NEPH-3

Overview
NameNEPH-3 (AKN21716.1)
Smed IDSMED30022844
Length (bp)2279
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NEPH-3 (SMED30022844) t-SNE clustered cells

Violin plots show distribution of expression levels for NEPH-3 (SMED30022844) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NEPH-3 (SMED30022844) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NEPH-3 (SMED30022844) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022844

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30022844SMESG000022777.1 dd_Smed_v4_11280_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30022844SMESG000022777.1 dd_Smed_v4_11280_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30022844SMESG000022777.1 dd_Smed_v4_11280_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30022844SMESG000022777.1 dd_Smed_v4_11280_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30022844SMESG000022777.1 dd_Smed_v4_11280_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022844SMESG000022777.1 dd_Smed_v4_11280_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30022844SMESG000022777.1 dd_Smed_v4_11280_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30022844SMESG000022777.1 dd_Smed_v4_11280_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30022844SMESG000022777.1 dd_Smed_v4_11280_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30022844SMESG000022777.1 dd_Smed_v4_11280_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022844SMESG000022777.1 Contig49819newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022844SMESG000022777.1 Contig49819uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022844SMESG000022777.1 Contig31165newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022844SMESG000022777.1 Contig31165uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30022844SMESG000022777.1 dd_Smed_v6_11280_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NEPH-3 vs. Ensembl Human
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:HGNC Symbol;Acc:HGNC:23204])

HSP 1 Score: 90.8929 bits (224), Expect = 1.523e-19
Identity = 61/221 (27.60%), Postives = 98/221 (44.34%), Query Frame = 3
Query:  351 CATSKSIGCN--STNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVTSVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVGAT 995
            C  + ++G    S  + V +GP    +  SL +    +G +    C   GNP   I W +  S  V++    L    ++ +D G Y+C+A V       + + L   GPP I +    +   G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ V S L I ++   DF   YNC+    +GSD   I L  +   PM +I+G  
Sbjct:  314 CEVTNALGSTNLSRTVDVYFGPRMTTEPQSLLV---DLGSDAIFSCAWTGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPP--DRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQESVPMAVIIGVA 529          

HSP 2 Score: 26.5646 bits (57), Expect = 1.523e-19
Identity = 19/86 (22.09%), Postives = 34/86 (39.53%), Query Frame = 1
Query:    4 RYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAW 261
            R  +V++L +    ++NG  + C A N      K      +  V         V    +    +E+++V F CSA   P+   + W
Sbjct:  205 RESIVSTLFISPGDVENGQSIVCRATNKAIPGGK------ETSVTIDIQHPPLVNLSVEPQPVLEDNVVTFHCSAKANPAVTQYRW 284          
BLAST of NEPH-3 vs. Ensembl Human
Match: KIRREL1 (kirre like nephrin family adhesion molecule 1 [Source:HGNC Symbol;Acc:HGNC:15734])

HSP 1 Score: 89.3521 bits (220), Expect = 8.646e-18
Identity = 59/184 (32.07%), Postives = 86/184 (46.74%), Query Frame = 3
Query:  453 IGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVTSVLHILSVQPHDF-GDYNCSVSTKYGSDMATIILLRKSETPMLMIVGAT 995
            IG ++ + C   GNP   +TW +  SN V++  + LL   +   D G Y C+A V       + + L   GPP I + +V Y   G   ++ C I S P P  + I W +K   L  GT  R+ + R  +   V S L I +V   DF   YNC+    +G   A I L  +   P+ +I GAT
Sbjct:  157 IGSDVTLTCVWVGNPPLTLTWTKKDSNMVLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPIISSEAVQYAVRGDGGKVECFIGSTPPP--DRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPVGIIAGAT 338          
BLAST of NEPH-3 vs. Ensembl Human
Match: KIRREL1 (kirre like nephrin family adhesion molecule 1 [Source:HGNC Symbol;Acc:HGNC:15734])

HSP 1 Score: 89.3521 bits (220), Expect = 1.001e-17
Identity = 59/184 (32.07%), Postives = 86/184 (46.74%), Query Frame = 3
Query:  453 IGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVTSVLHILSVQPHDF-GDYNCSVSTKYGSDMATIILLRKSETPMLMIVGAT 995
            IG ++ + C   GNP   +TW +  SN V++  + LL   +   D G Y C+A V       + + L   GPP I + +V Y   G   ++ C I S P P  + I W +K   L  GT  R+ + R  +   V S L I +V   DF   YNC+    +G   A I L  +   P+ +I GAT
Sbjct:  221 IGSDVTLTCVWVGNPPLTLTWTKKDSNMVLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPIISSEAVQYAVRGDGGKVECFIGSTPPP--DRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPVGIIAGAT 402          
BLAST of NEPH-3 vs. Ensembl Human
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:HGNC Symbol;Acc:HGNC:23204])

HSP 1 Score: 84.3445 bits (207), Expect = 1.306e-17
Identity = 62/233 (26.61%), Postives = 98/233 (42.06%), Query Frame = 3
Query:  351 CATSKSIGCN--STNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVTSVLHILSVQPHDFGD-YNCSVSTKYGSDMATIIL------------LRKSETPMLMIVGAT 995
            C  + ++G    S  + V +GP    +  SL +    +G +    C   GNP   I W +  S  V++    L    ++ +D G Y+C+A V       + + L   GPP I +    +   G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ V S L I ++   DF   YNC+    +GSD   I L            L     PM +I+G  
Sbjct:  314 CEVTNALGSTNLSRTVDVYFGPRMTTEPQSLLV---DLGSDAIFSCAWTGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPP--DRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMKSGAGLEAESVPMAVIIGVA 541          

HSP 2 Score: 26.5646 bits (57), Expect = 1.306e-17
Identity = 19/86 (22.09%), Postives = 34/86 (39.53%), Query Frame = 1
Query:    4 RYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAW 261
            R  +V++L +    ++NG  + C A N      K      +  V         V    +    +E+++V F CSA   P+   + W
Sbjct:  205 RESIVSTLFISPGDVENGQSIVCRATNKAIPGGK------ETSVTIDIQHPPLVNLSVEPQPVLEDNVVTFHCSAKANPAVTQYRW 284          
BLAST of NEPH-3 vs. Ensembl Human
Match: KIRREL1 (kirre like nephrin family adhesion molecule 1 [Source:HGNC Symbol;Acc:HGNC:15734])

HSP 1 Score: 88.9669 bits (219), Expect = 1.402e-17
Identity = 59/184 (32.07%), Postives = 86/184 (46.74%), Query Frame = 3
Query:  453 IGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVTSVLHILSVQPHDF-GDYNCSVSTKYGSDMATIILLRKSETPMLMIVGAT 995
            IG ++ + C   GNP   +TW +  SN V++  + LL   +   D G Y C+A V       + + L   GPP I + +V Y   G   ++ C I S P P  + I W +K   L  GT  R+ + R  +   V S L I +V   DF   YNC+    +G   A I L  +   P+ +I GAT
Sbjct:  321 IGSDVTLTCVWVGNPPLTLTWTKKDSNMVLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPIISSEAVQYAVRGDGGKVECFIGSTPPP--DRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPVGIIAGAT 502          
BLAST of NEPH-3 vs. Ensembl Celegans
Match: syg-1 (Synaptogenesis protein syg-1 [Source:UniProtKB/Swiss-Prot;Acc:B1Q236])

HSP 1 Score: 72.0182 bits (175), Expect = 9.728e-13
Identity = 46/179 (25.70%), Postives = 78/179 (43.58%), Query Frame = 3
Query:  456 GENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQL-LEGTRHKMYRQINEKIVTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVG 989
            G+N    C    NP P I W R  S+E+I  G  L   +++    G+Y C A V+ F ++    YL  +GPP +           ++  + C I     P  N ++W    K++     R  +++        S+L I  ++  DFG YNCS +   G D    +L +++    ++I  
Sbjct:  371 GDNAFFHCATLANPAPAIFWTRGDSDEIIGHGENLTLENVRTWQQGNYNCTATVEGFRKQILSHYLHIRGPPTVSMKDEVSASLDEATEIICEISG--RPKTNNVRWTVNGKEINFNNGRITVHQYPKPYGKESILKIKDLKEEDFGVYNCSANNGLGFDNRGTLLKKRNILDWIVITA 547          
BLAST of NEPH-3 vs. Ensembl Celegans
Match: syg-1 (Synaptogenesis protein syg-1 [Source:UniProtKB/Swiss-Prot;Acc:B1Q236])

HSP 1 Score: 72.0182 bits (175), Expect = 1.024e-12
Identity = 46/179 (25.70%), Postives = 78/179 (43.58%), Query Frame = 3
Query:  456 GENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQL-LEGTRHKMYRQINEKIVTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVG 989
            G+N    C    NP P I W R  S+E+I  G  L   +++    G+Y C A V+ F ++    YL  +GPP +           ++  + C I     P  N ++W    K++     R  +++        S+L I  ++  DFG YNCS +   G D    +L +++    ++I  
Sbjct:  371 GDNAFFHCATLANPAPAIFWTRGDSDEIIGHGENLTLENVRTWQQGNYNCTATVEGFRKQILSHYLHIRGPPTVSMKDEVSASLDEATEIICEISG--RPKTNNVRWTVNGKEINFNNGRITVHQYPKPYGKESILKIKDLKEEDFGVYNCSANNGLGFDNRGTLLKKRNILDWIVITA 547          
BLAST of NEPH-3 vs. Ensembl Celegans
Match: pxn-2 (PeroXidasiN (Drosophila peroxidase) homolog [Source:UniProtKB/TrEMBL;Acc:G5EG78])

HSP 1 Score: 62.3882 bits (150), Expect = 1.096e-9
Identity = 52/179 (29.05%), Postives = 80/179 (44.69%), Query Frame = 3
Query:  456 GENMQMECRADGNPEPLITW----QRISS---NEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKY-IYLGEKGPPEIKN-PSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSE 965
            GE ++++C A G P P ITW    Q+++    +++   GS+L        D G Y C A+  E  + H + + L E   P I + P  +    GQ   L C  K  P P   ++ W+F+  ++    R+  Y   +  I    L I  V  HD G + C      GS +AT  LL  +E
Sbjct:  366 GETLELKCEASGEPTPTITWLFEKQKLTESRKHKLTKNGSVLKIFPFLNTDIGQYECVASNGEESKSHIFSVSLKESEQPVIIDAPMDTNATIGQQVTLRCNAKGFPVP---DVVWLFEGIRI--PRRNTRYTISDNNI---ELTIEKVTRHDSGVFTCQAVNSVGSAVATANLLVGAE 536          
BLAST of NEPH-3 vs. Ensembl Celegans
Match: rig-5 (NeuRonal IGCAM [Source:UniProtKB/TrEMBL;Acc:H2FLI8])

HSP 1 Score: 57.7658 bits (138), Expect = 1.661e-8
Identity = 48/215 (22.33%), Postives = 85/215 (39.53%), Query Frame = 3
Query:  345 TCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEV-----------IARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSY-GREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKI-VTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIIL 950
            +C   ++ I  ++  + VK  P    S    +     G N+ + C+ADGNP P + W+R     +           +  G +L    +      +Y+C A+    P+    + L    PP ++  S +     G  AR+ CT ++ P P   E+ W    + + E     M   ++ +     +L I +VQ   FG Y C      G   + + L
Sbjct:  119 SCQINTEPITLSTGELDVKVPPVVSRSTPAAVEVRE-GNNVSLTCKADGNPTPTVIWRRQDRQIIRYNGATGFGASVFHGPVLHLTKVSRKHMSEYLCVASNGIPPDESWTVKLLVTFPPLVQAQSETVQASVGSMARMVCTTEAWPRP---EMGWEKDGEPVYESNNVAMTHTVSGQYHSVHILEIRNVQSSHFGVYRCVAKNDNGIHHSQVTL 329          
BLAST of NEPH-3 vs. Ensembl Celegans
Match: wrk-1 (Wrapper/Rega-1/Klingon homolog [Source:UniProtKB/TrEMBL;Acc:H2KZN8])

