D+D++   +++GEV+  L ++
Sbjct:  141 STDP--SENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLSGTSDPYVRVTLLPDKKHR--LETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDRFSRDDSIGEVFLPLCQV 257          
BLAST of Synaptotagmin VIa vs. Ensembl Fly
Match: Syt7 (gene:FBgn0039900 transcript:FBtr0343990)

HSP 1 Score: 84.7297 bits (208), Expect = 2.438e-17
Identity = 41/115 (35.65%), Postives = 67/115 (58.26%), Query Frame = 3
Query:  261 DQGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
             + +G IHF L Y+ Q  TL + + QGK L  KD  GTSDPY  +   P  +     +T++K +TLNP WN  F F  F  ++L    +H+ ++D+D++   +++GEV+  L ++
Sbjct:  145 SENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLSGTSDPYVRVTLLPDKKHR--LETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDRFSRDDSIGEVFLPLCQV 257          

HSP 2 Score: 49.2914 bits (116), Expect = 5.592e-6
Identity = 35/118 (29.66%), Postives = 55/118 (46.61%), Query Frame = 3
Query:  291 LRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWL--YKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKLHGKDHEEKEED 638
            L Y      L + + + +NL  KD  G SDPY  +K   +F D  +   KT +   TLNPV+N  F  FN   E++    + + + D+D  G +E +G +    K   G    +  +D
Sbjct:  284 LCYHPSNSILTLTLIKARNLKAKDINGKSDPY--VKVWLQFGDKRVEKRKTPIFTCTLNPVFNESFS-FNVPWEKIRECSLDVMVMDFDNIGRNELIGRILLAGKNGSGASETKHWQD 398          
BLAST of Synaptotagmin VIa vs. Ensembl Fly
Match: Syt7 (gene:FBgn0039900 transcript:FBtr0089137)

HSP 1 Score: 84.7297 bits (208), Expect = 2.438e-17
Identity = 41/115 (35.65%), Postives = 67/115 (58.26%), Query Frame = 3
Query:  261 DQGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
             + +G IHF L Y+ Q  TL + + QGK L  KD  GTSDPY  +   P  +     +T++K +TLNP WN  F F  F  ++L    +H+ ++D+D++   +++GEV+  L ++
Sbjct:  145 SENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLSGTSDPYVRVTLLPDKKHR--LETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDRFSRDDSIGEVFLPLCQV 257          

HSP 2 Score: 49.2914 bits (116), Expect = 5.592e-6
Identity = 35/118 (29.66%), Postives = 55/118 (46.61%), Query Frame = 3
Query:  291 LRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWL--YKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKLHGKDHEEKEED 638
            L Y      L + + + +NL  KD  G SDPY  +K   +F D  +   KT +   TLNPV+N  F  FN   E++    + + + D+D  G +E +G +    K   G    +  +D
Sbjct:  284 LCYHPSNSILTLTLIKARNLKAKDINGKSDPY--VKVWLQFGDKRVEKRKTPIFTCTLNPVFNESFS-FNVPWEKIRECSLDVMVMDFDNIGRNELIGRILLAGKNGSGASETKHWQD 398          
BLAST of Synaptotagmin VIa vs. Ensembl Zebrafish
Match: syt7a (synaptotagmin VIIa [Source:ZFIN;Acc:ZDB-GENE-090601-5])

HSP 1 Score: 79.7221 bits (195), Expect = 2.359e-15
Identity = 42/116 (36.21%), Postives = 66/116 (56.90%), Query Frame = 3
Query:  258 IDQGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
            + + LG I F L Y  Q  TL V I +G++L  KD  GTSDP+  I   P  +     +T+VK K LNP WN  F+F  F +E++    +++ + D+D++  ++ +GEV   L K+
Sbjct:  336 VSEKLGRIQFSLGYSFQDTTLTVKILKGQDLPAKDFSGTSDPFVKIYLLPDRKHK--LETKVKRKNLNPHWNETFLFEGFPYEKVRERTLYLQVLDYDRFSRNDPIGEVSIPLNKV 449          

HSP 2 Score: 60.077 bits (144), Expect = 3.458e-9
Identity = 47/157 (29.94%), Postives = 75/157 (47.77%), Query Frame = 3
Query:  957 KNLQALPNSRSAYGEILVSLDYVIRNRTLNVKIIKARNM----IDPTKRALVPYCVLRHLFIGNDREKTKSIHRTSYRFYTDTPVWNEEFPLKVPPKKLKQTAVEIQVFHSTSESKPKDDELGLIRLGLKTYPAQKAHYIEFLGNIGKPIENWHLIR 1415
            K+L+   +   + G++LVSL Y     T+ V IIKARN+    I  T    V   ++ H     +++KT +I R         PV+NE FP  VP   L++T + I V      S  ++D +G I L  K+ P +  H+ + L      +  WH ++
Sbjct:  459 KDLKPCSDGSGSRGDLLVSLCYNPTANTITVNIIKARNLKAMDIGGTSDPYVKVWLM-HKDKRVEKKKTVTIKRCL------NPVFNESFPFDVPAHVLRETTIIITVMDKDRLS--RNDVIGKIYLSWKSGPGEVKHWKDMLSRPRTNVAQWHALK 606          
BLAST of Synaptotagmin VIa vs. Ensembl Zebrafish
Match: syt7a (synaptotagmin VIIa [Source:ZFIN;Acc:ZDB-GENE-090601-5])

HSP 1 Score: 77.7962 bits (190), Expect = 4.846e-15
Identity = 42/116 (36.21%), Postives = 66/116 (56.90%), Query Frame = 3
Query:  258 IDQGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
            + + LG I F L Y  Q  TL V I +G++L  KD  GTSDP+  I   P  +     +T+VK K LNP WN  F+F  F +E++    +++ + D+D++  ++ +GEV   L K+
Sbjct:  110 VSEKLGRIQFSLGYSFQDTTLTVKILKGQDLPAKDFSGTSDPFVKIYLLPDRKHK--LETKVKRKNLNPHWNETFLFEGFPYEKVRERTLYLQVLDYDRFSRNDPIGEVSIPLNKV 223          

HSP 2 Score: 60.4622 bits (145), Expect = 1.652e-9
Identity = 47/157 (29.94%), Postives = 75/157 (47.77%), Query Frame = 3
Query:  957 KNLQALPNSRSAYGEILVSLDYVIRNRTLNVKIIKARNM----IDPTKRALVPYCVLRHLFIGNDREKTKSIHRTSYRFYTDTPVWNEEFPLKVPPKKLKQTAVEIQVFHSTSESKPKDDELGLIRLGLKTYPAQKAHYIEFLGNIGKPIENWHLIR 1415
            K+L+   +   + G++LVSL Y     T+ V IIKARN+    I  T    V   ++ H     +++KT +I R         PV+NE FP  VP   L++T + I V      S  ++D +G I L  K+ P +  H+ + L      +  WH ++
Sbjct:  233 KDLKPCSDGSGSRGDLLVSLCYNPTANTITVNIIKARNLKAMDIGGTSDPYVKVWLM-HKDKRVEKKKTVTIKRCL------NPVFNESFPFDVPAHVLRETTIIITVMDKDRLS--RNDVIGKIYLSWKSGPGEVKHWKDMLSRPRTNVAQWHALK 380          
BLAST of Synaptotagmin VIa vs. Ensembl Zebrafish
Match: syt9a (synaptotagmin IXa [Source:ZFIN;Acc:ZDB-GENE-031002-18])

HSP 1 Score: 78.1814 bits (191), Expect = 6.648e-15
Identity = 39/109 (35.78%), Postives = 65/109 (59.63%), Query Frame = 3
Query:  267 GLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYD 593
              G +HF+L+Y+   + L V I + ++L  KD  GTSDPY  I   P  +    ++T+V  KTLNPV++ VF  F   + +L   ++H ++YD+D++  H+ +G+V  D
Sbjct:  256 SCGRLHFILKYDCDLEQLIVKIHRAQDLPAKDFSGTSDPYVKIYLLPDRKTK--HQTKVHRKTLNPVFDEVF-LFPVAYADLPTRKLHFSVYDFDRFSRHDIIGQVVVD 361          

HSP 2 Score: 56.9954 bits (136), Expect = 3.452e-8
Identity = 33/103 (32.04%), Postives = 50/103 (48.54%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALG 578
            LG + F L Y      L + + + +NL   D  G SDPY  +      R     KT  K  TLNPV+N   V F+   E +D+  + + + D+D+ G +E +G
Sbjct:  389 LGDLMFSLCYLPTAGRLTITMIKARNLKAMDITGASDPYVKVSLMCDGRRLKKRKTSTKRNTLNPVYNEAIV-FDVPPENIDQISLLVAVMDYDRVGHNEVIG 490          

HSP 3 Score: 54.299 bits (129), Expect = 2.027e-7
Identity = 44/162 (27.16%), Postives = 79/162 (48.77%), Query Frame = 3
Query:  927 VNVIRRIEIKKNLQALPNSRSAYGEILVSLDYVIRNRTLNVKIIKARNM--IDPTKRALVPYCVLRHLFIGNDREKTKSIHRTSYRFYTDTPVWNEEFPLKVPPKKLKQTAVEIQVFHSTSESKPKDDELGLIRLGLKTYPAQKAHYIEFLGNIGKPIENWH 1406
            V+  R  ++ +++Q + +     G+++ SL Y+     L + +IKARN+  +D T  A  PY  +  +  G   +K K    TS +  T  PV+NE     VPP+ + Q ++ + V     +    ++ +G+ R+G       + H+ E L    KPI +WH
Sbjct:  367 VDFPRETKLCRDIQYVSSDNVDLGDLMFSLCYLPTAGRLTITMIKARNLKAMDITG-ASDPYVKVSLMCDGRRLKKRK----TSTKRNTLNPVYNEAIVFDVPPENIDQISLLVAVMD--YDRVGHNEVIGVCRVGNDAEGLGREHWNEMLTYPRKPIAHWH 521          
BLAST of Synaptotagmin VIa vs. Ensembl Zebrafish
Match: syt7b (synaptotagmin VIIb [Source:ZFIN;Acc:ZDB-GENE-090601-6])

HSP 1 Score: 77.7962 bits (190), Expect = 8.492e-15
Identity = 40/112 (35.71%), Postives = 65/112 (58.04%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
            LG I F + Y  Q  TL V I +G++L  KD  GTSDP+  +   P  +     +T+VK K LNP WN  F+F  F +E++ +  +++ + D+D++  ++ +GEV   L K+
Sbjct:  387 LGRIQFSVGYSFQDSTLTVKILKGQDLPAKDFSGTSDPFVKLYLLPDKKHK--LETKVKRKNLNPHWNETFLFEGFPYEKVVQRTLYLQVLDYDRFSRNDPIGEVSIPLNKV 496          
BLAST of Synaptotagmin VIa vs. Ensembl Zebrafish
Match: syt7b (synaptotagmin VIIb [Source:ZFIN;Acc:ZDB-GENE-090601-6])

HSP 1 Score: 77.0258 bits (188), Expect = 1.246e-14
Identity = 40/116 (34.48%), Postives = 67/116 (57.76%), Query Frame = 3
Query:  258 IDQGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
            + + LG I F + Y  Q  TL V I +G++L  KD  GTSDP+  +   P  +     +T+VK K LNP WN  F+F  F +E++ +  +++ + D+D++  ++ +GEV   L K+
Sbjct:  217 VCEKLGRIQFSVGYSFQDSTLTVKILKGQDLPAKDFSGTSDPFVKLYLLPDKKHK--LETKVKRKNLNPHWNETFLFEGFPYEKVVQRTLYLQVLDYDRFSRNDPIGEVSIPLNKV 330          

HSP 2 Score: 58.151 bits (139), Expect = 1.316e-8
Identity = 47/175 (26.86%), Postives = 80/175 (45.71%), Query Frame = 3
Query:  909 EENIPT--VNVIRRIEIKKNLQALPNSRSAYGEILVSLDYVIRNRTLNVKIIKARNM----IDPTKRALVPYCVLRHLFIGNDREKTKSIHRTSYRFYTDTPVWNEEFPLKVPPKKLKQTAVEIQVFHSTSESKPKDDELGLIRLGLKTYPAQKAHYIEFLGNIGKPIENWHLIR 1415
            E +IP   V ++    + K L+   +   + G++LVSL Y      + V IIKARN+    I  T    V   ++       +++K     +T        PV+NE FP  VP   L++T + I V      S  ++D +G I L  K+ PA+  H+ + + +    +  WH ++
Sbjct:  322 EVSIPLNKVELVPMQTLWKELKPCSDGSGSRGDLLVSLCYNPTANIITVSIIKARNLKAMDIGGTSDPYVKVWLM-------NKDKRVEKKKTVVMKRCLNPVFNESFPFDVPAHVLRETTIVITVMDKDRLS--RNDVIGKIYLSWKSGPAEVKHWKDMMSHPRTAVAQWHALK 487          
BLAST of Synaptotagmin VIa vs. Ensembl Xenopus
Match: RPH3A (rabphilin 3A [Source:NCBI gene;Acc:100487950])