HSP 1 Score: 57.3806 bits (137), Expect = 2.186e-8
Identity = 54/209 (25.84%), Postives = 94/209 (44.98%), Query Frame = 3
Query:  390 ILVKYGPNFKDSDSLTIYAASIGE-NMQMECRA-DGNPEPLITWQRISSN--EVIAR---GSILLRNDIQADDFGDYICKAAVKEFPERHKY-IYLGEKGPPEIKNPSVSY-GREGQSARLSCTIKSIPFPNDNEIKWIFKNKQL-LEGTRHKMYRQINEKI---VTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPML 977
            I V+  P    S    +Y A +GE N+ + C   +GNP+P + W + ++   E I R   G+ ++  +++    G Y C A      +R    I++ EK  P +KN       R+ Q+A   CT    P P   +++W+F   ++     + K   +  +++     S L +  +    FGDY C +S K GS  A + +  +   P L
Sbjct:  109 IKVQVKPLVVISPDTGVYHARVGEKNLVITCHVKEGNPKPGVVWTKQAAKLPEDIKREHGGARIVITEVKKHHAGKYNCLAENIAGSDRATIDIHVAEK--PWVKNEDTFIPVRKNQNASFWCTYDGTPVP---QVEWLFNGYKINFNDEKFKKTSETAQRLNGYSKSTLTVGDISEEAFGDYACRISNKLGSVTAVVHVSGRPGPPQL 312          
BLAST of NEPH-3 vs. Ensembl Fly
Match: rst (gene:FBgn0003285 transcript:FBtr0343758)

HSP 1 Score: 95.1301 bits (235), Expect = 4.429e-22
Identity = 67/223 (30.04%), Postives = 102/223 (45.74%), Query Frame = 3
Query:  342 ITCCATSKSIGC--NSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKI---VTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLM-IVGA 992
            I  C    S+G   +S  + + Y P+F+         A +G  + + C  D NP+P I W +  S+ V+   S  L   +  +  G Y CKA V  + E     Y+  KG P I +    YG  G +AR+ C   S+  P    + W F  +++   + H  Y  + + +   V S L I   Q + +G YNC+V   YG+D+A I L  K    +LM IVG 
Sbjct:  322 IVKCEVQNSVGKSEDSETLDISYAPSFRQRPQSM--EADVGSVVSLTCEVDSNPQPEIVWIQHPSDRVVGT-STNLTFSVSNETAGRYYCKANVPGYAEISADAYVYLKGSPAIGSQRTQYGLVGDTARIECFASSV--PRARHVSWTFNGQEISSESGHD-YSILVDAVPGGVKSTLIIRDSQAYHYGKYNCTVVNDYGNDVAEIQLQAKKSVSLLMTIVGG 538          

HSP 2 Score: 30.0314 bits (66), Expect = 4.429e-22
Identity = 11/33 (33.33%), Postives = 16/33 (48.48%), Query Frame = 1
Query:  190 FIENDIVEFTCSASGRPSDFHWAWTIGDESLVN 288
             +E+  V   C A   PSD  + W I DE ++ 
Sbjct:  271 IVEHSQVRLECRADANPSDVRYRWFINDEPIIG 303          
BLAST of NEPH-3 vs. Ensembl Fly
Match: rst (gene:FBgn0003285 transcript:FBtr0070562)

HSP 1 Score: 95.1301 bits (235), Expect = 4.429e-22
Identity = 67/223 (30.04%), Postives = 102/223 (45.74%), Query Frame = 3
Query:  342 ITCCATSKSIGC--NSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKI---VTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLM-IVGA 992
            I  C    S+G   +S  + + Y P+F+         A +G  + + C  D NP+P I W +  S+ V+   S  L   +  +  G Y CKA V  + E     Y+  KG P I +    YG  G +AR+ C   S+  P    + W F  +++   + H  Y  + + +   V S L I   Q + +G YNC+V   YG+D+A I L  K    +LM IVG 
Sbjct:  322 IVKCEVQNSVGKSEDSETLDISYAPSFRQRPQSM--EADVGSVVSLTCEVDSNPQPEIVWIQHPSDRVVGT-STNLTFSVSNETAGRYYCKANVPGYAEISADAYVYLKGSPAIGSQRTQYGLVGDTARIECFASSV--PRARHVSWTFNGQEISSESGHD-YSILVDAVPGGVKSTLIIRDSQAYHYGKYNCTVVNDYGNDVAEIQLQAKKSVSLLMTIVGG 538          

HSP 2 Score: 30.0314 bits (66), Expect = 4.429e-22
Identity = 11/33 (33.33%), Postives = 16/33 (48.48%), Query Frame = 1
Query:  190 FIENDIVEFTCSASGRPSDFHWAWTIGDESLVN 288
             +E+  V   C A   PSD  + W I DE ++ 
Sbjct:  271 IVEHSQVRLECRADANPSDVRYRWFINDEPIIG 303          
BLAST of NEPH-3 vs. Ensembl Fly
Match: kirre (gene:FBgn0028369 transcript:FBtr0332492)

HSP 1 Score: 87.0409 bits (214), Expect = 7.668e-18
Identity = 69/232 (29.74%), Postives = 104/232 (44.83%), Query Frame = 3
Query:  318 NSSRSWK-KITCCATSKSIGCN--STNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQL-LEGTRHKMY----RQINEKIVTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRK-SETPMLMIV 986
            N SR +   I  C    ++G +  S  + + +GP F+         A +G  + M C   GNPEP I W   +S++V+   +  L+  + ++  G Y CKA V  FPE      L  K  P I +  V +G  G   ++ C   SI  P    I W F+ K + +      +Y      + E  V + L I   +   FG YNC+V   YG D   I LLR+    P+L++V
Sbjct:  349 NVSRQYHDAIVKCEVVNAVGKSEQSKKLDISFGPVFRQRP--VSVEADLGATVSMRCDVAGNPEPEIEWISENSDQVVGVAA-ELKLKVSSETAGRYFCKAVVNGFPEIGAEATLYVKRAPIITSHKVQFGGVGGRVKIDCLAFSI--PKAEHILWSFEGKIINMSSADPDIYIFEEHHLPEG-VRAALIIRDSKATHFGKYNCTVMNSYGGDSLVITLLREPGNIPVLLVV 574          

HSP 2 Score: 23.483 bits (49), Expect = 7.668e-18
Identity = 8/23 (34.78%), Postives = 11/23 (47.83%), Query Frame = 1
Query:  208 VEFTCSASGRPSDFHWAWTIGDE 276
            V  +C A   P +  + W I DE
Sbjct:  313 VILSCQADANPHELSYRWFINDE 335          
BLAST of NEPH-3 vs. Ensembl Fly
Match: kirre (gene:FBgn0028369 transcript:FBtr0309498)

HSP 1 Score: 87.0409 bits (214), Expect = 7.668e-18
Identity = 69/232 (29.74%), Postives = 104/232 (44.83%), Query Frame = 3
Query:  318 NSSRSWK-KITCCATSKSIGCN--STNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQL-LEGTRHKMY----RQINEKIVTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRK-SETPMLMIV 986
            N SR +   I  C    ++G +  S  + + +GP F+         A +G  + M C   GNPEP I W   +S++V+   +  L+  + ++  G Y CKA V  FPE      L  K  P I +  V +G  G   ++ C   SI  P    I W F+ K + +      +Y      + E  V + L I   +   FG YNC+V   YG D   I LLR+    P+L++V
Sbjct:  349 NVSRQYHDAIVKCEVVNAVGKSEQSKKLDISFGPVFRQRP--VSVEADLGATVSMRCDVAGNPEPEIEWISENSDQVVGVAA-ELKLKVSSETAGRYFCKAVVNGFPEIGAEATLYVKRAPIITSHKVQFGGVGGRVKIDCLAFSI--PKAEHILWSFEGKIINMSSADPDIYIFEEHHLPEG-VRAALIIRDSKATHFGKYNCTVMNSYGGDSLVITLLREPGNIPVLLVV 574          

HSP 2 Score: 23.483 bits (49), Expect = 7.668e-18
Identity = 8/23 (34.78%), Postives = 11/23 (47.83%), Query Frame = 1
Query:  208 VEFTCSASGRPSDFHWAWTIGDE 276
            V  +C A   P +  + W I DE
Sbjct:  313 VILSCQADANPHELSYRWFINDE 335          
BLAST of NEPH-3 vs. Ensembl Fly
Match: kirre (gene:FBgn0028369 transcript:FBtr0070560)

HSP 1 Score: 87.0409 bits (214), Expect = 7.668e-18
Identity = 69/232 (29.74%), Postives = 104/232 (44.83%), Query Frame = 3
Query:  318 NSSRSWK-KITCCATSKSIGCN--STNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQL-LEGTRHKMY----RQINEKIVTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRK-SETPMLMIV 986
            N SR +   I  C    ++G +  S  + + +GP F+         A +G  + M C   GNPEP I W   +S++V+   +  L+  + ++  G Y CKA V  FPE      L  K  P I +  V +G  G   ++ C   SI  P    I W F+ K + +      +Y      + E  V + L I   +   FG YNC+V   YG D   I LLR+    P+L++V
Sbjct:  349 NVSRQYHDAIVKCEVVNAVGKSEQSKKLDISFGPVFRQRP--VSVEADLGATVSMRCDVAGNPEPEIEWISENSDQVVGVAA-ELKLKVSSETAGRYFCKAVVNGFPEIGAEATLYVKRAPIITSHKVQFGGVGGRVKIDCLAFSI--PKAEHILWSFEGKIINMSSADPDIYIFEEHHLPEG-VRAALIIRDSKATHFGKYNCTVMNSYGGDSLVITLLREPGNIPVLLVV 574          

HSP 2 Score: 23.483 bits (49), Expect = 7.668e-18
Identity = 8/23 (34.78%), Postives = 11/23 (47.83%), Query Frame = 1
Query:  208 VEFTCSASGRPSDFHWAWTIGDE 276
            V  +C A   P +  + W I DE
Sbjct:  313 VILSCQADANPHELSYRWFINDE 335          
BLAST of NEPH-3 vs. Ensembl Zebrafish
Match: kirrel3a (kirre like nephrin family adhesion molecule 3a [Source:ZFIN;Acc:ZDB-GENE-091117-44])

HSP 1 Score: 86.2705 bits (212), Expect = 5.608e-20
Identity = 60/220 (27.27%), Postives = 97/220 (44.09%), Query Frame = 3
Query:  351 CATSKSIGCN--STNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVTSVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVGA 992
            C  + ++G    S N+ V +GP    +  SL +     G +    C   GNP   I W +     V++  + L    ++ +D G Y+C+A V       K + L   GPP I +        G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ V S L + ++ P DF   YNC+    +GSD   I L  +    + +I+G 
Sbjct:  244 CEVTNALGSTNISRNVDVYFGPRLAAEPQSLQV---DRGSDAVFSCAWIGNPSLTIVWMKRGHGVVLSNENTLTLKAVRQEDAGKYVCRAVVPRVGVGEKEVMLTVNGPPSISSTQTQQALYGEKGQIKCFIRSTPPP--DRIAWSWKETVLESGTSGRYTVETVSTEEGVISTLTMRNIVPTDFQTIYNCTAWNSFGSDTEIIRLKEQGSLRLAVIIGV 458          