HSP 1 Score: 78.1814 bits (191), Expect = 1.090e-14
Identity = 39/112 (34.82%), Postives = 57/112 (50.89%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
            LG + F L Y+ +  +L   I + K L   D  G +DPY  +   P        +T+    T NP+WN   V+   T EEL R  + I++ D DK+G +E +GE  + LKKL
Sbjct:  393 LGSLEFSLFYDQENNSLHCGIIKAKGLKPMDSNGLADPYVKLHLLPGASKANKLRTKTLRNTRNPIWNETLVYHGITDEELQRKTLRISVCDEDKFGHNEFIGETRFSLKKL 504          

HSP 2 Score: 55.4546 bits (132), Expect = 1.663e-7
Identity = 30/93 (32.26%), Postives = 47/93 (50.54%), Query Frame = 3
Query:  273 GLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWD 551
            G I   L Y  Q   L V I +  +L   D  G SDP+  +   P        KT++K KTLNP +N  F F+   H +L + ++ ++++D+D
Sbjct:  551 GKILVSLMYNTQQGGLIVGIVRCVHLAAMDANGYSDPFVKLWLKPDMGKKAKNKTQIKKKTLNPEFNEEF-FYEIKHSDLAKKQLDVSVWDYD 642          
BLAST of Synaptotagmin VIa vs. Ensembl Xenopus
Match: RPH3A (rabphilin 3A [Source:NCBI gene;Acc:100487950])

HSP 1 Score: 76.2554 bits (186), Expect = 1.838e-14
Identity = 39/112 (34.82%), Postives = 57/112 (50.89%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
            LG + F L Y+ +  +L   I + K L   D  G +DPY  +   P        +T+    T NP+WN   V+   T EEL R  + I++ D DK+G +E +GE  + LKKL
Sbjct:   89 LGSLEFSLFYDQENNSLHCGIIKAKGLKPMDSNGLADPYVKLHLLPGASKANKLRTKTLRNTRNPIWNETLVYHGITDEELQRKTLRISVCDEDKFGHNEFIGETRFSLKKL 200          

HSP 2 Score: 54.6842 bits (130), Expect = 2.012e-7
Identity = 30/93 (32.26%), Postives = 47/93 (50.54%), Query Frame = 3
Query:  273 GLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWD 551
            G I   L Y  Q   L V I +  +L   D  G SDP+  +   P        KT++K KTLNP +N  F F+   H +L + ++ ++++D+D
Sbjct:  228 GKILVSLMYNTQQGGLIVGIVRCVHLAAMDANGYSDPFVKLWLKPDMGKKAKNKTQIKKKTLNPEFNEEF-FYEIKHSDLAKKQLDVSVWDYD 319          
BLAST of Synaptotagmin VIa vs. Ensembl Xenopus
Match: wnt6 (Wnt family member 6 [Source:Xenbase;Acc:XB-GENE-486077])

HSP 1 Score: 77.0258 bits (188), Expect = 1.879e-14
Identity = 39/109 (35.78%), Postives = 60/109 (55.05%), Query Frame = 3
Query:  267 GLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYD 593
              G I F+LRY   ++ L V I +   L  KD  G SDPY  +   P  +    ++T+V  KTLNP++N  F  FN    EL   ++H ++YD+D++  H+ +G+V  D
Sbjct:  247 SCGRISFILRYAYNSEQLVVKILKALELPAKDANGFSDPYVKMYLLPDRKKK--FQTKVHRKTLNPIFNETF-HFNVPFNELQNRKLHFSIYDFDRFSRHDLIGQVVLD 352          
BLAST of Synaptotagmin VIa vs. Ensembl Xenopus
Match: RPH3A (rabphilin 3A [Source:NCBI gene;Acc:100487950])

HSP 1 Score: 77.411 bits (189), Expect = 1.897e-14
Identity = 39/112 (34.82%), Postives = 57/112 (50.89%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
            LG + F L Y+ +  +L   I + K L   D  G +DPY  +   P        +T+    T NP+WN   V+   T EEL R  + I++ D DK+G +E +GE  + LKKL
Sbjct:  352 LGSLEFSLFYDQENNSLHCGIIKAKGLKPMDSNGLADPYVKLHLLPGASKANKLRTKTLRNTRNPIWNETLVYHGITDEELQRKTLRISVCDEDKFGHNEFIGETRFSLKKL 463          

HSP 2 Score: 55.0694 bits (131), Expect = 2.119e-7
Identity = 30/93 (32.26%), Postives = 47/93 (50.54%), Query Frame = 3
Query:  273 GLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWD 551
            G I   L Y  Q   L V I +  +L   D  G SDP+  +   P        KT++K KTLNP +N  F F+   H +L + ++ ++++D+D
Sbjct:  510 GKILVSLMYNTQQGGLIVGIVRCVHLAAMDANGYSDPFVKLWLKPDMGKKAKNKTQIKKKTLNPEFNEEF-FYEIKHSDLAKKQLDVSVWDYD 601          
BLAST of Synaptotagmin VIa vs. Ensembl Xenopus
Match: RPH3A (rabphilin 3A [Source:NCBI gene;Acc:100487950])

HSP 1 Score: 77.0258 bits (188), Expect = 2.321e-14
Identity = 39/112 (34.82%), Postives = 57/112 (50.89%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
            LG + F L Y+ +  +L   I + K L   D  G +DPY  +   P        +T+    T NP+WN   V+   T EEL R  + I++ D DK+G +E +GE  + LKKL
Sbjct:  282 LGSLEFSLFYDQENNSLHCGIIKAKGLKPMDSNGLADPYVKLHLLPGASKANKLRTKTLRNTRNPIWNETLVYHGITDEELQRKTLRISVCDEDKFGHNEFIGETRFSLKKL 393          

HSP 2 Score: 54.6842 bits (130), Expect = 2.263e-7
Identity = 30/93 (32.26%), Postives = 47/93 (50.54%), Query Frame = 3
Query:  273 GLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWD 551
            G I   L Y  Q   L V I +  +L   D  G SDP+  +   P        KT++K KTLNP +N  F F+   H +L + ++ ++++D+D
Sbjct:  440 GKILVSLMYNTQQGGLIVGIVRCVHLAAMDANGYSDPFVKLWLKPDMGKKAKNKTQIKKKTLNPEFNEEF-FYEIKHSDLAKKQLDVSVWDYD 531          
BLAST of Synaptotagmin VIa vs. Ensembl Mouse
Match: Syt9 (synaptotagmin IX [Source:MGI Symbol;Acc:MGI:1926373])

HSP 1 Score: 75.0998 bits (183), Expect = 4.880e-14
Identity = 39/110 (35.45%), Postives = 67/110 (60.91%), Query Frame = 3
Query:  264 QGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYD 593
            +  G ++F+L+Y+   + L V I +  NL  KD  GTSDPY  I   P  +    ++T+V  KTLNPV++ VF+ F   + +L+  ++H ++YD+D++  H+ +G+V  D
Sbjct:  219 KACGKLNFILKYDCDLEQLIVKIHKAVNLPAKDFSGTSDPYVKIYLLPDRKTK--HQTKVHRKTLNPVFDEVFL-FPVHYNDLEARKLHFSVYDFDRFSRHDLIGQVVVD 325          

HSP 2 Score: 60.4622 bits (145), Expect = 2.263e-9
Identity = 44/144 (30.56%), Postives = 68/144 (47.22%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALG--EVYYDLKKLHGKDHEEKEEDQPNEYAESLNVEKLSIKEW 695
            LG + F L Y      L + I + +NL   D  G SDPY  +      R     KT  K  TLNPV+N   V F+   E +D+  + I + D+D+ G +E +G  +V  + ++L G+DH          ++E L+  +  I  W
Sbjct:  353 LGELMFSLCYLPTAGRLTITIIKARNLKAMDITGASDPYVKVSLMCDGRRLKKRKTSTKRNTLNPVYNEAIV-FDVPPESIDQIHLSIAVMDYDRVGHNEVIGVCQVGNEAERL-GRDH----------WSEMLSYPRKPIAHW 484          

HSP 3 Score: 56.225 bits (134), Expect = 5.846e-8
Identity = 46/158 (29.11%), Postives = 76/158 (48.10%), Query Frame = 3
Query:  939 RRIEIKKNLQALPNSRSAYGEILVSLDYVIRNRTLNVKIIKARNM--IDPTKRALVPYCVLRHLFIGNDREKTKSIHRTSYRFYTDTPVWNEEFPLKVPPKKLKQTAVEIQVFHSTSESKPKDDELGLIRLGLKTYPAQKAHYIEFLGNIGKPIENWH 1406
            R   + K+++ + N     GE++ SL Y+     L + IIKARN+  +D T  A  PY  +  +  G   +K K    TS +  T  PV+NE     VPP+ + Q  + I V     +    ++ +G+ ++G +     + H+ E L    KPI +WH
Sbjct:  335 RECILWKDIEYVTNDNVDLGELMFSLCYLPTAGRLTITIIKARNLKAMDITG-ASDPYVKVSLMCDGRRLKKRK----TSTKRNTLNPVYNEAIVFDVPPESIDQIHLSIAVM--DYDRVGHNEVIGVCQVGNEAERLGRDHWSEMLSYPRKPIAHWH 485          
BLAST of Synaptotagmin VIa vs. Ensembl Mouse
Match: Syt7 (synaptotagmin VII [Source:MGI Symbol;Acc:MGI:1859545])

HSP 1 Score: 73.9442 bits (180), Expect = 1.137e-13
Identity = 39/114 (34.21%), Postives = 64/114 (56.14%), Query Frame = 3
Query:  264 QGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
            + LG I F + Y  Q  TL V + + + L  KD  GTSDP+  I   P  +     +T+VK K LNP WN  F+F  F +E++ +  +++ + D+D++  ++ +GEV   L K+
Sbjct:  210 ENLGRIQFSVGYNFQESTLTVKVMKAQELPAKDFSGTSDPFVKIYLLPDKKHK--LETKVKRKNLNPHWNETFLFEGFPYEKVVQRVLYLQVLDYDRFSRNDPIGEVSIPLNKV 321          

HSP 2 Score: 56.9954 bits (136), Expect = 3.027e-8
Identity = 42/157 (26.75%), Postives = 77/157 (49.04%), Query Frame = 3
Query:  957 KNLQALPNSRSAYGEILVSLDYVIRNRTLNVKIIKARNM----IDPTKRALVPYCVLRHLFIGNDREKTKSIHRTSYRFYTDTPVWNEEFPLKVPPKKLKQTAVEIQVFHSTSESKPKDDELGLIRLGLKTYPAQKAHYIEFLGNIGKPIENWHLIR 1415
            K+L+   +   + GE+L+SL Y     ++ V IIKARN+    I  T     PY  +  ++    ++K     +T  +     P++NE F   +P +KL++T + I V      S  ++D +G I L  K+ P +  H+ + +    +P+  WH ++
Sbjct:  331 KDLKPCSDGSGSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSD---PYVKVWLMY----KDKRVEKKKTVTKKRNLNPIFNESFAFDIPTEKLRETTIIITVMDKDKLS--RNDVIGKIYLSWKSGPGEVKHWKDMIARPRQPVAQWHQLK 478          

HSP 3 Score: 52.7582 bits (125), Expect = 7.781e-7
Identity = 36/113 (31.86%), Postives = 55/113 (48.67%), Query Frame = 3
Query:  273 GLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKLHG 611
            G +   L Y     ++ VNI + +NL   D  GTSDPY  +    + +     KT  K + LNP++N  F  F+   E+L    I IT+ D DK   ++ +G++Y   K   G
Sbjct:  344 GELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTKKRNLNPIFNESFA-FDIPTEKLRETTIIITVMDKDKLSRNDVIGKIYLSWKSGPG 455          
BLAST of Synaptotagmin VIa vs. Ensembl Mouse
Match: Syt7 (synaptotagmin VII [Source:MGI Symbol;Acc:MGI:1859545])

HSP 1 Score: 74.3294 bits (181), Expect = 1.146e-13
Identity = 39/112 (34.82%), Postives = 63/112 (56.25%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
            LG I F + Y  Q  TL V + + + L  KD  GTSDP+  I   P  +     +T+VK K LNP WN  F+F  F +E++ +  +++ + D+D++  ++ +GEV   L K+
Sbjct:  376 LGRIQFSVGYNFQESTLTVKVMKAQELPAKDFSGTSDPFVKIYLLPDKKHK--LETKVKRKNLNPHWNETFLFEGFPYEKVVQRVLYLQVLDYDRFSRNDPIGEVSIPLNKV 485          

HSP 2 Score: 56.6102 bits (135), Expect = 4.977e-8
Identity = 42/157 (26.75%), Postives = 77/157 (49.04%), Query Frame = 3
Query:  957 KNLQALPNSRSAYGEILVSLDYVIRNRTLNVKIIKARNM----IDPTKRALVPYCVLRHLFIGNDREKTKSIHRTSYRFYTDTPVWNEEFPLKVPPKKLKQTAVEIQVFHSTSESKPKDDELGLIRLGLKTYPAQKAHYIEFLGNIGKPIENWHLIR 1415
            K+L+   +   + GE+L+SL Y     ++ V IIKARN+    I  T     PY  +  ++    ++K     +T  +     P++NE F   +P +KL++T + I V      S  ++D +G I L  K+ P +  H+ + +    +P+  WH ++
Sbjct:  495 KDLKPCSDGSGSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSD---PYVKVWLMY----KDKRVEKKKTVTKKRNLNPIFNESFAFDIPTEKLRETTIIITVMDKDKLS--RNDVIGKIYLSWKSGPGEVKHWKDMIARPRQPVAQWHQLK 642          

HSP 3 Score: 52.7582 bits (125), Expect = 8.739e-7
Identity = 36/114 (31.58%), Postives = 56/114 (49.12%), Query Frame = 3
Query:  273 GLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKLHGK 614
            G +   L Y     ++ VNI + +NL   D  GTSDPY  +    + +     KT  K + LNP++N  F  F+   E+L    I IT+ D DK   ++ +G++Y   K   G+
Sbjct:  508 GELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTKKRNLNPIFNESFA-FDIPTEKLRETTIIITVMDKDKLSRNDVIGKIYLSWKSGPGE 620          
BLAST of Synaptotagmin VIa vs. Ensembl Mouse
Match: Syt7 (synaptotagmin VII [Source:MGI Symbol;Acc:MGI:1859545])

HSP 1 Score: 73.559 bits (179), Expect = 1.154e-13
Identity = 39/114 (34.21%), Postives = 64/114 (56.14%), Query Frame = 3
Query:  264 QGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
            + LG I F + Y  Q  TL V + + + L  KD  GTSDP+  I   P  +     +T+VK K LNP WN  F+F  F +E++ +  +++ + D+D++  ++ +GEV   L K+
Sbjct:  134 ENLGRIQFSVGYNFQESTLTVKVMKAQELPAKDFSGTSDPFVKIYLLPDKKHK--LETKVKRKNLNPHWNETFLFEGFPYEKVVQRVLYLQVLDYDRFSRNDPIGEVSIPLNKV 245          

HSP 2 Score: 56.9954 bits (136), Expect = 2.419e-8
Identity = 42/157 (26.75%), Postives = 77/157 (49.04%), Query Frame = 3
Query:  957 KNLQALPNSRSAYGEILVSLDYVIRNRTLNVKIIKARNM----IDPTKRALVPYCVLRHLFIGNDREKTKSIHRTSYRFYTDTPVWNEEFPLKVPPKKLKQTAVEIQVFHSTSESKPKDDELGLIRLGLKTYPAQKAHYIEFLGNIGKPIENWHLIR 1415
            K+L+   +   + GE+L+SL Y     ++ V IIKARN+    I  T     PY  +  ++    ++K     +T  +     P++NE F   +P +KL++T + I V      S  ++D +G I L  K+ P +  H+ + +    +P+  WH ++
Sbjct:  255 KDLKPCSDGSGSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSD---PYVKVWLMY----KDKRVEKKKTVTKKRNLNPIFNESFAFDIPTEKLRETTIIITVMDKDKLS--RNDVIGKIYLSWKSGPGEVKHWKDMIARPRQPVAQWHQLK 402          

HSP 3 Score: 51.9878 bits (123), Expect = 9.909e-7
Identity = 36/114 (31.58%), Postives = 56/114 (49.12%), Query Frame = 3
Query:  273 GLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKLHGK 614
            G +   L Y     ++ VNI + +NL   D  GTSDPY  +    + +     KT  K + LNP++N  F  F+   E+L    I IT+ D DK   ++ +G++Y   K   G+
Sbjct:  268 GELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTKKRNLNPIFNESFA-FDIPTEKLRETTIIITVMDKDKLSRNDVIGKIYLSWKSGPGE 380          
BLAST of Synaptotagmin VIa vs. Ensembl Mouse
Match: Syt7 (synaptotagmin VII [Source:MGI Symbol;Acc:MGI:1859545])

HSP 1 Score: 74.3294 bits (181), Expect = 1.205e-13
Identity = 39/112 (34.82%), Postives = 63/112 (56.25%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
            LG I F + Y  Q  TL V + + + L  KD  GTSDP+  I   P  +     +T+VK K LNP WN  F+F  F +E++ +  +++ + D+D++  ++ +GEV   L K+
Sbjct:  253 LGRIQFSVGYNFQESTLTVKVMKAQELPAKDFSGTSDPFVKIYLLPDKKHK--LETKVKRKNLNPHWNETFLFEGFPYEKVVQRVLYLQVLDYDRFSRNDPIGEVSIPLNKV 362          

HSP 2 Score: 56.9954 bits (136), Expect = 3.079e-8
Identity = 42/157 (26.75%), Postives = 77/157 (49.04%), Query Frame = 3
Query:  957 KNLQALPNSRSAYGEILVSLDYVIRNRTLNVKIIKARNM----IDPTKRALVPYCVLRHLFIGNDREKTKSIHRTSYRFYTDTPVWNEEFPLKVPPKKLKQTAVEIQVFHSTSESKPKDDELGLIRLGLKTYPAQKAHYIEFLGNIGKPIENWHLIR 1415
            K+L+   +   + GE+L+SL Y     ++ V IIKARN+    I  T     PY  +  ++    ++K     +T  +     P++NE F   +P +KL++T + I V      S  ++D +G I L  K+ P +  H+ + +    +P+  WH ++
Sbjct:  372 KDLKPCSDGSGSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSD---PYVKVWLMY----KDKRVEKKKTVTKKRNLNPIFNESFAFDIPTEKLRETTIIITVMDKDKLS--RNDVIGKIYLSWKSGPGEVKHWKDMIARPRQPVAQWHQLK 519          

HSP 3 Score: 52.373 bits (124), Expect = 8.414e-7
Identity = 36/114 (31.58%), Postives = 56/114 (49.12%), Query Frame = 3
Query:  273 GLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKLHGK 614
            G +   L Y     ++ VNI + +NL   D  GTSDPY  +    + +     KT  K + LNP++N  F  F+   E+L    I IT+ D DK   ++ +G++Y   K   G+
Sbjct:  385 GELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTKKRNLNPIFNESFA-FDIPTEKLRETTIIITVMDKDKLSRNDVIGKIYLSWKSGPGE 497          
BLAST of Synaptotagmin VIa vs. UniProt/SwissProt
Match: sp|P24507|SY63_DIPOM (Synaptotagmin-C OS=Diplobatis ommata OX=1870830 GN=P65-C PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.394e-14
Identity = 41/108 (37.96%), Postives = 62/108 (57.41%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYD 593
             G I+F+LRY   T+ L V I +  +L  KD  G SDPY  I   P  +    ++T+V  KTLNP++N  F  FN    EL   ++H ++YD+D++  H+ +G+V  D
Sbjct:  237 CGRINFMLRYTYTTEQLVVKILKALDLPAKDANGFSDPYVKIYLLPDRKKK--FQTKVHRKTLNPIFNETFQ-FNVPFNELQNRKLHFSVYDFDRFSRHDLIGQVVLD 341          

HSP 2 Score: 55.8398 bits (133), Expect = 6.163e-7
Identity = 35/103 (33.98%), Postives = 49/103 (47.57%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALG 578
            LG I+F L Y      L + I +  NL   D  G SDPY         R     KT +K  TLNPV+N   V F+  +E ++   + I + D+D  G +E +G
Sbjct:  369 LGEINFSLCYLPTAGRLTITIIKATNLKAMDLTGFSDPYVKASLICDERRLKKRKTSIKKNTLNPVYNEALV-FDIPNENMEHVNVIIAVMDYDCIGHNEVIG 470          

HSP 3 Score: 55.4546 bits (132), Expect = 7.665e-7
Identity = 47/155 (30.32%), Postives = 77/155 (49.68%), Query Frame = 3
Query:  984 RSAYGEILVSLDYVIRNRTLNVKIIKARNM--IDPTKRALVPYCVLRHLFIGNDREKTKSIHRTSYRFYTDTPVWNEEFPLKVPPKKLKQTAVEIQVFHSTSESKPKDDELGLIRLGLKTYPAQKAHYIEFLGNIGKPIENWHLIRK*KVIRSSL 1442
            ++  GEI  SL Y+     L + IIKA N+  +D T  +  PY  ++   I ++R   K   +TS +  T  PV+NE     +P + ++   V I V     +    ++ +G+ R+G  T    + H+ E L N  KPIE WH + + KV+ S +
Sbjct:  366 KADLGEINFSLCYLPTAGRLTITIIKATNLKAMDLTGFS-DPY--VKASLICDERRLKK--RKTSIKKNTLNPVYNEALVFDIPNENMEHVNVIIAVMDY--DCIGHNEVIGMCRVGNATDGPGREHWNEMLANPRKPIEQWHQLIEEKVMNSYM 513          
BLAST of Synaptotagmin VIa vs. UniProt/SwissProt
Match: sp|Q9Y2J0|RP3A_HUMAN (Rabphilin-3A OS=Homo sapiens OX=9606 GN=RPH3A PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.523e-13
Identity = 37/112 (33.04%), Postives = 57/112 (50.89%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
            LG + F L Y+    +L+  I + K L   D  G +DPY  +   P        +T+    T NP+WN   V+   T E++ R  + I++ D DK+G +E +GE  + LKKL
Sbjct:  393 LGALEFSLLYDQDNSSLQCTIIKAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPIWNETLVYHGITDEDMQRKTLRISVCDEDKFGHNEFIGETRFSLKKL 504          

HSP 2 Score: 57.3806 bits (137), Expect = 1.913e-7
Identity = 31/93 (33.33%), Postives = 48/93 (51.61%), Query Frame = 3
Query:  273 GLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWD 551
            G I   L Y  Q   L V I +  +L   D  G SDP+  +   P       +KT++K KTLNP +N  F F++  H +L +  + I+++D+D
Sbjct:  552 GKILVSLMYSTQQGGLIVGIIRCVHLAAMDANGYSDPFVKLWLKPDMGKKAKHKTQIKKKTLNPEFNEEF-FYDIKHSDLAKKSLDISVWDYD 643          
BLAST of Synaptotagmin VIa vs. UniProt/SwissProt
Match: sp|Q86SS6|SYT9_HUMAN (Synaptotagmin-9 OS=Homo sapiens OX=9606 GN=SYT9 PE=1 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.350e-13
Identity = 39/110 (35.45%), Postives = 67/110 (60.91%), Query Frame = 3
Query:  264 QGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYD 593
            +  G ++F+L+Y+   + L V I +  NL  KD  GTSDPY  I   P  +    ++T+V  KTLNPV++ VF+ F   + +L+  ++H ++YD+D++  H+ +G+V  D
Sbjct:  219 KACGKLNFILKYDCDLEQLIVKIHKAVNLPAKDFSGTSDPYVKIYLLPDRKTK--HQTKVHRKTLNPVFDEVFL-FPVPYNDLEARKLHFSVYDFDRFSRHDLIGQVVVD 325          

HSP 2 Score: 60.077 bits (144), Expect = 2.078e-8
Identity = 44/144 (30.56%), Postives = 68/144 (47.22%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALG--EVYYDLKKLHGKDHEEKEEDQPNEYAESLNVEKLSIKEW 695
            LG + F L Y      L + I + +NL   D  G SDPY  +      R     KT  K  TLNPV+N   V F+   E +D+  + I + D+D+ G +E +G  +V  + ++L G+DH          ++E L+  +  I  W
Sbjct:  353 LGELMFSLCYLPTAGRLTITIIKARNLKAMDITGASDPYVKVSLMCDGRRLKKRKTSTKRNTLNPVYNEAIV-FDVPPENIDQIHLSIAVMDYDRVGHNEIIGVCQVGNEAERL-GRDH----------WSEMLSYPRKPIAHW 484          