HSP 2 Score: 31.9574 bits (71), Expect = 5.608e-20
Identity = 24/110 (21.82%), Postives = 44/110 (40.00%), Query Frame = 1
Query:    4 RYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDH 333
            R   V++L +   ++++G  + C A N    N K      +  V         V    +    +E ++V+F C+A   P   H+ W  G   + +     Y++    VDH
Sbjct:  135 RESTVSTLHISASNIESGQQITCRASNKAAPNGK------EATVTIDIQHFPLVNLSVEPQPVLEGNLVKFHCAAKANPPVTHYRWAKGGSMITDATGDTYEV---LVDH 235          
BLAST of NEPH-3 vs. Ensembl Zebrafish
Match: kirrel3a (kirre like nephrin family adhesion molecule 3a [Source:ZFIN;Acc:ZDB-GENE-091117-44])

HSP 1 Score: 85.8853 bits (211), Expect = 6.816e-20
Identity = 60/220 (27.27%), Postives = 97/220 (44.09%), Query Frame = 3
Query:  351 CATSKSIGCN--STNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVTSVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVGA 992
            C  + ++G    S N+ V +GP    +  SL +     G +    C   GNP   I W +     V++  + L    ++ +D G Y+C+A V       K + L   GPP I +        G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ V S L + ++ P DF   YNC+    +GSD   I L  +    + +I+G 
Sbjct:  287 CEVTNALGSTNISRNVDVYFGPRLAAEPQSLQV---DRGSDAVFSCAWIGNPSLTIVWMKRGHGVVLSNENTLTLKAVRQEDAGKYVCRAVVPRVGVGEKEVMLTVNGPPSISSTQTQQALYGEKGQIKCFIRSTPPP--DRIAWSWKETVLESGTSGRYTVETVSTEEGVISTLTMRNIVPTDFQTIYNCTAWNSFGSDTEIIRLKEQGSLRLAVIIGV 501          

HSP 2 Score: 31.9574 bits (71), Expect = 6.816e-20
Identity = 24/110 (21.82%), Postives = 44/110 (40.00%), Query Frame = 1
Query:    4 RYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDH 333
            R   V++L +   ++++G  + C A N    N K      +  V         V    +    +E ++V+F C+A   P   H+ W  G   + +     Y++    VDH
Sbjct:  178 RESTVSTLHISASNIESGQQITCRASNKAAPNGK------EATVTIDIQHFPLVNLSVEPQPVLEGNLVKFHCAAKANPPVTHYRWAKGGSMITDATGDTYEV---LVDH 278          
BLAST of NEPH-3 vs. Ensembl Zebrafish
Match: kirrel3a (kirre like nephrin family adhesion molecule 3a [Source:ZFIN;Acc:ZDB-GENE-091117-44])

HSP 1 Score: 85.8853 bits (211), Expect = 6.816e-20
Identity = 60/220 (27.27%), Postives = 97/220 (44.09%), Query Frame = 3
Query:  351 CATSKSIGCN--STNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVTSVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVGA 992
            C  + ++G    S N+ V +GP    +  SL +     G +    C   GNP   I W +     V++  + L    ++ +D G Y+C+A V       K + L   GPP I +        G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ V S L + ++ P DF   YNC+    +GSD   I L  +    + +I+G 
Sbjct:  287 CEVTNALGSTNISRNVDVYFGPRLAAEPQSLQV---DRGSDAVFSCAWIGNPSLTIVWMKRGHGVVLSNENTLTLKAVRQEDAGKYVCRAVVPRVGVGEKEVMLTVNGPPSISSTQTQQALYGEKGQIKCFIRSTPPP--DRIAWSWKETVLESGTSGRYTVETVSTEEGVISTLTMRNIVPTDFQTIYNCTAWNSFGSDTEIIRLKEQGSLRLAVIIGV 501          

HSP 2 Score: 31.9574 bits (71), Expect = 6.816e-20
Identity = 24/110 (21.82%), Postives = 44/110 (40.00%), Query Frame = 1
Query:    4 RYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDH 333
            R   V++L +   ++++G  + C A N    N K      +  V         V    +    +E ++V+F C+A   P   H+ W  G   + +     Y++    VDH
Sbjct:  178 RESTVSTLHISASNIESGQQITCRASNKAAPNGK------EATVTIDIQHFPLVNLSVEPQPVLEGNLVKFHCAAKANPPVTHYRWAKGGSMITDATGDTYEV---LVDH 278          
BLAST of NEPH-3 vs. Ensembl Zebrafish
Match: kirrel3a (kirre like nephrin family adhesion molecule 3a [Source:ZFIN;Acc:ZDB-GENE-091117-44])

HSP 1 Score: 85.5001 bits (210), Expect = 9.923e-20
Identity = 60/220 (27.27%), Postives = 97/220 (44.09%), Query Frame = 3
Query:  351 CATSKSIGCN--STNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVTSVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVGA 992
            C  + ++G    S N+ V +GP    +  SL +     G +    C   GNP   I W +     V++  + L    ++ +D G Y+C+A V       K + L   GPP I +        G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ V S L + ++ P DF   YNC+    +GSD   I L  +    + +I+G 
Sbjct:  287 CEVTNALGSTNISRNVDVYFGPRLAAEPQSLQV---DRGSDAVFSCAWIGNPSLTIVWMKRGHGVVLSNENTLTLKAVRQEDAGKYVCRAVVPRVGVGEKEVMLTVNGPPSISSTQTQQALYGEKGQIKCFIRSTPPP--DRIAWSWKETVLESGTSGRYTVETVSTEEGVISTLTMRNIVPTDFQTIYNCTAWNSFGSDTEIIRLKEQGSLRLAVIIGV 501          

HSP 2 Score: 31.9574 bits (71), Expect = 9.923e-20
Identity = 24/110 (21.82%), Postives = 44/110 (40.00%), Query Frame = 1
Query:    4 RYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDH 333
            R   V++L +   ++++G  + C A N    N K      +  V         V    +    +E ++V+F C+A   P   H+ W  G   + +     Y++    VDH
Sbjct:  178 RESTVSTLHISASNIESGQQITCRASNKAAPNGK------EATVTIDIQHFPLVNLSVEPQPVLEGNLVKFHCAAKANPPVTHYRWAKGGSMITDATGDTYEV---LVDH 278          
BLAST of NEPH-3 vs. Ensembl Zebrafish
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:HGNC Symbol;Acc:HGNC:23204])

HSP 1 Score: 87.0409 bits (214), Expect = 5.464e-19
Identity = 60/206 (29.13%), Postives = 92/206 (44.66%), Query Frame = 3
Query:  351 CATSKSIGCN--STNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVTSVLHILSVQPHDFGD-YNCSVSTKYGSDMATIIL 950
            C  +  +G    S N+ V +GP    +  SL +    +G +    C   GNP   I W +  S  V++  +IL    ++ +D G Y+C+A V       K + L   GPP I +        G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E  V S L + ++ P DF   YNC+    +GSD   I L
Sbjct:  300 CEVTNPLGSTNISRNVDVYFGPRMAAEPQSLQV---DLGSDAVFNCAWTGNPSLTIVWMKRGSGVVLSNENILTLKSVRQEDAGKYVCRAVVPRVGAAEKEVSLTVNGPPTISSTQTHQAPHGEKGQIKCFIRSTPPP--DRIAWSWKETVLESGTSGRYTVETVSTEDGVLSTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRL 500          

HSP 2 Score: 27.7202 bits (60), Expect = 5.464e-19
Identity = 24/110 (21.82%), Postives = 44/110 (40.00%), Query Frame = 1
Query:    4 RYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDH 333
            R   V++L +   ++++G  + C A N    N K      +  V      +  V    +    +E ++V+F CSA   P    + W  G   +  +    Y++    VDH
Sbjct:  191 RESTVSTLYISASNIESGQKIICRASNKAVPNGK------ETSVTIDIQHLPLVNLSVEPQPVLEGNLVKFHCSAKANPPVTQYKWAKGGSVIKEVSGDTYEVI---VDH 291          
BLAST of NEPH-3 vs. Ensembl Xenopus
Match: igfbp4 (insulin like growth factor binding protein 4 [Source:Xenbase;Acc:XB-GENE-484795])

HSP 1 Score: 100.523 bits (249), Expect = 2.189e-23
Identity = 66/220 (30.00%), Postives = 100/220 (45.45%), Query Frame = 3
Query:  351 CATSKSIGCNSTNILV--KYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVTSVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVGAT 995
            C     +G  + + LV  ++ P        T     +G ++ + C   GNP   +TW +  SN V++ G+ L    ++ +D G Y+CKA V       + + L   GPP I +  V Y   G   ++ C I S P P  + I W +K   L  GT  R+ + R  +   V S L I +V   DF   YNC+    +G   A I LL +   P+ +I GAT
Sbjct:  289 CEVHNEVGSTNVSTLVDVQFAPRVVVEPKPT--TTDMGSDVTLTCIWAGNPPLTLTWTKKGSNMVLSNGNQLFLKSVKQEDAGPYVCKAIVPRIGVGEREVTLFVNGPPIIASEEVQYAARGDKGKVECFIGSTPPP--DRIAWAWKENVLETGTLERYTVERTTSTSGVLSTLTINNVMESDFQTRYNCTAWNSFGPGTAIIQLLEREVVPVGIIAGAT 504          

HSP 2 Score: 30.0314 bits (66), Expect = 2.189e-23
Identity = 13/41 (31.71%), Postives = 21/41 (51.22%), Query Frame = 1
Query:  196 ENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKI 318
            E + V FTCSA+  P    + W  G   + + RD  Y+ ++
Sbjct:  238 EGERVRFTCSATANPEIKGYRWAKGGMIIESARDSSYETQV 278          
BLAST of NEPH-3 vs. Ensembl Xenopus
Match: igfbp4 (insulin like growth factor binding protein 4 [Source:Xenbase;Acc:XB-GENE-484795])

HSP 1 Score: 100.523 bits (249), Expect = 2.259e-23
Identity = 66/220 (30.00%), Postives = 100/220 (45.45%), Query Frame = 3
Query:  351 CATSKSIGCNSTNILV--KYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVTSVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVGAT 995
            C     +G  + + LV  ++ P        T     +G ++ + C   GNP   +TW +  SN V++ G+ L    ++ +D G Y+CKA V       + + L   GPP I +  V Y   G   ++ C I S P P  + I W +K   L  GT  R+ + R  +   V S L I +V   DF   YNC+    +G   A I LL +   P+ +I GAT
Sbjct:  287 CEVHNEVGSTNVSTLVDVQFAPRVVVEPKPT--TTDMGSDVTLTCIWAGNPPLTLTWTKKGSNMVLSNGNQLFLKSVKQEDAGPYVCKAIVPRIGVGEREVTLFVNGPPIIASEEVQYAARGDKGKVECFIGSTPPP--DRIAWAWKENVLETGTLERYTVERTTSTSGVLSTLTINNVMESDFQTRYNCTAWNSFGPGTAIIQLLEREVVPVGIIAGAT 502          

HSP 2 Score: 30.0314 bits (66), Expect = 2.259e-23
Identity = 13/41 (31.71%), Postives = 21/41 (51.22%), Query Frame = 1
Query:  196 ENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKI 318
            E + V FTCSA+  P    + W  G   + + RD  Y+ ++
Sbjct:  236 EGERVRFTCSATANPEIKGYRWAKGGMIIESARDSSYETQV 276          
BLAST of NEPH-3 vs. Ensembl Xenopus
Match: igfbp4 (insulin like growth factor binding protein 4 [Source:Xenbase;Acc:XB-GENE-484795])