HSP 3 Score: 55.4546 bits (132), Expect = 6.169e-7
Identity = 46/158 (29.11%), Postives = 76/158 (48.10%), Query Frame = 3
Query:  939 RRIEIKKNLQALPNSRSAYGEILVSLDYVIRNRTLNVKIIKARNM--IDPTKRALVPYCVLRHLFIGNDREKTKSIHRTSYRFYTDTPVWNEEFPLKVPPKKLKQTAVEIQVFHSTSESKPKDDELGLIRLGLKTYPAQKAHYIEFLGNIGKPIENWH 1406
            R   + K+++ + N     GE++ SL Y+     L + IIKARN+  +D T  A  PY  +  +  G   +K K    TS +  T  PV+NE     VPP+ + Q  + I V     +    ++ +G+ ++G +     + H+ E L    KPI +WH
Sbjct:  335 RECILWKDIEYVTNDNVDLGELMFSLCYLPTAGRLTITIIKARNLKAMDITG-ASDPYVKVSLMCDGRRLKKRK----TSTKRNTLNPVYNEAIVFDVPPENIDQIHLSIAVM--DYDRVGHNEIIGVCQVGNEAERLGRDHWSEMLSYPRKPIAHWH 485          
BLAST of Synaptotagmin VIa vs. UniProt/SwissProt
Match: sp|Q06846|RP3A_BOVIN (Rabphilin-3A OS=Bos taurus OX=9913 GN=RPH3A PE=1 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 2.496e-13
Identity = 37/112 (33.04%), Postives = 56/112 (50.00%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
            LG + F L Y+    +L   I + K L   D  G +DPY  +   P        +T+    T NP+WN   V+   T E++ R  + I++ D DK+G +E +GE  + LKKL
Sbjct:  403 LGALEFSLLYDQDNSSLHCTIIKAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPIWNETLVYHGITDEDMQRKTLRISVCDEDKFGHNEFIGETRFSLKKL 514          

HSP 2 Score: 57.7658 bits (138), Expect = 1.735e-7
Identity = 31/93 (33.33%), Postives = 48/93 (51.61%), Query Frame = 3
Query:  273 GLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWD 551
            G I   L Y  Q   L V I +  +L   D  G SDP+  +   P       +KT++K KTLNP +N  F F++  H +L +  + I+++D+D
Sbjct:  562 GKILVSLMYSTQQGGLIVGIIRCVHLAAMDANGYSDPFVKLWLKPDMGKKAKHKTQIKKKTLNPEFNEEF-FYDIKHSDLAKKSLDISVWDYD 653          
BLAST of Synaptotagmin VIa vs. UniProt/SwissProt
Match: sp|Q9R0N9|SYT9_MOUSE (Synaptotagmin-9 OS=Mus musculus OX=10090 GN=Syt9 PE=1 SV=2)

HSP 1 Score: 75.0998 bits (183), Expect = 3.414e-13
Identity = 39/110 (35.45%), Postives = 67/110 (60.91%), Query Frame = 3
Query:  264 QGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYD 593
            +  G ++F+L+Y+   + L V I +  NL  KD  GTSDPY  I   P  +    ++T+V  KTLNPV++ VF+ F   + +L+  ++H ++YD+D++  H+ +G+V  D
Sbjct:  219 KACGKLNFILKYDCDLEQLIVKIHKAVNLPAKDFSGTSDPYVKIYLLPDRKTK--HQTKVHRKTLNPVFDEVFL-FPVHYNDLEARKLHFSVYDFDRFSRHDLIGQVVVD 325          

HSP 2 Score: 60.4622 bits (145), Expect = 1.583e-8
Identity = 44/144 (30.56%), Postives = 68/144 (47.22%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALG--EVYYDLKKLHGKDHEEKEEDQPNEYAESLNVEKLSIKEW 695
            LG + F L Y      L + I + +NL   D  G SDPY  +      R     KT  K  TLNPV+N   V F+   E +D+  + I + D+D+ G +E +G  +V  + ++L G+DH          ++E L+  +  I  W
Sbjct:  353 LGELMFSLCYLPTAGRLTITIIKARNLKAMDITGASDPYVKVSLMCDGRRLKKRKTSTKRNTLNPVYNEAIV-FDVPPESIDQIHLSIAVMDYDRVGHNEVIGVCQVGNEAERL-GRDH----------WSEMLSYPRKPIAHW 484          

HSP 3 Score: 56.225 bits (134), Expect = 4.089e-7
Identity = 46/158 (29.11%), Postives = 76/158 (48.10%), Query Frame = 3
Query:  939 RRIEIKKNLQALPNSRSAYGEILVSLDYVIRNRTLNVKIIKARNM--IDPTKRALVPYCVLRHLFIGNDREKTKSIHRTSYRFYTDTPVWNEEFPLKVPPKKLKQTAVEIQVFHSTSESKPKDDELGLIRLGLKTYPAQKAHYIEFLGNIGKPIENWH 1406
            R   + K+++ + N     GE++ SL Y+     L + IIKARN+  +D T  A  PY  +  +  G   +K K    TS +  T  PV+NE     VPP+ + Q  + I V     +    ++ +G+ ++G +     + H+ E L    KPI +WH
Sbjct:  335 RECILWKDIEYVTNDNVDLGELMFSLCYLPTAGRLTITIIKARNLKAMDITG-ASDPYVKVSLMCDGRRLKKRK----TSTKRNTLNPVYNEAIVFDVPPESIDQIHLSIAVM--DYDRVGHNEVIGVCQVGNEAERLGRDHWSEMLSYPRKPIAHWH 485          
BLAST of Synaptotagmin VIa vs. TrEMBL
Match: D7EJD0 (Synaptotagmin 1-like Protein OS=Tribolium castaneum OX=7070 GN=TcasGA2_TC002242 PE=4 SV=2)

HSP 1 Score: 83.9593 bits (206), Expect = 1.357e-15
Identity = 42/114 (36.84%), Postives = 68/114 (59.65%), Query Frame = 3
Query:  264 QGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
            + +G IHF L Y+ Q  TL + I QGK+L  KD  GTSDPY  +   P  +     +T++K +TLNP WN  F F  F  ++L    +H+ ++D+D++   +++GEV+  L ++
Sbjct:   23 ENVGQIHFSLEYDFQNTTLILRIIQGKDLPAKDLSGTSDPYVRVTLLPDKKHRL--ETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDRFSRDDSIGEVFLPLCQV 134          
BLAST of Synaptotagmin VIa vs. TrEMBL
Match: D3TS75 (Synaptotagmin OS=Glossina morsitans morsitans OX=37546 PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 2.989e-15
Identity = 41/115 (35.65%), Postives = 68/115 (59.13%), Query Frame = 3
Query:  264 QGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKLH 608
            + +G IHF L Y+ Q  +L + + QGK L  KD  GTSDPY  +   P  +     +T++K +TLNP WN  F F  F  ++L    +H+ ++D+D++   +++GEV+  L ++H
Sbjct:  151 ENVGQIHFSLEYDFQNTSLILKVLQGKELPAKDLSGTSDPYVRVTLLPDKKHR--LETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDRFSRDDSIGEVFLPLCQIH 263          
BLAST of Synaptotagmin VIa vs. TrEMBL
Match: U4UCS3 (C2 domain-containing protein OS=Dendroctonus ponderosae OX=77166 GN=D910_01135 PE=4 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 4.159e-15
Identity = 42/114 (36.84%), Postives = 68/114 (59.65%), Query Frame = 3
Query:  264 QGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
            + +G IHF L Y+ Q  TL + I QGK+L  KD  GTSDPY  +   P  +     +T++K +TLNP WN  F F  F  ++L    +H+ ++D+D++   +++GEV+  L ++
Sbjct:   42 ENVGQIHFSLEYDFQNTTLILKILQGKDLPAKDLSGTSDPYVRVTLLPDKKHR--LETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDRFSRDDSIGEVFLPLCQV 153          
BLAST of Synaptotagmin VIa vs. TrEMBL
Match: N6T9P1 (C2 domain-containing protein (Fragment) OS=Dendroctonus ponderosae OX=77166 GN=D910_01214 PE=4 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 5.262e-15
Identity = 42/114 (36.84%), Postives = 68/114 (59.65%), Query Frame = 3
Query:  264 QGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
            + +G IHF L Y+ Q  TL + I QGK+L  KD  GTSDPY  +   P  +     +T++K +TLNP WN  F F  F  ++L    +H+ ++D+D++   +++GEV+  L ++
Sbjct:   46 ENVGQIHFSLEYDFQNTTLILKILQGKDLPAKDLSGTSDPYVRVTLLPDKKHRL--ETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDRFSRDDSIGEVFLPLCQV 157          
BLAST of Synaptotagmin VIa vs. TrEMBL
Match: A0A1A9Z228 (C2 domain-containing protein OS=Glossina pallidipes OX=7398 PE=4 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 6.455e-15
Identity = 44/125 (35.20%), Postives = 70/125 (56.00%), Query Frame = 3
Query:  264 QGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKK-------LHGKD 617
            + +G IHF L Y+ Q  +L + + QGK L  KD  GTSDPY  +   P  +     +T++K +TLNP WN  F F  F  ++L    +H+ ++D+D++   +++GEV+  L +       LHG D
Sbjct:   68 ENVGQIHFSLEYDFQNTSLILKVLQGKELPAKDLSGTSDPYVRVTLLPDKKHRL--ETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDRFSRDDSIGEVFLPLCQQHRVSTYLHGHD 190          
BLAST of Synaptotagmin VIa vs. Ensembl Cavefish
Match: syt9b (synaptotagmin 9 [Source:NCBI gene;Acc:103033725])

HSP 1 Score: 80.1073 bits (196), Expect = 1.239e-15
Identity = 43/119 (36.13%), Postives = 70/119 (58.82%), Query Frame = 3
Query:  237 GRNIDPGIDQGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYD 593
            GR  D       G +HF+L+Y+   + L V I + ++L  KD  GTSDPY  I   P  +    ++T+V  KTLNPV++ VF+ F   + EL+  ++H ++YD+D++  H+ +G+V  D
Sbjct:  221 GRRAD-----SCGRLHFILKYDCDLEQLIVKIHKAEDLPAKDFSGTSDPYVKIYLLPERKTK--HQTKVHRKTLNPVFDEVFL-FPVAYAELNMRKLHFSVYDFDRFSRHDLIGQVVVD 331          

HSP 2 Score: 56.9954 bits (136), Expect = 2.475e-8
Identity = 38/118 (32.20%), Postives = 56/118 (47.46%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYY-DLKKLHGKDH 620
            LG + F L Y      L + I + +NL   D  G SDPY  +      R     KT  K  TLNPV+N   V F+   E +D+  + I + D+D+ G +E +G     +  +  G+DH
Sbjct:  359 LGDLMFSLCYLPTAGRLTITIIKARNLKAMDITGASDPYVKVSLMCDGRRLKKRKTSTKRNTLNPVYNEAIV-FDVPPENIDQISLLIAVMDYDRVGHNEIIGVCRVGNTAESLGRDH 475          

HSP 3 Score: 53.5286 bits (127), Expect = 3.519e-7
Identity = 45/158 (28.48%), Postives = 75/158 (47.47%), Query Frame = 3
Query:  939 RRIEIKKNLQALPNSRSAYGEILVSLDYVIRNRTLNVKIIKARNM--IDPTKRALVPYCVLRHLFIGNDREKTKSIHRTSYRFYTDTPVWNEEFPLKVPPKKLKQTAVEIQVFHSTSESKPKDDELGLIRLGLKTYPAQKAHYIEFLGNIGKPIENWH 1406
            R  ++ K++  +       G+++ SL Y+     L + IIKARN+  +D T  A  PY  +  +  G   +K K    TS +  T  PV+NE     VPP+ + Q ++ I V     +    ++ +G+ R+G       + H+ E L    KPI +WH
Sbjct:  341 RETKLCKDILYVTADNVDLGDLMFSLCYLPTAGRLTITIIKARNLKAMDITG-ASDPYVKVSLMCDGRRLKKRK----TSTKRNTLNPVYNEAIVFDVPPENIDQISLLIAVM--DYDRVGHNEIIGVCRVGNTAESLGRDHWNEMLTYPRKPIAHWH 491          
BLAST of Synaptotagmin VIa vs. Ensembl Cavefish
Match: syt6a (synaptotagmin-6-like [Source:NCBI gene;Acc:103041393])

HSP 1 Score: 79.337 bits (194), Expect = 2.256e-15
Identity = 42/110 (38.18%), Postives = 67/110 (60.91%), Query Frame = 3
Query:  255 GIDQGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEV 584
            G  +  G I+F LRY+ + +TL VNI +  +L  KD  G+SDPY  I   P   D   ++T V  KTLNP +N  F  F  +++EL   ++H++++D+D++  H+ +GEV
Sbjct:  240 GGGKNCGKINFSLRYDYENETLLVNILKAFDLPAKDLCGSSDPYVKIYLLP---DRKKFQTRVHRKTLNPTFNESFQ-FPVSYDELPARKLHLSVFDFDRFSRHDMIGEV 345          

HSP 2 Score: 51.2174 bits (121), Expect = 1.702e-6
Identity = 48/153 (31.37%), Postives = 70/153 (45.75%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALG--EVYYDLKKLHGKDHEEKE---EDQPNEYAESLNVEKLSIKEWVETTNS 713
            LG I F L Y      L + + + +NL   D  G SDPY  +      R     KT +K  TLNP +N   +F +   E +D+  +HI++ D+D  G +E +G   V    + L G+DH  +      +P  +   L   K S KEW   T S
Sbjct:  376 LGEIMFSLCYLPTAGRLTLTVIKCRNLKAMDITGYSDPYVKVSLICDGRRLKKKKTTIKKNTLNPTYNEAIIF-DIPPESMDQVSLHISVMDYDLVGHNEIIGVNRVGCGAEGL-GRDHWNEMLAYPRKPIAHWHPLLESKKSEKEWKTRTAS 526          
BLAST of Synaptotagmin VIa vs. Ensembl Cavefish
Match: syt6a (synaptotagmin-6-like [Source:NCBI gene;Acc:103041393])

HSP 1 Score: 78.5666 bits (192), Expect = 2.474e-15
Identity = 42/110 (38.18%), Postives = 67/110 (60.91%), Query Frame = 3
Query:  255 GIDQGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEV 584
            G  +  G I+F LRY+ + +TL VNI +  +L  KD  G+SDPY  I   P   D   ++T V  KTLNP +N  F  F  +++EL   ++H++++D+D++  H+ +GEV
Sbjct:  153 GGGKNCGKINFSLRYDYENETLLVNILKAFDLPAKDLCGSSDPYVKIYLLP---DRKKFQTRVHRKTLNPTFNESFQ-FPVSYDELPARKLHLSVFDFDRFSRHDMIGEV 258          

HSP 2 Score: 50.447 bits (119), Expect = 2.765e-6
Identity = 34/103 (33.01%), Postives = 51/103 (49.51%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALG 578
            LG I F L Y      L + + + +NL   D  G SDPY  +      R     KT +K  TLNP +N   +F +   E +D+  +HI++ D+D  G +E +G
Sbjct:  289 LGEIMFSLCYLPTAGRLTLTVIKCRNLKAMDITGYSDPYVKVSLICDGRRLKKKKTTIKKNTLNPTYNEAIIF-DIPPESMDQVSLHISVMDYDLVGHNEIIG 390          
BLAST of Synaptotagmin VIa vs. Ensembl Cavefish
Match: syt7a (synaptotagmin VIIa [Source:ZFIN;Acc:ZDB-GENE-090601-5])

HSP 1 Score: 78.9518 bits (193), Expect = 3.102e-15
Identity = 42/116 (36.21%), Postives = 66/116 (56.90%), Query Frame = 3
Query:  258 IDQGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
            I + LG I F + Y  Q  TL V I +G++L  KD  GTSDP+  I   P  +     +T+VK K LNP WN  F+F  F +E++    +++ + D+D++  ++ +GEV   L K+
Sbjct:  302 ISEKLGRIQFSVGYSFQDSTLTVKIMKGQDLPAKDFSGTSDPFVKIYLLPDKKHK--LETKVKRKNLNPHWNETFLFEGFPYEKVRERTLYLQVLDYDRFSRNDPIGEVSIPLNKV 415          

HSP 2 Score: 58.151 bits (139), Expect = 1.163e-8
Identity = 46/157 (29.30%), Postives = 74/157 (47.13%), Query Frame = 3
Query:  957 KNLQALPNSRSAYGEILVSLDYVIRNRTLNVKIIKARNM----IDPTKRALVPYCVLRHLFIGNDREKTKSIHRTSYRFYTDTPVWNEEFPLKVPPKKLKQTAVEIQVFHSTSESKPKDDELGLIRLGLKTYPAQKAHYIEFLGNIGKPIENWHLIR 1415
            K L+   +   + G++L+SL Y     T+ V IIK RN+    I  T    V   ++ H     +++KT +I R         PV+NE FP  VP   L++T + I V      S  ++D +G I L  K+ PA+  H+ + L      +  WH ++
Sbjct:  425 KELKPCSDGSGSRGDLLLSLCYNPTANTITVNIIKGRNLKAMDIGGTSDPYVKVWLM-HKDKRVEKKKTVTIKRCL------NPVFNESFPFDVPAHVLRETTIIITVMDKDRLS--RNDVIGKIYLSWKSGPAEVKHWKDMLSRPRTNVAQWHALK 572          

HSP 3 Score: 51.2174 bits (121), Expect = 2.012e-6
Identity = 36/109 (33.03%), Postives = 52/109 (47.71%), Query Frame = 3
Query:  273 GLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLK 599
            G +   L Y     T+ VNI +G+NL   D  GTSDPY  +    + +     KT    + LNPV+N  F F    H  L    I IT+ D D+   ++ +G++Y   K
Sbjct:  438 GDLLLSLCYNPTANTITVNIIKGRNLKAMDIGGTSDPYVKVWLMHKDKRVEKKKTVTIKRCLNPVFNESFPFDVPAH-VLRETTIIITVMDKDRLSRNDVIGKIYLSWK 545          
BLAST of Synaptotagmin VIa vs. Ensembl Cavefish
Match: syt9a (synaptotagmin IXa [Source:ZFIN;Acc:ZDB-GENE-031002-18])

HSP 1 Score: 77.0258 bits (188), Expect = 3.234e-15
Identity = 40/105 (38.10%), Postives = 65/105 (61.90%), Query Frame = 3
Query:  279 IHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYD 593
            +HF+L+Y+   + L V I + ++L  KD  GTSDPY  I   P  +    ++T+V  KTLNPV++ VF+ F   + EL   ++H T+YD+D++  H+ +G+V  D
Sbjct:  179 LHFILKYDCDLEQLIVKIHRAQDLPAKDFSGTSDPYVKIYLLPDRKTK--HQTKVHRKTLNPVFDEVFL-FPVAYAELPTRKLHFTVYDFDRFSRHDIIGQVVVD 280          
BLAST of Synaptotagmin VIa vs. Ensembl Sea Lamprey
Match: SYT6 (synaptotagmin 6 [Source:HGNC Symbol;Acc:HGNC:18638])

HSP 1 Score: 75.485 bits (184), Expect = 9.426e-16
Identity = 42/108 (38.89%), Postives = 62/108 (57.41%), Query Frame = 3
Query:  273 GLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDP-RFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYD 593
            G ++F L Y+ + + L V + +   L  KD  GTSDPY  I   P R R    Y+T+V  KTLNPV+   F FF   + EL   R+H ++YD+D++  H+ +G+V  D
Sbjct:  114 GKLNFALHYDYEMEQLLVRVCRAAELPAKDFSGTSDPYVKIYLLPDRKRK---YQTKVHRKTLNPVFEETFQFF-VPYAELPARRLHFSVYDFDRFSRHDTIGQVVVD 217          
BLAST of Synaptotagmin VIa vs. Ensembl Sea Lamprey
Match: SYT6 (synaptotagmin 6 [Source:HGNC Symbol;Acc:HGNC:18638])

HSP 1 Score: 75.485 bits (184), Expect = 2.364e-15
Identity = 44/120 (36.67%), Postives = 66/120 (55.00%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKLHGKDHEEK 629
             G I+F +RY+ + + L V I +  +L  KD  GTSDPY  I   P  +    Y+T+V  KTLNPV++  F  F   + EL   R+H ++YD+D++  H+ +G V  D   L   DH  +
Sbjct:  184 CGRINFQVRYDYEGEQLVVKINKAVDLPAKDFSGTSDPYVKIYLLPERKRK--YQTKVHRKTLNPVFDETFQ-FGVPYSELASRRLHFSVYDFDRFSRHDIIGTVLVD-NLLEATDHSRE 299          
BLAST of Synaptotagmin VIa vs. Ensembl Sea Lamprey
Match: syt2a (synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503-315])

HSP 1 Score: 69.3218 bits (168), Expect = 7.285e-14
Identity = 39/105 (37.14%), Postives = 57/105 (54.29%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEV 584
            LG + F + Y+ Q   L V + Q   L   D  GTSDPY  +   P  +    Y+T+V  KTLNPV+N  FV F   + EL    + + +YD+D++  H+ +GEV
Sbjct:   80 LGKLQFSIDYDFQNNQLTVGVIQAAELPALDMGGTSDPYVKLFLMPDKKKK--YETKVHRKTLNPVFNESFV-FKVPYSELGGKTLVMAVYDFDRFSKHDIIGEV 181          
BLAST of Synaptotagmin VIa vs. Ensembl Sea Lamprey
Match: syt2a (synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503-315])

HSP 1 Score: 69.707 bits (169), Expect = 8.301e-14
Identity = 39/105 (37.14%), Postives = 57/105 (54.29%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEV 584
            LG + F + Y+ Q   L V + Q   L   D  GTSDPY  +   P  +    Y+T+V  KTLNPV+N  FV F   + EL    + + +YD+D++  H+ +GEV
Sbjct:   97 LGKLQFSIDYDFQNNQLTVGVIQAAELPALDMGGTSDPYVKLFLMPDKKKK--YETKVHRKTLNPVFNESFV-FKVPYSELGGKTLVMAVYDFDRFSKHDIIGEV 198          
BLAST of Synaptotagmin VIa vs. Ensembl Sea Lamprey
Match: SYT5 (synaptotagmin 5 [Source:HGNC Symbol;Acc:HGNC:11513])

HSP 1 Score: 66.6254 bits (161), Expect = 6.326e-13
Identity = 39/120 (32.50%), Postives = 60/120 (50.00%), Query Frame = 3
Query:  243 NIDPGI------DQGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEV 584
            +IDPG       +  LG + F L Y ++T    V I Q  +L   D  G SDPY  +   P  +    ++T V  KTLNP++   F F     EEL    + + +YD+D++  H+ +GE+
Sbjct:   64 DIDPGFIEDIYKENTLGRLQFSLDYNLKTSQFTVGILQATDLAAMDIGGMSDPYVRVYLLPHKKKK--FETSVHRKTLNPIFEEKFTF-TVPFEELVERVLVMVVYDFDRFSRHDIIGEL 180          
BLAST of Synaptotagmin VIa vs. Ensembl Yeast
Match: TCB3 (Cortical ER protein involved in ER-plasma membrane tethering; one of 6 proteins (Ist2p, Scs2p, Scs22p, Tcb1p, Tcb2p, Tcb3p) that connect ER to the plasma membrane (PM) and regulate PM phosphatidylinositol-4-phosphate (PI4P) levels by controlling access of Sac1p phosphatase to its substrate PI4P in the PM; localized to the bud via specific mRNA transport; non-tagged protein detected in a phosphorylated state in mitochondria; C-termini of Tcb1p, Tcb2p and Tcb3p interact [Source:SGD;Acc:S000004537])

HSP 1 Score: 50.447 bits (119), Expect = 5.358e-7
Identity = 29/99 (29.29%), Postives = 49/99 (49.49%), Query Frame = 3
Query:  309 TKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
            T  L + +  G  L   D  G SDP+  I  +    D  ++K+ +K KTL+PVWN        +     ++++   + DWD+ GD++ LG+   D+  L
Sbjct: 1133 TGYLNIKLISGHGLKSADRNGYSDPFVHIFVN----DKKVFKSNIKKKTLDPVWNEDAKIPILSRS---KNQVIFNVLDWDRAGDNDDLGQASLDVSSL 1224          
BLAST of Synaptotagmin VIa vs. Ensembl Nematostella
Match: EDO31746 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX17])