HSP 1 Score: 100.138 bits (248), Expect = 2.373e-23
Identity = 66/220 (30.00%), Postives = 100/220 (45.45%), Query Frame = 3
Query:  351 CATSKSIGCNSTNILV--KYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVTSVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVGAT 995
            C     +G  + + LV  ++ P        T     +G ++ + C   GNP   +TW +  SN V++ G+ L    ++ +D G Y+CKA V       + + L   GPP I +  V Y   G   ++ C I S P P  + I W +K   L  GT  R+ + R  +   V S L I +V   DF   YNC+    +G   A I LL +   P+ +I GAT
Sbjct:  285 CEVHNEVGSTNVSTLVDVQFAPRVVVEPKPT--TTDMGSDVTLTCIWAGNPPLTLTWTKKGSNMVLSNGNQLFLKSVKQEDAGPYVCKAIVPRIGVGEREVTLFVNGPPIIASEEVQYAARGDKGKVECFIGSTPPP--DRIAWAWKENVLETGTLERYTVERTTSTSGVLSTLTINNVMESDFQTRYNCTAWNSFGPGTAIIQLLEREVVPVGIIAGAT 500          

HSP 2 Score: 30.0314 bits (66), Expect = 2.373e-23
Identity = 13/41 (31.71%), Postives = 21/41 (51.22%), Query Frame = 1
Query:  196 ENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKI 318
            E + V FTCSA+  P    + W  G   + + RD  Y+ ++
Sbjct:  234 EGERVRFTCSATANPEIKGYRWAKGGMIIESARDSSYETQV 274          
BLAST of NEPH-3 vs. Ensembl Xenopus
Match: igfbp4 (insulin like growth factor binding protein 4 [Source:Xenbase;Acc:XB-GENE-484795])

HSP 1 Score: 100.138 bits (248), Expect = 2.396e-23
Identity = 66/220 (30.00%), Postives = 100/220 (45.45%), Query Frame = 3
Query:  351 CATSKSIGCNSTNILV--KYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVTSVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVGAT 995
            C     +G  + + LV  ++ P        T     +G ++ + C   GNP   +TW +  SN V++ G+ L    ++ +D G Y+CKA V       + + L   GPP I +  V Y   G   ++ C I S P P  + I W +K   L  GT  R+ + R  +   V S L I +V   DF   YNC+    +G   A I LL +   P+ +I GAT
Sbjct:  292 CEVHNEVGSTNVSTLVDVQFAPRVVVEPKPT--TTDMGSDVTLTCIWAGNPPLTLTWTKKGSNMVLSNGNQLFLKSVKQEDAGPYVCKAIVPRIGVGEREVTLFVNGPPIIASEEVQYAARGDKGKVECFIGSTPPP--DRIAWAWKENVLETGTLERYTVERTTSTSGVLSTLTINNVMESDFQTRYNCTAWNSFGPGTAIIQLLEREVVPVGIIAGAT 507          

HSP 2 Score: 30.0314 bits (66), Expect = 2.396e-23
Identity = 13/41 (31.71%), Postives = 21/41 (51.22%), Query Frame = 1
Query:  196 ENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKI 318
            E + V FTCSA+  P    + W  G   + + RD  Y+ ++
Sbjct:  241 EGERVRFTCSATANPEIKGYRWAKGGMIIESARDSSYETQV 281          
BLAST of NEPH-3 vs. Ensembl Xenopus
Match: igfbp4 (insulin like growth factor binding protein 4 [Source:Xenbase;Acc:XB-GENE-484795])

HSP 1 Score: 100.138 bits (248), Expect = 2.580e-23
Identity = 66/220 (30.00%), Postives = 100/220 (45.45%), Query Frame = 3
Query:  351 CATSKSIGCNSTNILV--KYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVTSVLHILSVQPHDF-GDYNCSVSTKYGSDMATIILLRKSETPMLMIVGAT 995
            C     +G  + + LV  ++ P        T     +G ++ + C   GNP   +TW +  SN V++ G+ L    ++ +D G Y+CKA V       + + L   GPP I +  V Y   G   ++ C I S P P  + I W +K   L  GT  R+ + R  +   V S L I +V   DF   YNC+    +G   A I LL +   P+ +I GAT
Sbjct:  237 CEVHNEVGSTNVSTLVDVQFAPRVVVEPKPT--TTDMGSDVTLTCIWAGNPPLTLTWTKKGSNMVLSNGNQLFLKSVKQEDAGPYVCKAIVPRIGVGEREVTLFVNGPPIIASEEVQYAARGDKGKVECFIGSTPPP--DRIAWAWKENVLETGTLERYTVERTTSTSGVLSTLTINNVMESDFQTRYNCTAWNSFGPGTAIIQLLEREVVPVGIIAGAT 452          

HSP 2 Score: 30.0314 bits (66), Expect = 2.580e-23
Identity = 13/41 (31.71%), Postives = 21/41 (51.22%), Query Frame = 1
Query:  196 ENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKI 318
            E + V FTCSA+  P    + W  G   + + RD  Y+ ++
Sbjct:  186 EGERVRFTCSATANPEIKGYRWAKGGMIIESARDSSYETQV 226          
BLAST of NEPH-3 vs. Ensembl Mouse
Match: Kirrel3 (kirre like nephrin family adhesion molecule 3 [Source:MGI Symbol;Acc:MGI:1914953])

HSP 1 Score: 90.5077 bits (223), Expect = 8.218e-20
Identity = 61/220 (27.73%), Postives = 98/220 (44.55%), Query Frame = 3
Query:  351 CATSKSIGCN--STNILVKYGPNF-KDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVTSVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVGA 992
            C  + ++G    S  + V +GP    +  SL +    +G +    C   GNP   I W +  S  V++    L    ++ +D G Y+C+A V       + + L   GPP I +    +   G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ V S L I ++   DF   YNC+    +GSD   I L  +   PM +I+G 
Sbjct:  281 CEVTNALGSTNLSRTVDVYFGPRMTSEPQSLLV---DLGSDAVFSCAWIGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPP--DRIAWSWKENVLESGTSGRYTVETVNTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQESVPMAVIIGV 495          

HSP 2 Score: 27.335 bits (59), Expect = 8.218e-20
Identity = 20/86 (23.26%), Postives = 34/86 (39.53%), Query Frame = 1
Query:    4 RYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAW 261
            R  +V++L +    ++NG  + C A N      K      +  V         V    +    +E++IV F CSA   P+   + W
Sbjct:  172 RESIVSTLFISPGDVENGQSIVCRATNKAIPGGK------ETSVTIDIQHPPLVNLSVEPQPVLEDNIVTFHCSAKANPAVTQYRW 251          
BLAST of NEPH-3 vs. Ensembl Mouse
Match: Kirrel3 (kirre like nephrin family adhesion molecule 3 [Source:MGI Symbol;Acc:MGI:1914953])

HSP 1 Score: 90.5077 bits (223), Expect = 8.218e-20
Identity = 61/220 (27.73%), Postives = 98/220 (44.55%), Query Frame = 3
Query:  351 CATSKSIGCN--STNILVKYGPNF-KDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVTSVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVGA 992
            C  + ++G    S  + V +GP    +  SL +    +G +    C   GNP   I W +  S  V++    L    ++ +D G Y+C+A V       + + L   GPP I +    +   G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ V S L I ++   DF   YNC+    +GSD   I L  +   PM +I+G 
Sbjct:  281 CEVTNALGSTNLSRTVDVYFGPRMTSEPQSLLV---DLGSDAVFSCAWIGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPP--DRIAWSWKENVLESGTSGRYTVETVNTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQESVPMAVIIGV 495          

HSP 2 Score: 27.335 bits (59), Expect = 8.218e-20
Identity = 20/86 (23.26%), Postives = 34/86 (39.53%), Query Frame = 1
Query:    4 RYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAW 261
            R  +V++L +    ++NG  + C A N      K      +  V         V    +    +E++IV F CSA   P+   + W
Sbjct:  172 RESIVSTLFISPGDVENGQSIVCRATNKAIPGGK------ETSVTIDIQHPPLVNLSVEPQPVLEDNIVTFHCSAKANPAVTQYRW 251          
BLAST of NEPH-3 vs. Ensembl Mouse
Match: Kirrel3 (kirre like nephrin family adhesion molecule 3 [Source:MGI Symbol;Acc:MGI:1914953])

HSP 1 Score: 90.1225 bits (222), Expect = 1.076e-19
Identity = 61/220 (27.73%), Postives = 98/220 (44.55%), Query Frame = 3
Query:  351 CATSKSIGCN--STNILVKYGPNF-KDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVTSVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVGA 992
            C  + ++G    S  + V +GP    +  SL +    +G +    C   GNP   I W +  S  V++    L    ++ +D G Y+C+A V       + + L   GPP I +    +   G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ V S L I ++   DF   YNC+    +GSD   I L  +   PM +I+G 
Sbjct:  314 CEVTNALGSTNLSRTVDVYFGPRMTSEPQSLLV---DLGSDAVFSCAWIGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPP--DRIAWSWKENVLESGTSGRYTVETVNTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQESVPMAVIIGV 528          

HSP 2 Score: 27.335 bits (59), Expect = 1.076e-19
Identity = 20/86 (23.26%), Postives = 34/86 (39.53%), Query Frame = 1
Query:    4 RYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAW 261
            R  +V++L +    ++NG  + C A N      K      +  V         V    +    +E++IV F CSA   P+   + W
Sbjct:  205 RESIVSTLFISPGDVENGQSIVCRATNKAIPGGK------ETSVTIDIQHPPLVNLSVEPQPVLEDNIVTFHCSAKANPAVTQYRW 284          
BLAST of NEPH-3 vs. Ensembl Mouse
Match: Kirrel3 (kirre like nephrin family adhesion molecule 3 [Source:MGI Symbol;Acc:MGI:1914953])

HSP 1 Score: 90.1225 bits (222), Expect = 1.082e-19
Identity = 61/220 (27.73%), Postives = 98/220 (44.55%), Query Frame = 3
Query:  351 CATSKSIGCN--STNILVKYGPNF-KDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVTSVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVGA 992
            C  + ++G    S  + V +GP    +  SL +    +G +    C   GNP   I W +  S  V++    L    ++ +D G Y+C+A V       + + L   GPP I +    +   G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ V S L I ++   DF   YNC+    +GSD   I L  +   PM +I+G 
Sbjct:  281 CEVTNALGSTNLSRTVDVYFGPRMTSEPQSLLV---DLGSDAVFSCAWIGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPP--DRIAWSWKENVLESGTSGRYTVETVNTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQESVPMAVIIGV 495          

HSP 2 Score: 27.335 bits (59), Expect = 1.082e-19
Identity = 20/86 (23.26%), Postives = 34/86 (39.53%), Query Frame = 1
Query:    4 RYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAW 261
            R  +V++L +    ++NG  + C A N      K      +  V         V    +    +E++IV F CSA   P+   + W
Sbjct:  172 RESIVSTLFISPGDVENGQSIVCRATNKAIPGGK------ETSVTIDIQHPPLVNLSVEPQPVLEDNIVTFHCSAKANPAVTQYRW 251          
BLAST of NEPH-3 vs. Ensembl Mouse
Match: Kirrel (kirre like nephrin family adhesion molecule 1 [Source:MGI Symbol;Acc:MGI:1891396])

HSP 1 Score: 88.5817 bits (218), Expect = 9.610e-19
Identity = 64/222 (28.83%), Postives = 98/222 (44.14%), Query Frame = 3
Query:  351 CATSKSIGCNSTNILVKYGPNFKDSDSLTIY----AASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVTSVLHILSVQPHDF-GDYNCSVSTKYGSDMATIILLRKSETPMLMIVGAT 995
            C     +G  + + LV    N   +  + +Y       IG ++ + C   GNP   +TW +  SN V++  + LL   +   D G Y C+A V       + + L   GPP I + +V +   G   ++ C I S P P  + I W +K   L  GT  R+ + R  +   V S L I +V   DF   YNC+    +G   A I L  +   P+ +I GAT
Sbjct:  319 CEVYNKVGSTNVSTLV----NVHFAPRIVVYPKPTTTDIGSDVTLTCVWVGNPPLTLTWTKKDSNMVLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPIISSEAVQFAVRGDGGKVECFIGSTPPP--DRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPVGIIAGAT 534          