HSP 1 Score: 73.1738 bits (178), Expect = 4.014e-14
Identity = 39/105 (37.14%), Postives = 60/105 (57.14%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEV 584
            +G I+F L Y     TL V I + +++  KD  G+SDPY  I   P  +    Y+T+V  KTLNPV+N  FVF N  + E+    + + L+D+D++  H+ +GE 
Sbjct:   84 IGRINFTLDYSFTDNTLTVGIIRAEDIPAKDFSGSSDPYVKIMLLPDKKKK--YETKVHRKTLNPVFNEQFVFKNIPYSEITNRILLMELFDFDRFSRHDLIGEA 186          

HSP 2 Score: 54.6842 bits (130), Expect = 4.107e-8
Identity = 37/105 (35.24%), Postives = 55/105 (52.38%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEV 584
            LG I F LRY   +  L++ I + K+L   D  G SDPY  I      R     KT VK +TLNP +N  F  F    E++++  + I++ D+D+ G  E +G+ 
Sbjct:  221 LGDICFSLRYVPSSGKLQITIVEAKSLKSMDLTGYSDPYVKIALVQEGRKIKKKKTTVKKRTLNPYYNETFT-FTVAFEKIEQTSLIISVLDYDRVGKSEMIGKC 324          
BLAST of Synaptotagmin VIa vs. Ensembl Nematostella
Match: EDO41933 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S352])

HSP 1 Score: 71.2478 bits (173), Expect = 8.937e-14
Identity = 39/113 (34.51%), Postives = 57/113 (50.44%), Query Frame = 3
Query:  267 GLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
            GLGL+ F LRY+     L V +   K L   D  GTSDPY  +   P        ++  K KTLNPV+N    ++  T EE+    + + ++D D  G ++ +GE   +LK L
Sbjct:   18 GLGLLEFTLRYQKLDSRLDVVLHDAKGLKPMDHGGTSDPYVKLHLLPGASKSNKLRSHTKYKTLNPVFNETLTYYGITEEEISSKTLRLQVFDEDTIGRNDFIGETSINLKLL 130          

HSP 2 Score: 59.6918 bits (143), Expect = 6.497e-10
Identity = 33/109 (30.28%), Postives = 54/109 (49.54%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDL 596
            LG I   L+Y  Q   L V + +   L   D  G SDPY      P  +     +T ++ KTLNP +N  FV ++  H EL +  + +T++D+D    ++ +G V  ++
Sbjct:  154 LGRIQLALKYNTQRGMLFVTVMRCSGLASMDANGYSDPYVKCYLKPDPQKKSKRRTNIRKKTLNPEFNEEFV-YDIAHHELAKKSLEVTVWDYDVGKSNDFIGGVILNI 261          
BLAST of Synaptotagmin VIa vs. Ensembl Nematostella
Match: EDO43704 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXY7])

HSP 1 Score: 69.707 bits (169), Expect = 2.361e-13
Identity = 38/105 (36.19%), Postives = 56/105 (53.33%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEV 584
            LG I F L Y      L + + + + L  KD  GTSDP+  I   P  +     +T VK K LNPVWN VF F  F H +L    +++ + D+D++  ++ +GEV
Sbjct:    3 LGKIFFSLTYYSSDSVLTLKVLKAQGLPAKDFSGTSDPFVKIMLLPDKKHK--LETRVKRKNLNPVWNEVFTFEGFPHNKLMGKTLYMQVLDYDRFSRNDPIGEV 105          

HSP 2 Score: 55.0694 bits (131), Expect = 1.754e-8
Identity = 46/157 (29.30%), Postives = 73/157 (46.50%), Query Frame = 3
Query:  945 IEIKKNLQALPNSRSAYGEILVSLDYVIRNRTLNVKIIKARNM--IDPTKRALVPYCVLRHLFIGNDREKTKSIHRTSYRFYTDTPVWNEEFPLKVPPKKLKQTAVEIQVFHSTSESKPKDDEL-GLIRLGLKTYPAQKAHYIEFLGNIGKPIENWH 1406
            +   K+L      R   G++LVSL Y   N  + V ++KA  +  +D T  +  PY  ++   +  DR   K   +T+ +  T  PVWNE F   VP  K++       VF+     +   +EL G + LG +T  +   H+ E + N  KP+  WH
Sbjct:  119 LTFTKDLLPCKKDRVPLGDLLVSLMYQPTNNRIIVVVMKANKLKAMDLTGSS-DPY--VKMYIMHKDRRLDKK--KTTIKRRTRDPVWNESFIFDVPLDKIRDLTF---VFNVMDYDRITQNELIGQVILGYRTTGSSLRHWTEMMNNPRKPVAQWH 267          
BLAST of Synaptotagmin VIa vs. Ensembl Nematostella
Match: EDO32931 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STM9])

HSP 1 Score: 69.3218 bits (168), Expect = 1.714e-12
Identity = 41/110 (37.27%), Postives = 63/110 (57.27%), Query Frame = 3
Query:  291 LRYEVQTKTLKVNIFQGKNLVGKD----PRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVF-VFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
            L+Y +    L++ + + K+LV KD     +GTSDPYA++K   +      ++TE K +TLNP WN VF VF + +  +    +I I L+D D+  D EALG V  D+  +
Sbjct:  309 LKYPLPDGVLRIEVTEAKDLVAKDIAVFKKGTSDPYAMVKVGAQ-----TFRTETKKETLNPKWNEVFEVFVDNSQGQ----KIKIQLFDEDRASDDEALGSVEADISTV 409          
BLAST of Synaptotagmin VIa vs. Ensembl Nematostella
Match: EDO49802 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFY4])

HSP 1 Score: 67.3958 bits (163), Expect = 2.860e-12
Identity = 38/112 (33.93%), Postives = 62/112 (55.36%), Query Frame = 3
Query:  273 GLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKLH 608
            G I   L+Y  + + L V + + ++LV +D  G SDPY V++  P   ++   KT  K KTLNPV+N +F  F   H  L   ++  T++D D +G+ +  GE   DL +++
Sbjct:   31 GDIEMSLKYNHREQLLLVKVIRARDLVPRDLNGKSDPYVVLELVPDRLEEGTKKTRFKQKTLNPVFNEIFQ-FKVPHNNLTDTKLCATIWDHDFFGEDDFNGEAVVDLSRVN 141          
BLAST of Synaptotagmin VIa vs. Ensembl Medaka
Match: ENSORLT00000000569.2 (pep primary_assembly:ASM223467v1:12:1368783:1372867:-1 gene:ENSORLG00000000462.2 transcript:ENSORLT00000000569.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.6406 bits (187), Expect = 1.551e-15
Identity = 39/113 (34.51%), Postives = 56/113 (49.56%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKLH 608
            LG + F L YE +   L   I + K L   D  G +DPY  +   P        +T+    TLNP WN   V+   T E++ R  + +++ D DK+G +E +GE    LKKLH
Sbjct:   45 LGSLEFSLLYEQEGHALHCCIIKAKGLKPMDSNGLADPYVKLHLLPGASKSTKLRTKTLKNTLNPAWNETLVYHGITDEDMARKTLRLSVSDEDKFGHNEFIGETRVALKKLH 157          
BLAST of Synaptotagmin VIa vs. Ensembl Medaka
Match: syt7a (synaptotagmin-7-like [Source:NCBI gene;Acc:101169108])

HSP 1 Score: 78.1814 bits (191), Expect = 2.711e-15
Identity = 41/116 (35.34%), Postives = 66/116 (56.90%), Query Frame = 3
Query:  258 IDQGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
            I + LG I F + Y  Q  TL V + +G++L  KD  GTSDP+  I   P  +     +T+VK K LNP WN  F+F  F +E++    +++ + D+D++  ++ +GEV   L K+
Sbjct:  121 ISEKLGRIQFSIGYSFQNTTLTVKVLKGQDLPAKDFSGTSDPFVKIYLLPDKKHK--LETKVKRKNLNPHWNETFLFEGFPYEKVRERTLYLQVLDYDRFSRNDPIGEVSIPLNKV 234          

HSP 2 Score: 59.6918 bits (143), Expect = 3.079e-9
Identity = 48/157 (30.57%), Postives = 71/157 (45.22%), Query Frame = 3
Query:  957 KNLQALPNSRSAYGEILVSLDYVIRNRTLNVKIIKARNM----IDPTKRALVPYCVLRHLFIGNDREKTKSIHRTSYRFYTDTPVWNEEFPLKVPPKKLKQTAVEIQVFHSTSESKPKDDELGLIRLGLKTYPAQKAHYIEFLGNIGKPIENWHLIR 1415
            K L+   +     GE+LVSL Y     T+ V IIKARN+    I  T     PY  +  +      EK K++           PV+NE FP  VP   L++T + I V      S  ++D +G I L  K+ PA+  H+ + L      +  WH ++
Sbjct:  244 KELKPCSDGSGRRGELLVSLCYNPTANTITVNIIKARNLKAMDIGGTSD---PYVKVWLMHKDKRVEKKKTVVIKCCL----NPVFNESFPFDVPAHVLRETTIVITVMDKDRLS--RNDVIGKIYLSWKSGPAEVKHWKDMLARPRTNVAQWHALK 391          

HSP 3 Score: 48.9062 bits (115), Expect = 7.431e-6
Identity = 35/103 (33.98%), Postives = 49/103 (47.57%), Query Frame = 3
Query:  291 LRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLK 599
            L Y     T+ VNI + +NL   D  GTSDPY  +    + +     KT V    LNPV+N  F F    H  L    I IT+ D D+   ++ +G++Y   K
Sbjct:  263 LCYNPTANTITVNIIKARNLKAMDIGGTSDPYVKVWLMHKDKRVEKKKTVVIKCCLNPVFNESFPFDVPAH-VLRETTIVITVMDKDRLSRNDVIGKIYLSWK 364          
BLAST of Synaptotagmin VIa vs. Ensembl Medaka
Match: syt9b (synaptotagmin-9 [Source:NCBI gene;Acc:101171486])

HSP 1 Score: 78.9518 bits (193), Expect = 2.885e-15
Identity = 42/119 (35.29%), Postives = 70/119 (58.82%), Query Frame = 3
Query:  237 GRNIDPGIDQGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYD 593
            GR  D       G +HF+L++++  + L V I + ++L  KD  GTSDPY  I   P  +    ++T+V  KTLNPV++ VF+ F   + EL   ++H ++YD+D++  H+ +G+V  D
Sbjct:  228 GRRTD-----SCGRLHFILKFDLDLEQLIVKIHRAQDLPAKDFSGTSDPYVKIYLLPDRKTK--HQTKVHRKTLNPVFDEVFL-FPVAYAELSSRKLHFSVYDFDRFSRHDLIGQVVVD 338          

HSP 2 Score: 58.151 bits (139), Expect = 1.158e-8
Identity = 45/158 (28.48%), Postives = 78/158 (49.37%), Query Frame = 3
Query:  939 RRIEIKKNLQALPNSRSAYGEILVSLDYVIRNRTLNVKIIKARNM--IDPTKRALVPYCVLRHLFIGNDREKTKSIHRTSYRFYTDTPVWNEEFPLKVPPKKLKQTAVEIQVFHSTSESKPKDDELGLIRLGLKTYPAQKAHYIEFLGNIGKPIENWH 1406
            R  ++ +++Q + +     GE++ SL Y+     L + +IKARN+  +D T  A  PY  +  +  G   +K K    TS +  T  PV+NE     VPP+ + Q ++ I V     +    ++ +G+ R+G +     + H+ E L    KPI +WH
Sbjct:  348 RETKLCRDIQYVTSDNVDLGELMFSLCYLPTAGRLTITMIKARNLKAMDITG-ASDPYVKVSLMCEGRRLKKRK----TSTKRNTLNPVYNEAIVFDVPPENIDQISLLIAVMD--YDRVGHNEVIGVCRVGSEAESLGRDHWNEMLSYPRKPIAHWH 498          

HSP 3 Score: 57.7658 bits (138), Expect = 1.344e-8
Identity = 39/119 (32.77%), Postives = 58/119 (48.74%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALG--EVYYDLKKLHGKDH 620
            LG + F L Y      L + + + +NL   D  G SDPY  +      R     KT  K  TLNPV+N   V F+   E +D+  + I + D+D+ G +E +G   V  + + L G+DH
Sbjct:  366 LGELMFSLCYLPTAGRLTITMIKARNLKAMDITGASDPYVKVSLMCEGRRLKKRKTSTKRNTLNPVYNEAIV-FDVPPENIDQISLLIAVMDYDRVGHNEVIGVCRVGSEAESL-GRDH 482          
BLAST of Synaptotagmin VIa vs. Ensembl Medaka
Match: syt7a (synaptotagmin-7-like [Source:NCBI gene;Acc:101169108])

HSP 1 Score: 79.337 bits (194), Expect = 2.922e-15
Identity = 41/116 (35.34%), Postives = 66/116 (56.90%), Query Frame = 3
Query:  258 IDQGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKL 605
            I + LG I F + Y  Q  TL V + +G++L  KD  GTSDP+  I   P  +     +T+VK K LNP WN  F+F  F +E++    +++ + D+D++  ++ +GEV   L K+
Sbjct:  471 ISEKLGRIQFSIGYSFQNTTLTVKVLKGQDLPAKDFSGTSDPFVKIYLLPDKKHK--LETKVKRKNLNPHWNETFLFEGFPYEKVRERTLYLQVLDYDRFSRNDPIGEVSIPLNKV 584          

HSP 2 Score: 56.9954 bits (136), Expect = 2.800e-8
Identity = 48/157 (30.57%), Postives = 71/157 (45.22%), Query Frame = 3
Query:  957 KNLQALPNSRSAYGEILVSLDYVIRNRTLNVKIIKARNM----IDPTKRALVPYCVLRHLFIGNDREKTKSIHRTSYRFYTDTPVWNEEFPLKVPPKKLKQTAVEIQVFHSTSESKPKDDELGLIRLGLKTYPAQKAHYIEFLGNIGKPIENWHLIR 1415
            K L+   +     GE+LVSL Y     T+ V IIKARN+    I  T     PY  +  +      EK K++           PV+NE FP  VP   L++T + I V      S  ++D +G I L  K+ PA+  H+ + L      +  WH ++
Sbjct:  594 KELKPCSDGSGRRGELLVSLCYNPTANTITVNIIKARNLKAMDIGGTSD---PYVKVWLMHKDKRVEKKKTVVIKCCL----NPVFNESFPFDVPAHVLRETTIVITVMDKDRLS--RNDVIGKIYLSWKSGPAEVKHWKDMLARPRTNVAQWHALK 741          

HSP 3 Score: 48.9062 bits (115), Expect = 9.407e-6
Identity = 34/103 (33.01%), Postives = 49/103 (47.57%), Query Frame = 3
Query:  291 LRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLK 599
            L Y     T+ VNI + +NL   D  GTSDPY  +    + +     KT V    LNPV+N  F  F+     L    I IT+ D D+   ++ +G++Y   K
Sbjct:  613 LCYNPTANTITVNIIKARNLKAMDIGGTSDPYVKVWLMHKDKRVEKKKTVVIKCCLNPVFNESFP-FDVPAHVLRETTIVITVMDKDRLSRNDVIGKIYLSWK 714          
BLAST of Synaptotagmin VIa vs. Ensembl Medaka
Match: syt9b (synaptotagmin-9 [Source:NCBI gene;Acc:101171486])

HSP 1 Score: 78.5666 bits (192), Expect = 3.318e-15
Identity = 42/119 (35.29%), Postives = 70/119 (58.82%), Query Frame = 3
Query:  237 GRNIDPGIDQGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYD 593
            GR  D       G +HF+L++++  + L V I + ++L  KD  GTSDPY  I   P  +    ++T+V  KTLNPV++ VF+ F   + EL   ++H ++YD+D++  H+ +G+V  D
Sbjct:  228 GRRTD-----SCGRLHFILKFDLDLEQLIVKIHRAQDLPAKDFSGTSDPYVKIYLLPDRKTK--HQTKVHRKTLNPVFDEVFL-FPVAYAELSSRKLHFSVYDFDRFSRHDLIGQVVVD 338          

HSP 2 Score: 58.151 bits (139), Expect = 1.124e-8
Identity = 39/119 (32.77%), Postives = 58/119 (48.74%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALG--EVYYDLKKLHGKDH 620
            LG + F L Y      L + + + +NL   D  G SDPY  +      R     KT  K  TLNPV+N   V F+   E +D+  + I + D+D+ G +E +G   V  + + L G+DH
Sbjct:  366 LGELMFSLCYLPTAGRLTITMIKARNLKAMDITGASDPYVKVSLMCEGRRLKKRKTSTKRNTLNPVYNEAIV-FDVPPENIDQISLLIAVMDYDRVGHNEVIGVCRVGSEAESL-GRDH 482          

HSP 3 Score: 57.7658 bits (138), Expect = 1.410e-8
Identity = 45/158 (28.48%), Postives = 78/158 (49.37%), Query Frame = 3
Query:  939 RRIEIKKNLQALPNSRSAYGEILVSLDYVIRNRTLNVKIIKARNM--IDPTKRALVPYCVLRHLFIGNDREKTKSIHRTSYRFYTDTPVWNEEFPLKVPPKKLKQTAVEIQVFHSTSESKPKDDELGLIRLGLKTYPAQKAHYIEFLGNIGKPIENWH 1406
            R  ++ +++Q + +     GE++ SL Y+     L + +IKARN+  +D T  A  PY  +  +  G   +K K    TS +  T  PV+NE     VPP+ + Q ++ I V     +    ++ +G+ R+G +     + H+ E L    KPI +WH
Sbjct:  348 RETKLCRDIQYVTSDNVDLGELMFSLCYLPTAGRLTITMIKARNLKAMDITG-ASDPYVKVSLMCEGRRLKKRK----TSTKRNTLNPVYNEAIVFDVPPENIDQISLLIAVMD--YDRVGHNEVIGVCRVGSEAESLGRDHWNEMLSYPRKPIAHWH 498          
BLAST of Synaptotagmin VIa vs. Planmine SMEST
Match: SMESG000043595.1 (SMESG000043595.1)

HSP 1 Score: 760.755 bits (1963), Expect = 0.000e+0
Identity = 415/415 (100.00%), Postives = 415/415 (100.00%), Query Frame = 3
Query:  174 KKTKLXXXXXXXXXXXXXXIIGRNIDPGIDQGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKLHGKDHEEKEEDQPNEYAESLNVEKLSIKEWVETTNSKYGIEEPPKELEPITEEDEKAVQKSASMIFNXXXXXXXXXXXXXXXXXXXXXXXPDAEGNMNGDDEENIPTVNVIRRIEIKKNLQALPNSRSAYGEILVSLDYVIRNRTLNVKIIKARNMIDPTKRALVPYCVLRHLFIGNDREKTKSIHRTSYRFYTDTPVWNEEFPLKVPPKKLKQTAVEIQVFHSTSESKPKDDELGLIRLGLKTYPAQKAHYIEFLGNIGKPIENWHLIRK 1418
            KKTKLEDEFEEPEPERPLPIIGRNIDPGIDQGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKLHGKDHEEKEEDQPNEYAESLNVEKLSIKEWVETTNSKYGIEEPPKELEPITEEDEKAVQKSASMIFNEHYDEYEEMEEEDEEELEYQNDEPDAEGNMNGDDEENIPTVNVIRRIEIKKNLQALPNSRSAYGEILVSLDYVIRNRTLNVKIIKARNMIDPTKRALVPYCVLRHLFIGNDREKTKSIHRTSYRFYTDTPVWNEEFPLKVPPKKLKQTAVEIQVFHSTSESKPKDDELGLIRLGLKTYPAQKAHYIEFLGNIGKPIENWHLIRK
Sbjct:   35 KKTKLEDEFEEPEPERPLPIIGRNIDPGIDQGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKLHGKDHEEKEEDQPNEYAESLNVEKLSIKEWVETTNSKYGIEEPPKELEPITEEDEKAVQKSASMIFNEHYDEYEEMEEEDEEELEYQNDEPDAEGNMNGDDEENIPTVNVIRRIEIKKNLQALPNSRSAYGEILVSLDYVIRNRTLNVKIIKARNMIDPTKRALVPYCVLRHLFIGNDREKTKSIHRTSYRFYTDTPVWNEEFPLKVPPKKLKQTAVEIQVFHSTSESKPKDDELGLIRLGLKTYPAQKAHYIEFLGNIGKPIENWHLIRK 449          

HSP 2 Score: 65.0846 bits (157), Expect = 4.264e-11
Identity = 32/33 (96.97%), Postives = 32/33 (96.97%), Query Frame = 1
Query:   82 EEITIIDVIKDLRKLWPLSVIFPEAVKETHEKK 180
             EITIIDVIKDLRKLWPLSVIFPEAVKETHEKK
Sbjct:    4 NEITIIDVIKDLRKLWPLSVIFPEAVKETHEKK 36          
BLAST of Synaptotagmin VIa vs. Planmine SMEST
Match: SMESG000040037.1 (SMESG000040037.1)

HSP 1 Score: 69.707 bits (169), Expect = 1.397e-12
Identity = 42/132 (31.82%), Postives = 69/132 (52.27%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPR-GTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKLH---GKDHEEKEEDQPNEY 653
            LG + F   Y+ Q + L V+I +  +L  KD + GTSDPY  ++  P  R     KT+++ KTLNPV+   F F +FT  ++    +H  +  +D++   + +GEV   L +L    G +    +E QP  +
Sbjct:  134 LGSLEFSASYDNQKQILSVSILRCCDLPSKDTQLGTSDPYVKLQLLPEKRQR--VKTQIQRKTLNPVFGETFTFNSFTLNQVKSTSLHFVVLSFDRFSRDDIIGEVVCPLMELDLNLGSEVVLTKEIQPRRF 263          

HSP 2 Score: 50.447 bits (119), Expect = 1.892e-6
Identity = 42/146 (28.77%), Postives = 64/146 (43.84%), Query Frame = 3
Query:  261 DQGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRG-TSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKLHGKDHEEKEEDQPNEYAESLNVEKLSIKEW 695
            D   G I   + ++   K L V I + +NL   D  G   DPY  +      +     KT VK +TLNPV+N  F F    +E L    I + + D+D+   +E +G +      + G    EKEE     + E +N  +  + EW
Sbjct:  267 DDDRGEILLSICHQPAAKMLTVVILKARNLPKTDATGLAGDPYVKLYLVQNGQRLAKKKTHVKKRTLNPVYNQSFSFDLQDNENLLNIAIELLIMDYDRVTKNEVIGRL------MIGYGFGEKEE---QHWTEVINNPRKQMAEW 403          
BLAST of Synaptotagmin VIa vs. Planmine SMEST
Match: SMESG000040037.1 (SMESG000040037.1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.563e-12
Identity = 42/132 (31.82%), Postives = 69/132 (52.27%), Query Frame = 3
Query:  270 LGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPR-GTSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKLH---GKDHEEKEEDQPNEY 653
            LG + F   Y+ Q + L V+I +  +L  KD + GTSDPY  ++  P  R     KT+++ KTLNPV+   F F +FT  ++    +H  +  +D++   + +GEV   L +L    G +    +E QP  +
Sbjct:  121 LGSLEFSASYDNQKQILSVSILRCCDLPSKDTQLGTSDPYVKLQLLPEKRQR--VKTQIQRKTLNPVFGETFTFNSFTLNQVKSTSLHFVVLSFDRFSRDDIIGEVVCPLMELDLNLGSEVVLTKEIQPRRF 250          

HSP 2 Score: 50.0618 bits (118), Expect = 2.273e-6
Identity = 42/146 (28.77%), Postives = 64/146 (43.84%), Query Frame = 3
Query:  261 DQGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRG-TSDPYAVIKFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKLHGKDHEEKEEDQPNEYAESLNVEKLSIKEW 695
            D   G I   + ++   K L V I + +NL   D  G   DPY  +      +     KT VK +TLNPV+N  F F    +E L    I + + D+D+   +E +G +      + G    EKEE     + E +N  +  + EW
Sbjct:  254 DDDRGEILLSICHQPAAKMLTVVILKARNLPKTDATGLAGDPYVKLYLVQNGQRLAKKKTHVKKRTLNPVYNQSFSFDLQDNENLLNIAIELLIMDYDRVTKNEVIGRL------MIGYGFGEKEE---QHWTEVINNPRKQMAEW 390          
BLAST of Synaptotagmin VIa vs. Planmine SMEST
Match: SMESG000059797.1 (SMESG000059797.1)

HSP 1 Score: 65.855 bits (159), Expect = 1.712e-11
Identity = 42/132 (31.82%), Postives = 72/132 (54.55%), Query Frame = 3
Query:  264 QGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVI--KFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKLHGKDHEE--KEEDQPN 647
            + LG + + ++Y  ++++L+V +  G +L+  +  GTSDPY  +  K  P+ +    ++T+VK +T NPV+N  F  F  + EEL    +    YD+D++  HE +G +  DL  L      E   E DQP+
Sbjct:   62 ESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLK----FETKVKRRTRNPVFNEDFT-FTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPS 188          
BLAST of Synaptotagmin VIa vs. Planmine SMEST
Match: SMESG000059797.1 (SMESG000059797.1)