HSP 2 Score: 25.409 bits (54), Expect = 9.610e-19
Identity = 19/105 (18.10%), Postives = 38/105 (36.19%), Query Frame = 1
Query:    4 RYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKI 318
            R   ++ L ++   L  G    C ++N    N K      +  +         V    +    +E + V FTC A+  P    + W  G   + +  + +Y+  +
Sbjct:  210 RETTISQLLIEPTDLDIGRVFTCRSMNEAIPNGK------ETSIELDVHHPPTVTLSIEPQTVLEGERVIFTCQATANPEILGYRWAKGGFLIEDAHESRYETNV 308          
BLAST of NEPH-3 vs. UniProt/SwissProt
Match: sp|Q08180|ICCR_DROME (Irregular chiasm C-roughest protein OS=Drosophila melanogaster OX=7227 GN=rst PE=1 SV=2)

HSP 1 Score: 95.1301 bits (235), Expect = 3.391e-21
Identity = 67/223 (30.04%), Postives = 102/223 (45.74%), Query Frame = 3
Query:  342 ITCCATSKSIGC--NSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKI---VTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLM-IVGA 992
            I  C    S+G   +S  + + Y P+F+         A +G  + + C  D NP+P I W +  S+ V+   S  L   +  +  G Y CKA V  + E     Y+  KG P I +    YG  G +AR+ C   S+  P    + W F  +++   + H  Y  + + +   V S L I   Q + +G YNC+V   YG+D+A I L  K    +LM IVG 
Sbjct:  322 IVKCEVQNSVGKSEDSETLDISYAPSFRQRPQSM--EADVGSVVSLTCEVDSNPQPEIVWIQHPSDRVVGT-STNLTFSVSNETAGRYYCKANVPGYAEISADAYVYLKGSPAIGSQRTQYGLVGDTARIECFASSV--PRARHVSWTFNGQEISSESGHD-YSILVDAVPGGVKSTLIIRDSQAYHYGKYNCTVVNDYGNDVAEIQLQAKKSVSLLMTIVGG 538          

HSP 2 Score: 30.0314 bits (66), Expect = 3.391e-21
Identity = 11/33 (33.33%), Postives = 16/33 (48.48%), Query Frame = 1
Query:  190 FIENDIVEFTCSASGRPSDFHWAWTIGDESLVN 288
             +E+  V   C A   PSD  + W I DE ++ 
Sbjct:  271 IVEHSQVRLECRADANPSDVRYRWFINDEPIIG 303          
BLAST of NEPH-3 vs. UniProt/SwissProt
Match: sp|Q6X936|KIRR1_RAT (Kin of IRRE-like protein 1 OS=Rattus norvegicus OX=10116 GN=Kirrel1 PE=1 SV=2)

HSP 1 Score: 88.5817 bits (218), Expect = 4.879e-18
Identity = 64/222 (28.83%), Postives = 98/222 (44.14%), Query Frame = 3
Query:  351 CATSKSIGCNSTNILVKYGPNFKDSDSLTIY----AASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVTSVLHILSVQPHDF-GDYNCSVSTKYGSDMATIILLRKSETPMLMIVGAT 995
            C     +G  + + LV    N   +  + +Y       IG ++ + C   GNP   +TW +  SN V++  + LL   +   D G Y C+A V       + + L   GPP I + +V +   G   ++ C I S P P  + I W +K   L  GT  R+ + R  +   V S L I +V   DF   YNC+    +G   A I L  +   P+ +I GAT
Sbjct:  319 CEVYNKVGSTNVSTLV----NVHFAPRIVVYPKPTTTDIGSDVTLTCVWVGNPPLTLTWTKKDSNMVLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPIISSEAVQFAVRGDGGKVECFIGSTPPP--DRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPVGIIAGAT 534          

HSP 2 Score: 25.7942 bits (55), Expect = 4.879e-18
Identity = 19/105 (18.10%), Postives = 38/105 (36.19%), Query Frame = 1
Query:    4 RYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKI 318
            R   ++ L ++   L  G    C ++N    N K      +  +         V    +    +E + V FTC A+  P    + W  G   + +  + +Y+  +
Sbjct:  210 RETTISQLLIQPTDLDIGRVFTCRSMNEAIPNGK------ETSIELDVHHPPTVTLSIEPQTVLEGERVIFTCQATANPEILGYRWAKGGFLIEDAHESRYETNV 308          
BLAST of NEPH-3 vs. UniProt/SwissProt
Match: sp|Q80W68|KIRR1_MOUSE (Kin of IRRE-like protein 1 OS=Mus musculus OX=10090 GN=Kirrel1 PE=1 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 5.844e-18
Identity = 64/222 (28.83%), Postives = 98/222 (44.14%), Query Frame = 3
Query:  351 CATSKSIGCNSTNILVKYGPNFKDSDSLTIY----AASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVTSVLHILSVQPHDF-GDYNCSVSTKYGSDMATIILLRKSETPMLMIVGAT 995
            C     +G  + + LV    N   +  + +Y       IG ++ + C   GNP   +TW +  SN V++  + LL   +   D G Y C+A V       + + L   GPP I + +V +   G   ++ C I S P P  + I W +K   L  GT  R+ + R  +   V S L I +V   DF   YNC+    +G   A I L  +   P+ +I GAT
Sbjct:  319 CEVYNKVGSTNVSTLV----NVHFAPRIVVYPKPTTTDIGSDVTLTCVWVGNPPLTLTWTKKDSNMVLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPIISSEAVQFAVRGDGGKVECFIGSTPPP--DRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPVGIIAGAT 534          

HSP 2 Score: 25.409 bits (54), Expect = 5.844e-18
Identity = 19/105 (18.10%), Postives = 38/105 (36.19%), Query Frame = 1
Query:    4 RYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKI 318
            R   ++ L ++   L  G    C ++N    N K      +  +         V    +    +E + V FTC A+  P    + W  G   + +  + +Y+  +
Sbjct:  210 RETTISQLLIEPTDLDIGRVFTCRSMNEAIPNGK------ETSIELDVHHPPTVTLSIEPQTVLEGERVIFTCQATANPEILGYRWAKGGFLIEDAHESRYETNV 308          
BLAST of NEPH-3 vs. UniProt/SwissProt
Match: sp|Q8BR86|KIRR3_MOUSE (Kin of IRRE-like protein 3 OS=Mus musculus OX=10090 GN=Kirrel3 PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 5.660e-17
Identity = 62/233 (26.61%), Postives = 98/233 (42.06%), Query Frame = 3
Query:  351 CATSKSIGCN--STNILVKYGPNF-KDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVTSVLHILSVQPHDFGD-YNCSVSTKYGSDMATIIL------------LRKSETPMLMIVGAT 995
            C  + ++G    S  + V +GP    +  SL +    +G +    C   GNP   I W +  S  V++    L    ++ +D G Y+C+A V       + + L   GPP I +    +   G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ V S L I ++   DF   YNC+    +GSD   I L            L     PM +I+G  
Sbjct:  314 CEVTNALGSTNLSRTVDVYFGPRMTSEPQSLLV---DLGSDAVFSCAWIGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPP--DRIAWSWKENVLESGTSGRYTVETVNTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMKSGAGLEAESVPMAVIIGVA 541          

HSP 2 Score: 26.9498 bits (58), Expect = 5.660e-17
Identity = 20/86 (23.26%), Postives = 34/86 (39.53%), Query Frame = 1
Query:    4 RYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAW 261
            R  +V++L +    ++NG  + C A N      K      +  V         V    +    +E++IV F CSA   P+   + W
Sbjct:  205 RESIVSTLFISPGDVENGQSIVCRATNKAIPGGK------ETSVTIDIQHPPLVNLSVEPQPVLEDNIVTFHCSAKANPAVTQYRW 284          
BLAST of NEPH-3 vs. UniProt/SwissProt
Match: sp|Q8IZU9|KIRR3_HUMAN (Kin of IRRE-like protein 3 OS=Homo sapiens OX=9606 GN=KIRREL3 PE=1 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 5.754e-17
Identity = 62/233 (26.61%), Postives = 98/233 (42.06%), Query Frame = 3
Query:  351 CATSKSIGCN--STNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVTSVLHILSVQPHDFGD-YNCSVSTKYGSDMATIIL------------LRKSETPMLMIVGAT 995
            C  + ++G    S  + V +GP    +  SL +    +G +    C   GNP   I W +  S  V++    L    ++ +D G Y+C+A V       + + L   GPP I +    +   G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ V S L I ++   DF   YNC+    +GSD   I L            L     PM +I+G  
Sbjct:  314 CEVTNALGSTNLSRTVDVYFGPRMTTEPQSLLV---DLGSDAIFSCAWTGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPP--DRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMKSGAGLEAESVPMAVIIGVA 541          

HSP 2 Score: 26.5646 bits (57), Expect = 5.754e-17
Identity = 19/86 (22.09%), Postives = 34/86 (39.53%), Query Frame = 1
Query:    4 RYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAW 261
            R  +V++L +    ++NG  + C A N      K      +  V         V    +    +E+++V F CSA   P+   + W
Sbjct:  205 RESIVSTLFISPGDVENGQSIVCRATNKAIPGGK------ETSVTIDIQHPPLVNLSVEPQPVLEDNVVTFHCSAKANPAVTQYRW 284          
BLAST of NEPH-3 vs. TrEMBL
Match: A0A0H3YJJ7 (NEPH-3 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=NEPH-3 PE=2 SV=1)

HSP 1 Score: 654.825 bits (1688), Expect = 0.000e+0
Identity = 333/335 (99.40%), Postives = 334/335 (99.70%), Query Frame = 3
Query:  336 KKITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGATXXXXXXXXXXXXXXXXXQRRKFKDEYMKGNPSSPEIPLHHEAKSTLIDSDCQCNPNLYSWIPQSFDVKSQNDVLSKIHYQDGNFWPNSQEIESCYSNSVPDSQSSNKSVKITKHD 1340
            KKITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIV SVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGATIIFLFILLVIIVVLCICQRRKFKDEYMKGNPSSPEIPLHHEAKSTLIDSDCQCNPNLYSWIPQSFDVKSQNDVLSKIHYQDGNFWPNSQEIESCYSNSVPDSQSSNKSVKITKH+
Sbjct:  344 KKITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVISVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGATIIFLFILLVIIVVLCICQRRKFKDEYMKGNPSSPEIPLHHEAKSTLIDSDCQCNPNLYSWIPQSFDVKSQNDVLSKIHYQDGNFWPNSQEIESCYSNSVPDSQSSNKSVKITKHE 678          

HSP 2 Score: 202.601 bits (514), Expect = 0.000e+0
Identity = 112/112 (100.00%), Postives = 112/112 (100.00%), Query Frame = 1
Query:    7 YDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKK 342
            YDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQIVVYTVPIVVINVYPKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKK
Sbjct:  234 YDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQIVVYTVPIVVINVYPKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKK 345          

HSP 3 Score: 256.144 bits (653), Expect = 3.652e-70
Identity = 125/142 (88.03%), Postives = 129/142 (90.85%), Query Frame = 1
Query: 1300 ANPVINQSRSPSMIIIFIKRNANTNPILYNMHTIGTNTLNRYSTNMPFTNLPIPREKDPRFCDSSQCTQYLYQNLYNPVVEHNSQLNPTESTASPIYIVKKPANKKHQIQFQTDFYSPGKPIIKNKLNSGSANMEMYTDHQH 1725
            +N V +   S   + I    NANTNPILYNMHTIGTNTLNRYSTNMPFTNLPIPREKDPRFCDSSQCTQYLYQNLYNPVVEHNSQLNPTESTASPIYIVKKPANKKHQIQFQTDFYSPGKPIIKNKLNSGSANMEMYTDHQ+
Sbjct:  659 SNSVPDSQSSNKSVKITKHENANTNPILYNMHTIGTNTLNRYSTNMPFTNLPIPREKDPRFCDSSQCTQYLYQNLYNPVVEHNSQLNPTESTASPIYIVKKPANKKHQIQFQTDFYSPGKPIIKNKLNSGSANMEMYTDHQN 800          
BLAST of NEPH-3 vs. TrEMBL
Match: A0A0H3YFE9 (NEPH-2 OS=Schmidtea mediterranea OX=79327 GN=NEPH-2 PE=2 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 2.417e-54
Identity = 124/370 (33.51%), Postives = 205/370 (55.41%), Query Frame = 3
Query:  312 KDNSSRSWKK--ITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLL-EGTRHKMYRQINEKIVTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGATXXXXXXXXXXXXXXXXXQRRKFKDEYMKGNPSSPEIPLHHEA---KSTLIDSDCQCNPNLYSWIP-------QSFDVKSQNDVLSKIHYQDGNF-WPNSQEIESCYSNSVPDSQSSNKSVKITKHDYYIYKKERQHQSN 1379
            K  ++R+  K  + C A +   G +   + VKYGP FKD DS  +Y A+IG+++ + C  D NP   I WQR S+N++I  G+IL R +IQ  DFG YIC A V+ F  + K I L ++  P I+         G+S +  C I SIP  N N+I W+++ ++L+ + T++ +  +       S+L I ++Q  DFG YNCSV+T  GS    ++L + S  P+++IVG T+    +++++I+ LC+C+R    ++Y KG+P++  I  ++     KS   + D QC PN + WIP       +S  V+   DV  +   ++G+       ++ S Y++S+P SQ+  K ++    D  +YK+E    SN
Sbjct:  316 KIKATRTMNKAVVKCIANNGKEGHDLRMLNVKYGPQFKD-DSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSPIPLILIVGGTVFITMVMMIVIIALCVCKRGICSNKYQKGSPTN-RINSNNSTDPLKSPQFEMDYQCQPNFFQWIPNNNREQVKSSFVRYGQDVDDRSSIRNGSINQYRGLDMCSTYTSSIPGSQNGEKPIRNPDID-DVYKEEFYPSSN 682          

HSP 2 Score: 62.7734 bits (151), Expect = 2.417e-54
Identity = 38/108 (35.19%), Postives = 55/108 (50.93%), Query Frame = 1
Query:   10 DVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQN--NIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRV 327
            D  ++L+ K+  L NG  +KC A N G+  +K N+  A+  +       + +    QN  N F END +  +CSA GRP  F W W I D  ++N     YK+K TR 
Sbjct:  217 DSFSTLKAKVNQLLNGKSIKCSATNRGF--EKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRT 322          
BLAST of NEPH-3 vs. TrEMBL
Match: A0A4S2MJS2 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000877 PE=4 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 9.272e-51
Identity = 81/215 (37.67%), Postives = 121/215 (56.28%), Query Frame = 3
Query:  348 CCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGA 992
            C A S   G   T + VK+GP F +   L ++ AS+GE++ MEC A GNP P I W+R   +EV+ RG    ++ ++ DDFG YIC A V EFP   K +Y+ ++ PP I+   V + + G++ARL CT+ S+P P  ++  W F  + + +   H   R+     V  +L I  V   D+G YNC+V   YGSD   I L ++ + P+  IVG+
Sbjct:  336 CIAISNKKGHTETTVRVKFGPQFLEPSPL-LFTASVGEDIAMECPARGNPTPRIDWRREGGHEVLHRGVTYRKDSLRDDDFGTYICTAYVSEFPPVSKQMYISKRRPPTIQPNPVVHAKLGRTARLRCTVNSVPQPPPDQTHWYFNGRPVRQDNHHTFEREEFLGGVVLILQIAHVMRTDYGKYNCTVRNGYGSDWKLIELSQQEDIPLQFIVGS 549          

HSP 2 Score: 66.6254 bits (161), Expect = 9.272e-51
Identity = 37/108 (34.26%), Postives = 61/108 (56.48%), Query Frame = 1
Query:   10 DVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDH 333
            D  + +  ++  L +G  ++C A N GY  Q L     ++ V+  P+V I V P +++N ++E+DI+   C+A GRP  F W W +    + NI DP Y+L++TR  H
Sbjct:  223 DASSQMSARLNKLHHGKLVECRATNLGYDEQALRPAFTKLEVHYAPVVSIQVRPPRRDNEYMEHDIITVECAAHGRPDSFMWEWFVNGRQVENIADPWYRLRLTRDMH 330          
BLAST of NEPH-3 vs. TrEMBL
Match: A0A4S2MJ83 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000877 PE=4 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 1.015e-50
Identity = 81/215 (37.67%), Postives = 121/215 (56.28%), Query Frame = 3
Query:  348 CCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGA 992
            C A S   G   T + VK+GP F +   L ++ AS+GE++ MEC A GNP P I W+R   +EV+ RG    ++ ++ DDFG YIC A V EFP   K +Y+ ++ PP I+   V + + G++ARL CT+ S+P P  ++  W F  + + +   H   R+     V  +L I  V   D+G YNC+V   YGSD   I L ++ + P+  IVG+
Sbjct:  365 CIAISNKKGHTETTVRVKFGPQFLEPSPL-LFTASVGEDIAMECPARGNPTPRIDWRREGGHEVLHRGVTYRKDSLRDDDFGTYICTAYVSEFPPVSKQMYISKRRPPTIQPNPVVHAKLGRTARLRCTVNSVPQPPPDQTHWYFNGRPVRQDNHHTFEREEFLGGVVLILQIAHVMRTDYGKYNCTVRNGYGSDWKLIELSQQEDIPLQFIVGS 578          

HSP 2 Score: 67.0106 bits (162), Expect = 1.015e-50
Identity = 37/108 (34.26%), Postives = 61/108 (56.48%), Query Frame = 1
Query:   10 DVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDH 333
            D  + +  ++  L +G  ++C A N GY  Q L     ++ V+  P+V I V P +++N ++E+DI+   C+A GRP  F W W +    + NI DP Y+L++TR  H
Sbjct:  252 DASSQMSARLNKLHHGKLVECRATNLGYDEQALRPAFTKLEVHYAPVVSIQVRPPRRDNEYMEHDIITVECAAHGRPDSFMWEWFVNGRQVENIADPWYRLRLTRDMH 359          
BLAST of NEPH-3 vs. TrEMBL
Match: A0A419PMQ9 (Kin of IRRE-like protein 3 OS=Clonorchis sinensis OX=79923 GN=Kirrel3 PE=4 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 1.212e-50
Identity = 81/215 (37.67%), Postives = 121/215 (56.28%), Query Frame = 3
Query:  348 CCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGA 992
            C A S   G   T + VK+GP F +   L ++ AS+GE++ MEC A GNP P I W+R   +EV+ RG    ++ ++ DDFG YIC A V EFP   K +Y+ ++ PP I+   V + + G++ARL CT+ S+P P  ++  W F  + + +   H   R+     V  +L I  V   D+G YNC+V   YGSD   I L ++ + P+  IVG+
Sbjct:  109 CIAISNKKGHTETTVRVKFGPQFLEPSPL-LFTASVGEDIAMECPARGNPTPRIDWRREGGHEVLHRGVTYRKDSLRDDDFGTYICTAYVSEFPPVSKQMYISKRRPPTIQPNPVVHAKLGRTARLRCTVNSVPLPPPDQTHWYFNGRPVRQDNHHTFEREEFLGGVVLILQIAHVMRTDYGRYNCTVRNGYGSDWKLIELSQQEDIPLQFIVGS 322          

HSP 2 Score: 65.0846 bits (157), Expect = 1.212e-50
Identity = 36/103 (34.95%), Postives = 59/103 (57.28%), Query Frame = 1
Query:   25 LELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDH 333
            +  ++  L +G  ++C A N GY  Q L     ++ V+  P+V I V P +++N ++E+DI+   C+A GRP  F W W +    + NI DP Y+L++TR  H
Sbjct:    1 MSARLNKLHHGKLVECRATNLGYDEQALRPAFTKLEVHYAPVVSIQVRPPRRDNEYMEHDIITVECAAHGRPDSFMWEWFVNGRQVENIADPWYRLRLTRDMH 103          
BLAST of NEPH-3 vs. Ensembl Cavefish
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:HGNC Symbol;Acc:HGNC:23204])

HSP 1 Score: 93.5893 bits (231), Expect = 9.744e-21
Identity = 63/220 (28.64%), Postives = 99/220 (45.00%), Query Frame = 3
Query:  351 CATSKSIGCN--STNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVTSVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVGA 992
            C  +  +G    S N+ V +GP    +  SL +    +G +    C   GNP   I W +  S  V++  +IL    ++ +D G Y+C+A V       K + L   GPP I +        G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E  V S L + ++ P DF   YNC+    +GSD   I L  +   P+ +I+G 
Sbjct:  266 CEVTNPLGSTNISRNVDVYFGPRMAAEPQSLQV---DLGSDAVFNCAWTGNPSLTIVWMKRGSGVVLSNENILTLKAVRQEDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQTHQAPHGEKGQIKCFIRSTPPP--DRIAWSWKETVLESGTSGRYTVETVSTEDGVLSTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKEQESLPVAVIIGV 480          

HSP 2 Score: 26.9498 bits (58), Expect = 9.744e-21
Identity = 24/110 (21.82%), Postives = 43/110 (39.09%), Query Frame = 1
Query:    4 RYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDH 333
            R   V++L +   +++ G  + C A N    N K      +  V      +  V    +    +E ++V+F CSA   P    + W  G   +  +    Y++    VDH
Sbjct:  157 RESTVSTLYISPSNIETGQKIICRASNKAIPNGK------ETSVTIDIQHLPLVNLSVEPQPVLEGNLVKFHCSAKANPPVTQYKWAKGGTVIKEVSGDTYEVI---VDH 257          
BLAST of NEPH-3 vs. Ensembl Cavefish
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:HGNC Symbol;Acc:HGNC:23204])

HSP 1 Score: 93.5893 bits (231), Expect = 9.751e-21
Identity = 63/220 (28.64%), Postives = 99/220 (45.00%), Query Frame = 3
Query:  351 CATSKSIGCN--STNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVTSVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVGA 992
            C  +  +G    S N+ V +GP    +  SL +    +G +    C   GNP   I W +  S  V++  +IL    ++ +D G Y+C+A V       K + L   GPP I +        G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E  V S L + ++ P DF   YNC+    +GSD   I L  +   P+ +I+G 
Sbjct:  266 CEVTNPLGSTNISRNVDVYFGPRMAAEPQSLQV---DLGSDAVFNCAWTGNPSLTIVWMKRGSGVVLSNENILTLKAVRQEDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQTHQAPHGEKGQIKCFIRSTPPP--DRIAWSWKETVLESGTSGRYTVETVSTEDGVLSTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKEQESLPVAVIIGV 480          

HSP 2 Score: 26.9498 bits (58), Expect = 9.751e-21
Identity = 24/110 (21.82%), Postives = 43/110 (39.09%), Query Frame = 1
Query:    4 RYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDH 333
            R   V++L +   +++ G  + C A N    N K      +  V      +  V    +    +E ++V+F CSA   P    + W  G   +  +    Y++    VDH
Sbjct:  157 RESTVSTLYISPSNIETGQKIICRASNKAIPNGK------ETSVTIDIQHLPLVNLSVEPQPVLEGNLVKFHCSAKANPPVTQYKWAKGGTVIKEVSGDTYEVI---VDH 257          
BLAST of NEPH-3 vs. Ensembl Cavefish
Match: kirrel3a (kirre like nephrin family adhesion molecule 3a [Source:ZFIN;Acc:ZDB-GENE-091117-44])

HSP 1 Score: 87.8113 bits (216), Expect = 1.958e-20
Identity = 60/219 (27.40%), Postives = 98/219 (44.75%), Query Frame = 3
Query:  351 CATSKSIGCN--STNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVTSVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVG 989
            C  + ++G    S N+ V +GP    +  SL +    +G +    C   GNP   I W +     V++  + L    ++ +D G Y+C+A V       K + L   GPP I +        G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ V S L + ++ P DF   YNC+    +GSD   I L  +    + +I+G
Sbjct:  293 CEVTNALGSTNISRNVDVYFGPRLAAEPQSLQV---DLGSDAVFNCAWTGNPSLTIVWMKRGHGVVLSNENTLTLKAVKQEDAGKYVCRAVVPRVGVGEKEVTLTVNGPPTISSTQTQQALYGEKGQIKCFIRSTPPP--DRIAWSWKETVLESGTSGRYTVETVSTEEGVISTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKEQGSLRLAVIIG 506          

HSP 2 Score: 31.5722 bits (70), Expect = 1.958e-20
Identity = 25/110 (22.73%), Postives = 45/110 (40.91%), Query Frame = 1
Query:    4 RYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDH 333
            R   V++L +   ++++G  + C A N    N K      +  V      +  V    +    +E ++V+F CSA   P   H+ W  G   + ++    Y+     VDH
Sbjct:  184 RESTVSTLYISASNIESGQRITCRASNKAAPNGK------EATVTIDIQHLPLVNLSVEPQPILEGNLVKFHCSAKANPPVTHYRWAKGGAVIRDVLGDSYE---AVVDH 284          
BLAST of NEPH-3 vs. Ensembl Cavefish
Match: kirrel3l (kirre like nephrin family adhesion molecule 3, like [Source:ZFIN;Acc:ZDB-GENE-070831-1])

HSP 1 Score: 88.5817 bits (218), Expect = 1.180e-17
Identity = 62/221 (28.05%), Postives = 100/221 (45.25%), Query Frame = 3
Query:  351 CATSKSIGCN--STNILVKYGPNF-KDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVTSVLHILSVQPHDFG-DYNCSVSTKYGSDMATIILLRKSETPMLMIVGAT 995
            C  S S+G    ST + V++GP    +   LT+     G +    C   GNP   + W +  SN V++  + L    +  +D G Y CKA V       + + L   GPP I   +     +    +L C + S P P  ++I W F    L  G+  R+ +    +++ V S L +      DF   YNC+   ++G+  A +IL  +   PML+I+GA+
Sbjct:  271 CEVSNSVGSTNVSTLVDVQFGPRLLSEPKPLTV---DTGMDAAFTCAWTGNPPLTLAWTKQGSNVVLSNSNTLQLKAVTQEDAGLYTCKAIVPMIGVAERDVTLTVNGPPIITAEATQKAVKHSKGKLECLVGSSPPP--DKIVWTFGEMTLSSGSSGRYSVQTVNSDRGVLSSLILSETLAQDFQLRYNCTAWNRFGTGTALVILKEQEALPMLIIIGAS 486          
BLAST of NEPH-3 vs. Ensembl Cavefish
Match: kirrel3l (kirre like nephrin family adhesion molecule 3, like [Source:ZFIN;Acc:ZDB-GENE-070831-1])

HSP 1 Score: 88.5817 bits (218), Expect = 1.195e-17
Identity = 62/221 (28.05%), Postives = 100/221 (45.25%), Query Frame = 3
Query:  351 CATSKSIGCN--STNILVKYGPNF-KDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVTSVLHILSVQPHDFG-DYNCSVSTKYGSDMATIILLRKSETPMLMIVGAT 995
            C  S S+G    ST + V++GP    +   LT+     G +    C   GNP   + W +  SN V++  + L    +  +D G Y CKA V       + + L   GPP I   +     +    +L C + S P P  ++I W F    L  G+  R+ +    +++ V S L +      DF   YNC+   ++G+  A +IL  +   PML+I+GA+
Sbjct:  274 CEVSNSVGSTNVSTLVDVQFGPRLLSEPKPLTV---DTGMDAAFTCAWTGNPPLTLAWTKQGSNVVLSNSNTLQLKAVTQEDAGLYTCKAIVPMIGVAERDVTLTVNGPPIITAEATQKAVKHSKGKLECLVGSSPPP--DKIVWTFGEMTLSSGSSGRYSVQTVNSDRGVLSSLILSETLAQDFQLRYNCTAWNRFGTGTALVILKEQEALPMLIIIGAS 489          
BLAST of NEPH-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010550.1 (pep scaffold:Pmarinus_7.0:GL479154:26986:35474:-1 gene:ENSPMAG00000009556.1 transcript:ENSPMAT00000010550.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.5741 bits (205), Expect = 9.511e-18
Identity = 52/171 (30.41%), Postives = 76/171 (44.44%), Query Frame = 3
Query:  456 GENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKI--VTSVLHILSVQPHDF-GDYNCSVSTKYGSDMATIILLRK 959
            G +    C   GNP   + W R  SN V++  ++LL   +  DD G Y+CKA V       K + L   GPP I +  + +   G+  R+ C I S   P  + + W +K   L  GT  +   +   ++  V S L I +V   DF   YNC+    +GSD     L  K
Sbjct:   16 GSDATFTCAWSGNPPLTLAWTRKGSNVVLSNSNMLLLKGVTQDDTGRYVCKAIVPRIGVGEKEVMLNVNGPPIISSDLLQHALRGEKGRVECFIGST--PPAHHLAWAWKENVLEVGTYERYTVETVSRVDGVLSTLTITNVMEGDFQTAYNCTAWNGFGSDTEIFTLREK 184          
BLAST of NEPH-3 vs. Ensembl Sea Lamprey
Match: igdcc3 (immunoglobulin superfamily, DCC subclass, member 3 [Source:ZFIN;Acc:ZDB-GENE-080303-24])

HSP 1 Score: 59.3066 bits (142), Expect = 2.674e-9
Identity = 49/183 (26.78%), Postives = 77/183 (42.08%), Query Frame = 3
Query:  429 SLTIYAASIGENMQMECRADGNPEPLITWQRISSN-------EVIARGSILLRNDIQADDFGDYICKA-AVKEFPERHKYIYLGEKGPPEIKNPSVSYGRE-GQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIIL 950
            +LT++  +I     +EC A GNP P+++W R+          +V+  G++++ +D+     G Y+C A        R     L  + PPE   P  S  R  G SA L+C+ +  P P    I W+     L +  R ++          S L I  V   D G Y C+     G   A+  L
Sbjct:  210 TLTVHQTAI-----LECIATGNPRPIVSWSRLDGRPIGVEGIQVVGTGNLMI-SDVAVQHAGVYVCAANRPGTRVRRTAQGRLIVQAPPEFMQPPQSVTRSLGASAVLTCSAQGTPSPR---IIWLHNGLPLHQSERVRLQNG------NSTLTIQRVCSEDEGIYQCTAENSAGYTQASARL 377          
BLAST of NEPH-3 vs. Ensembl Sea Lamprey
Match: cntn3b (contactin 3b [Source:ZFIN;Acc:ZDB-GENE-130530-645])

HSP 1 Score: 58.5362 bits (140), Expect = 4.561e-9
Identity = 52/209 (24.88%), Postives = 91/209 (43.54%), Query Frame = 3
Query:  399 KYGPNF-KDSDSLTIYAASIGENMQMECRADGNPEPLITWQR------ISSNEVIARGSILLRNDIQADDFGDYIC-----KAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVG 989
            +YGP F ++ + +T    S  + +   CRA G+P PL  W +      I+ +  +A GS+++RN  +  D G + C       ++     R ++ YL           +V   R+GQ   L C     P P   E+ +++   ++ +  R    R +++  VT  L+I  V+  D G Y C V      +  T   +    TP+L+  G
Sbjct:    5 EYGPLFLEEPEDVTYLVESSEKKVSFRCRASGHPPPLYRWLKNGTEVPITGHYSLAGGSLIVRNPSEGRDGGVFQCLVTNSVGSIISVEARLQFAYLESFRSKPRGTVAV---RQGQGVVLICA----PPPYSGELTFVWLFNEMYDYMRSDGRRFVSQ--VTGNLYIAKVEATDVGSYTCMV-----HNTVTNTRVASPPTPLLIKSG 199          

HSP 2 Score: 54.6842 bits (130), Expect = 6.806e-8
Identity = 58/225 (25.78%), Postives = 89/225 (39.56%), Query Frame = 3
Query:  375 CNSTNILVKYGPNFKDSDSLTIYAA------------SIGENMQMECRADGNPEPLITWQR-------ISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFP-ERHKYIYLGEKGPPEIKNP--SVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMI 983
            CN+ N+  K     K    +T+YA              IG+ +  +C+A G P P   W R        S   V+A G ++L+ ++Q  D G Y C A  K      H  + +    P    NP   V+    G  A + C  K+ P P+     W   N  +++  R  + +          L I SV   D G Y C+V    GS  +T  L+ K  T + ++
Sbjct:  276 CNAENVAGKNSAQGK----ITVYAPPHWIQPISNVEQGIGDKLSWDCKAGGKPPPTYRWLRNGVPLPSESRFSVMANGELILQ-ELQPWDRGMYQCLAENKHGRIYSHGELRVKASAPDFRSNPLKRVTPAARGGQAVIKCEPKAWPRPS---FTWTKGNAMVMDNERMSITQN-------GSLWIRSVTDEDAGTYTCTVENHLGSANSTGRLILKESTRITVV 485          
BLAST of NEPH-3 vs. Ensembl Sea Lamprey
Match: pxdn (peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2])

HSP 1 Score: 56.9954 bits (136), Expect = 1.611e-8
Identity = 47/186 (25.27%), Postives = 72/186 (38.71%), Query Frame = 3
Query:  453 IGENMQMECRADGNPEPLITWQRISSNEVIA--RGSILLRNDIQAD-----DFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVTSVLHILSVQPHDFGDYNCSVSTKYG-SDMATIILLRKSETPMLMIV 986
            +GE++ +EC A G+P P ++W R  S ++ A  R S+     +  +     D G Y C A+  +   R     L +  P  I  P      EG +  L C  +  P P    I W     QL    R  +       + +  L I  V  HD G + C      G    AT + +    TP+  + 
Sbjct:  292 VGESVTLECSAGGHPAPRVSWTRDDSEQLPADPRFSVTASGGLHVERAGPGDEGRYTCHASNNQDSIRASATILLKSAPQFILAPEDQVVTEGHTVDLHCEAQGRPLP---VIAWTKAGSQLPSDRRLTV-------LSSGTLRIARVALHDQGQFECQAVNVVGVRRAATQLTVLPRVTPVFSVT 467          

HSP 2 Score: 48.9062 bits (115), Expect = 4.877e-6
Identity = 49/190 (25.79%), Postives = 76/190 (40.00%), Query Frame = 3
Query:  456 GENMQMECRADGNPEPLITWQRISSNEV----------IARGSILLRNDIQADDFGDYICKA--AVKEFPERHKYI-YLGEKGPPE-IKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKN-KQLLEGTRHKMYRQINEKIVTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLM 980
            G  + + CRA+GNP+P I W   +SNE+          +  G++++R D +  D G Y C A     E       + Y     PP  +  P  +    G+S  L C+    P P    + W   + +QL    R  +         +  LH+    P D G Y C  S    S  A+  +L KS    ++
Sbjct:  197 GNTVYLRCRAEGNPKPAIIWLH-NSNEIAMAEDERRNLLQDGTLMIR-DTRHTDQGTYQCMARNVAGEVKAPEVVLRYFDVPAPPTFVIQPHDTEVLVGESVTLECSAGGHPAP---RVSWTRDDSEQLPADPRFSV-------TASGGLHVERAGPGDEGRYTCHASNNQDSIRASATILLKSAPQFIL 374          
BLAST of NEPH-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004605.1 (pep scaffold:Pmarinus_7.0:GL476854:241038:246210:-1 gene:ENSPMAG00000004199.1 transcript:ENSPMAT00000004605.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.9138 bits (128), Expect = 8.541e-8
Identity = 47/205 (22.93%), Postives = 79/205 (38.54%), Query Frame = 3
Query:  381 STNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRI------SSNEVI--ARGSILLRNDIQADDFGDYICKAAVKEFPERHK----YIYLGEKGPPEIKNPSVSYGR--EGQSARLSCTIKSIPFPNDNEIKWIFK-NKQLLEGTRHKMYRQINEKIVTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIIL 950
            +  + +   P  +D     +   + G+++ +ECRA G+P PLITW+        SS  ++  A GS+ +R+  ++ D G Y C A   +     +       +G   PP    P+        G S  L+C  +  P P   +  W      QL  G+            +   L +      D G Y CS  +  G     ++L
Sbjct:  185 TATVSINQAPQIQDKPERAVVRITSGDSIALECRASGDPAPLITWRLPDGSVPHSSGRLLTHANGSLEIRSAARS-DAGRYACVARGADGSRDARLSVDLTVMGAPAPPSFLAPTTERVEVAPGASVALACPARGEPPP---QTTWTLPGGAQLARGSNRGARFSAG---LDGALLVRGATLADTGVYRCSARSPSGVADRVVLL 382          
BLAST of NEPH-3 vs. Ensembl Nematostella
Match: EDO30350 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T115])

HSP 1 Score: 71.2478 bits (173), Expect = 7.067e-14
Identity = 46/158 (29.11%), Postives = 67/158 (42.41%), Query Frame = 3
Query:  471 MECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKA----AVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVTSVLH-ILSVQPHDFGDYNCSVSTKYGS 929
            + C A GNP P +TW R    +V+  G  L  +D++  D G Y+C A      +  P           G     N +V    EG+S  L+CT    P PN   I W          T+H +   +   I T ++H I SVQ    G Y C+ + + G+
Sbjct:    1 LSCSATGNPTPNVTWTRSGGADVLGTGETLTISDVKISDGGCYVCTAYNNIGSEANPASVHVTSTTPSGDTFASNITV---IEGESLTLNCTATGCPTPN---ITW----------TKHGVSAALRSNITTEIIHQIASVQKSHAGRYTCAANNEIGT 142          
BLAST of NEPH-3 vs. Ensembl Nematostella
Match: EDO34058 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQE0])

HSP 1 Score: 59.3066 bits (142), Expect = 3.448e-10
Identity = 57/194 (29.38%), Postives = 82/194 (42.27%), Query Frame = 3
Query:  432 LTIYAASIGENMQMECRADGNPEPLITWQRISSN-------EVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKN-PSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVG 989
            LT+ A   GE   ++C A G+P P   W +   +        VIA GS+++ + + +D+  +Y C+ AV      H  IYL   GPP I +  S   G +G +  L C  K  P P    I W  ++ Q +   R        + I    L I +VQ  D G Y C+     G         R S T  + IVG
Sbjct:    8 LTLIA---GETAVLQCTAAGSPTPYFRWLKSGKSLTMGGRMSVIAGGSLMIESTMASDE-ANYTCQ-AVNNVGSVHMAIYLEVIGPPNITSFRSSVTGVQGDTISLPCRAKGFPPP---VITW-SRSGQTIPYDRR-------QSIDNGTLLIGNVQKSDSGKYTCTAVNTAGE--------RDSVTMTVSIVG 177          
BLAST of NEPH-3 vs. Ensembl Nematostella
Match: EDO35185 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM80])

HSP 1 Score: 61.2326 bits (147), Expect = 1.140e-9
Identity = 55/210 (26.19%), Postives = 88/210 (41.90%), Query Frame = 3
Query:  405 GPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITW--------QRISSNEVIARGS--ILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVS------YGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKM---------YRQINEKIVTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRK 959
            GP    S S  ++ A +G ++ + C A G+P+P + W        + +S  +++ +GS  IL    +  +D G Y C A       +   + L       I  P VS            +  L C +++ P      + W   +KQL +G R+KM         Y+++  +  T  L I  V   D G+Y C V T  GS  A I L+ K
Sbjct:  330 GPPIITSRS-NVHEAKVGSDVAVACVATGSPKPTVEWSSQPLPQCRSLSRAKIVNQGSTAILTIESVTKEDEGIYCCVARNSNGQSKPHIVILSVSYHKRILPPHVSPFSQVVVSTTDSTTTLICAVENAP-QKYTTVFWTLNSKQLTDGGRYKMATTFSTEVEYKRLLLERATMTLIIKHVTTQDSGEYQCGVVTHIGSGHAEIQLVTK 537          
BLAST of NEPH-3 vs. Ensembl Nematostella
Match: EDO49558 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGM2])

HSP 1 Score: 58.5362 bits (140), Expect = 5.981e-9
Identity = 53/197 (26.90%), Postives = 85/197 (43.15%), Query Frame = 3
Query:  405 GPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSIL-LRNDIQA----------DDFGDYICKAAVKEFPERHKYIYLGEKG--PPE-IKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILL 953
            GP F     L +     G    +E    G P+P++ W  +   E++   S++ L  + Q           DD G+Y C A  K          L E+G  PP+ I  PS     EG+ A+    +  +P P   E++W+   + +  G R     QI  +   SVL I+  + +D G+Y C  ++K G D  ++ LL
Sbjct:  263 GPKF--LQRLELKEVVEGSRTDLEVEVSGKPKPVVEW--LKDGELVKPSSLMTLETEGQVHTLTIMNTTLDDEGEYTCIAKNKVGEVSCTAELLVEEGMRPPQFIVKPSSLQIMEGKMAKFEARVSGLPGP---EVEWLRDGRPIKPGRRF----QIEFEKDRSVLTIIDAKLNDEGEYTCVATSKAGKDSCSVELL 448          
BLAST of NEPH-3 vs. Ensembl Nematostella
Match: EDO27477 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T954])

HSP 1 Score: 54.299 bits (129), Expect = 1.944e-8
Identity = 44/168 (26.19%), Postives = 70/168 (41.67%), Query Frame = 3
Query:  459 ENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGRE--GQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLR 956
            +++ ++C A G+P P ITW       +   GSIL   ++   + G Y CKA             L     PEI+     +     G++  L+C ++  P P+   + W  K  Q        ++  +  +   SVL ++  Q  DFGDY C      G D  T+ L R
Sbjct:   18 DSVTLQCHASGDPAPNITWSH-EGAPLEHNGSILTLYNVTRREAGSYECKADNGIRKPAKASAVLSVNFAPEIERQKKKHFETSLGKAINLTCDVEGGPLPS---VTWSRKRSQF-----SIIFSPVRMR---SVLEVIPKQSRDFGDYICMARNIMGWDSHTLTLKR 173          
BLAST of NEPH-3 vs. Ensembl Medaka
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:NCBI gene;Acc:101170290])

HSP 1 Score: 95.9005 bits (237), Expect = 1.444e-21
Identity = 63/219 (28.77%), Postives = 101/219 (46.12%), Query Frame = 3
Query:  351 CATSKSIGCN--STNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVTSVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVG 989
            C  + S+G    S N+ V +GP    +  SL +    +G +    C   GNP   I W +  S  V++  ++L    ++ +D G Y+C+A V       K + L   GPP I +        G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ V S L + ++ P DF   YNC+    +GSD   I L  +   P+ +I+G
Sbjct:  288 CEVTNSLGSTNVSRNVDVYFGPRMAAEPQSLQV---DLGSDAVFNCAWTGNPSLTIVWMKRGSGVVLSNENLLTLKSVRQEDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQTQQALHGEKGQIKCFIRSTPPP--DRIAWSWKETVLESGTSGRYTVETVNTEEGVISTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKEQESLPVAVIIG 501          

HSP 2 Score: 27.335 bits (59), Expect = 1.444e-21
Identity = 25/110 (22.73%), Postives = 41/110 (37.27%), Query Frame = 1
Query:    4 RYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDH 333
            R   V++L L   +++ G  + C A N    N K      +  V      +  V    +    +E  +V F CSA   P    + W  G   +  +    Y++    VDH
Sbjct:  179 RESTVSTLYLSPSNIETGQQIICRASNKAVPNGK------EASVTIDIQHLPLVNLSVEPQAVLEGSLVRFQCSAKANPPVTLYRWAKGGSIIKEVSGDTYEVI---VDH 279          
BLAST of NEPH-3 vs. Ensembl Medaka
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:NCBI gene;Acc:101170290])

HSP 1 Score: 95.9005 bits (237), Expect = 1.455e-21
Identity = 63/219 (28.77%), Postives = 101/219 (46.12%), Query Frame = 3
Query:  351 CATSKSIGCN--STNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVTSVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVG 989
            C  + S+G    S N+ V +GP    +  SL +    +G +    C   GNP   I W +  S  V++  ++L    ++ +D G Y+C+A V       K + L   GPP I +        G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ V S L + ++ P DF   YNC+    +GSD   I L  +   P+ +I+G
Sbjct:  312 CEVTNSLGSTNVSRNVDVYFGPRMAAEPQSLQV---DLGSDAVFNCAWTGNPSLTIVWMKRGSGVVLSNENLLTLKSVRQEDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQTQQALHGEKGQIKCFIRSTPPP--DRIAWSWKETVLESGTSGRYTVETVNTEEGVISTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKEQESLPVAVIIG 525          

HSP 2 Score: 27.335 bits (59), Expect = 1.455e-21
Identity = 25/110 (22.73%), Postives = 41/110 (37.27%), Query Frame = 1
Query:    4 RYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDH 333
            R   V++L L   +++ G  + C A N    N K      +  V      +  V    +    +E  +V F CSA   P    + W  G   +  +    Y++    VDH
Sbjct:  203 RESTVSTLYLSPSNIETGQQIICRASNKAVPNGK------EASVTIDIQHLPLVNLSVEPQAVLEGSLVRFQCSAKANPPVTLYRWAKGGSIIKEVSGDTYEVI---VDH 303          
BLAST of NEPH-3 vs. Ensembl Medaka
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:NCBI gene;Acc:101170290])

HSP 1 Score: 95.9005 bits (237), Expect = 1.564e-21
Identity = 63/219 (28.77%), Postives = 101/219 (46.12%), Query Frame = 3
Query:  351 CATSKSIGCN--STNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVTSVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSETPMLMIVG 989
            C  + S+G    S N+ V +GP    +  SL +    +G +    C   GNP   I W +  S  V++  ++L    ++ +D G Y+C+A V       K + L   GPP I +        G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ V S L + ++ P DF   YNC+    +GSD   I L  +   P+ +I+G
Sbjct:  354 CEVTNSLGSTNVSRNVDVYFGPRMAAEPQSLQV---DLGSDAVFNCAWTGNPSLTIVWMKRGSGVVLSNENLLTLKSVRQEDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQTQQALHGEKGQIKCFIRSTPPP--DRIAWSWKETVLESGTSGRYTVETVNTEEGVISTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKEQESLPVAVIIG 567          

HSP 2 Score: 27.335 bits (59), Expect = 1.564e-21
Identity = 25/110 (22.73%), Postives = 41/110 (37.27%), Query Frame = 1
Query:    4 RYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDH 333
            R   V++L L   +++ G  + C A N    N K      +  V      +  V    +    +E  +V F CSA   P    + W  G   +  +    Y++    VDH
Sbjct:  245 RESTVSTLYLSPSNIETGQQIICRASNKAVPNGK------EASVTIDIQHLPLVNLSVEPQAVLEGSLVRFQCSAKANPPVTLYRWAKGGSIIKEVSGDTYEVI---VDH 345          
BLAST of NEPH-3 vs. Ensembl Medaka
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:NCBI gene;Acc:101170290])

HSP 1 Score: 90.8929 bits (224), Expect = 5.668e