HSP 1 Score: 65.855 bits (159), Expect = 1.838e-11
Identity = 42/132 (31.82%), Postives = 72/132 (54.55%), Query Frame = 3
Query:  264 QGLGLIHFLLRYEVQTKTLKVNIFQGKNLVGKDPRGTSDPYAVI--KFDPRFRDDWLYKTEVKMKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDLKKLHGKDHEE--KEEDQPN 647
            + LG + + ++Y  ++++L+V +  G +L+  +  GTSDPY  +  K  P+ +    ++T+VK +T NPV+N  F  F  + EEL    +    YD+D++  HE +G +  DL  L      E   E DQP+
Sbjct:   59 ESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLK----FETKVKRRTRNPVFNEDFT-FTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPS 185          
The following BLAST results are available for this feature:
BLAST of Synaptotagmin VIa vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYT91.910e-1435.45synaptotagmin 9 [Source:HGNC Symbol;Acc:HGNC:19265... [more]
RPH3A3.172e-1433.04rabphilin 3A [Source:HGNC Symbol;Acc:HGNC:17056][more]
RPH3A3.172e-1433.04rabphilin 3A [Source:HGNC Symbol;Acc:HGNC:17056][more]
RPH3A3.172e-1433.04rabphilin 3A [Source:HGNC Symbol;Acc:HGNC:17056][more]
RPH3A3.734e-1433.04rabphilin 3A [Source:HGNC Symbol;Acc:HGNC:17056][more]
back to top
BLAST of Synaptotagmin VIa vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snt-13.078e-1134.82Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
snt-14.072e-1134.82Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
snt-31.303e-1031.25SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5... [more]
snt-31.303e-1031.25SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5... [more]
rbf-11.844e-1032.81Rabphilin-1 [Source:UniProtKB/Swiss-Prot;Acc:P418... [more]
back to top
BLAST of Synaptotagmin VIa vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syt71.026e-1735.54gene:FBgn0039900 transcript:FBtr0305658[more]
Syt71.242e-1735.54gene:FBgn0039900 transcript:FBtr0089139[more]
Syt71.389e-1735.54gene:FBgn0039900 transcript:FBtr0089134[more]
Syt72.438e-1735.65gene:FBgn0039900 transcript:FBtr0343990[more]
Syt72.438e-1735.65gene:FBgn0039900 transcript:FBtr0089137[more]
back to top
BLAST of Synaptotagmin VIa vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt7a2.359e-1536.21synaptotagmin VIIa [Source:ZFIN;Acc:ZDB-GENE-09060... [more]
syt7a4.846e-1536.21synaptotagmin VIIa [Source:ZFIN;Acc:ZDB-GENE-09060... [more]
syt9a6.648e-1535.78synaptotagmin IXa [Source:ZFIN;Acc:ZDB-GENE-031002... [more]
syt7b8.492e-1535.71synaptotagmin VIIb [Source:ZFIN;Acc:ZDB-GENE-09060... [more]
syt7b1.246e-1434.48synaptotagmin VIIb [Source:ZFIN;Acc:ZDB-GENE-09060... [more]
back to top
BLAST of Synaptotagmin VIa vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RPH3A1.090e-1434.82rabphilin 3A [Source:NCBI gene;Acc:100487950][more]
RPH3A1.838e-1434.82rabphilin 3A [Source:NCBI gene;Acc:100487950][more]
wnt61.879e-1435.78Wnt family member 6 [Source:Xenbase;Acc:XB-GENE-48... [more]
RPH3A1.897e-1434.82rabphilin 3A [Source:NCBI gene;Acc:100487950][more]
RPH3A2.321e-1434.82rabphilin 3A [Source:NCBI gene;Acc:100487950][more]
back to top
BLAST of Synaptotagmin VIa vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syt94.880e-1435.45synaptotagmin IX [Source:MGI Symbol;Acc:MGI:192637... [more]
Syt71.137e-1334.21synaptotagmin VII [Source:MGI Symbol;Acc:MGI:18595... [more]
Syt71.146e-1334.82synaptotagmin VII [Source:MGI Symbol;Acc:MGI:18595... [more]
Syt71.154e-1334.21synaptotagmin VII [Source:MGI Symbol;Acc:MGI:18595... [more]
Syt71.205e-1334.82synaptotagmin VII [Source:MGI Symbol;Acc:MGI:18595... [more]
back to top
BLAST of Synaptotagmin VIa vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P24507|SY63_DIPOM2.394e-1437.96Synaptotagmin-C OS=Diplobatis ommata OX=1870830 GN... [more]
sp|Q9Y2J0|RP3A_HUMAN1.523e-1333.04Rabphilin-3A OS=Homo sapiens OX=9606 GN=RPH3A PE=1... [more]
sp|Q86SS6|SYT9_HUMAN2.350e-1335.45Synaptotagmin-9 OS=Homo sapiens OX=9606 GN=SYT9 PE... [more]
sp|Q06846|RP3A_BOVIN2.496e-1333.04Rabphilin-3A OS=Bos taurus OX=9913 GN=RPH3A PE=1 S... [more]
sp|Q9R0N9|SYT9_MOUSE3.414e-1335.45Synaptotagmin-9 OS=Mus musculus OX=10090 GN=Syt9 P... [more]
back to top
BLAST of Synaptotagmin VIa vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D7EJD01.357e-1536.84Synaptotagmin 1-like Protein OS=Tribolium castaneu... [more]
D3TS752.989e-1535.65Synaptotagmin OS=Glossina morsitans morsitans OX=3... [more]
U4UCS34.159e-1536.84C2 domain-containing protein OS=Dendroctonus ponde... [more]
N6T9P15.262e-1536.84C2 domain-containing protein (Fragment) OS=Dendroc... [more]
A0A1A9Z2286.455e-1535.20C2 domain-containing protein OS=Glossina pallidipe... [more]
back to top
BLAST of Synaptotagmin VIa vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt9b1.239e-1536.13synaptotagmin 9 [Source:NCBI gene;Acc:103033725][more]
syt6a2.256e-1538.18synaptotagmin-6-like [Source:NCBI gene;Acc:1030413... [more]
syt6a2.474e-1538.18synaptotagmin-6-like [Source:NCBI gene;Acc:1030413... [more]
syt7a3.102e-1536.21synaptotagmin VIIa [Source:ZFIN;Acc:ZDB-GENE-09060... [more]
syt9a3.234e-1538.10synaptotagmin IXa [Source:ZFIN;Acc:ZDB-GENE-031002... [more]
back to top
BLAST of Synaptotagmin VIa vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYT69.426e-1638.89synaptotagmin 6 [Source:HGNC Symbol;Acc:HGNC:18638... [more]
SYT62.364e-1536.67synaptotagmin 6 [Source:HGNC Symbol;Acc:HGNC:18638... [more]
syt2a7.285e-1437.14synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
syt2a8.301e-1437.14synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
SYT56.326e-1332.50synaptotagmin 5 [Source:HGNC Symbol;Acc:HGNC:11513... [more]
back to top
BLAST of Synaptotagmin VIa vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TCB35.358e-729.29Cortical ER protein involved in ER-plasma membrane... [more]
back to top
BLAST of Synaptotagmin VIa vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO317464.014e-1437.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419338.937e-1434.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437042.361e-1336.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329311.714e-1237.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498022.860e-1233.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Synaptotagmin VIa vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000000569.21.551e-1534.51pep primary_assembly:ASM223467v1:12:1368783:137286... [more]
syt7a2.711e-1535.34synaptotagmin-7-like [Source:NCBI gene;Acc:1011691... [more]
syt9b2.885e-1535.29synaptotagmin-9 [Source:NCBI gene;Acc:101171486][more]
syt7a2.922e-1535.34synaptotagmin-7-like [Source:NCBI gene;Acc:1011691... [more]
syt9b3.318e-1535.29synaptotagmin-9 [Source:NCBI gene;Acc:101171486][more]
back to top
BLAST of Synaptotagmin VIa vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043595.14.264e-11100.00SMESG000043595.1[more]
SMESG000040037.11.397e-1231.82SMESG000040037.1[more]
SMESG000040037.11.563e-1231.82SMESG000040037.1[more]
SMESG000059797.11.712e-1131.82SMESG000059797.1[more]
SMESG000059797.11.838e-1131.82SMESG000059797.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022848 ID=SMED30022848|Name=Synaptotagmin VIa|organism=Schmidtea mediterranea sexual|type=transcript|length=1451bp
GTTTGTTTTATCGATTAAATTTTCTGTTTGTATCAACAGCTTTATTGTTC
ACATTTCACAATGGATTTAAATGAGAATGGTGAGGAAATAACTATTATCG
ATGTAATAAAAGATTTGAGAAAGTTATGGCCTTTATCGGTTATATTTCCT
GAAGCTGTGAAAGAAACTCATGAAAAAAAACTAAACTAGAAGATGAATTT
GAGGAACCAGAACCTGAAAGACCTCTTCCCATAATCGGACGTAACATAGA
TCCTGGTATTGACCAAGGATTGGGTTTGATACATTTTTTGTTAAGATATG
AAGTACAAACTAAGACATTAAAAGTAAATATATTCCAAGGAAAGAATTTA
GTGGGAAAAGATCCTCGAGGTACCAGTGATCCATATGCAGTAATAAAATT
TGATCCGAGATTTCGTGATGATTGGTTATACAAAACTGAAGTCAAAATGA
AGACATTAAATCCAGTTTGGAATCATGTATTTGTGTTTTTCAATTTCACT
CACGAGGAACTTGACAGACATAGGATCCATATCACATTATATGACTGGGA
TAAATATGGGGACCATGAGGCACTGGGAGAGGTTTATTATGATCTTAAGA
AGTTACATGGAAAAGATCACGAAGAAAAGGAAGAAGATCAGCCAAATGAA
TACGCAGAATCGTTGAACGTTGAAAAGCTTTCAATTAAAGAATGGGTTGA
AACCACGAATTCGAAATACGGCATTGAAGAACCTCCCAAGGAATTGGAGC
CAATAACCGAAGAAGACGAAAAAGCTGTACAAAAAAGTGCTTCTATGATT
TTCAATGAACACTATGATGAATACGAAGAAATGGAGGAAGAAGACGAAGA
GGAATTAGAATATCAAAACGATGAACCCGATGCAGAGGGAAATATGAATG
GTGATGATGAAGAAAATATACCAACTGTGAATGTGATACGTAGAATTGAA
ATTAAAAAAAATCTTCAGGCTTTGCCAAATTCAAGAAGTGCATATGGAGA
AATTTTGGTATCCCTCGATTATGTAATTAGAAATAGAACTTTGAATGTTA
AGATAATAAAAGCCAGAAATATGATTGATCCAACTAAACGGGCTTTAGTG
CCATACTGTGTTTTAAGGCATTTATTTATCGGCAACGACCGTGAGAAAAC
CAAAAGTATTCATAGGACATCTTACAGATTTTATACAGACACTCCAGTTT
GGAATGAAGAATTTCCTTTGAAAGTTCCACCAAAAAAATTAAAACAAACC
GCAGTTGAAATACAAGTCTTTCATAGCACAAGTGAATCTAAACCAAAAGA
TGATGAACTCGGTCTAATTCGGCTTGGTTTGAAAACATATCCAGCTCAAA
AAGCTCATTATATAGAATTCTTGGGGAATATTGGAAAGCCGATAGAAAAT
TGGCATTTGATAAGGAAGTAAAAAGTCATTCGTTCTTCACTCGTCGGAAA
G
back to top

protein sequence of SMED30022848-orf-1

>SMED30022848-orf-1 ID=SMED30022848-orf-1|Name=SMED30022848-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=325bp
MKTLNPVWNHVFVFFNFTHEELDRHRIHITLYDWDKYGDHEALGEVYYDL
KKLHGKDHEEKEEDQPNEYAESLNVEKLSIKEWVETTNSKYGIEEPPKEL
EPITEEDEKAVQKSASMIFNEHYDEYEEMEEEDEEELEYQNDEPDAEGNM
NGDDEENIPTVNVIRRIEIKKNLQALPNSRSAYGEILVSLDYVIRNRTLN
VKIIKARNMIDPTKRALVPYCVLRHLFIGNDREKTKSIHRTSYRFYTDTP
VWNEEFPLKVPPKKLKQTAVEIQVFHSTSESKPKDDELGLIRLGLKTYPA
QKAHYIEFLGNIGKPIENWHLIRK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007340acrosome reaction
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
Vocabulary: INTERPRO
TermDefinition
IPR001565Synaptotagmin
IPR000008C2_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding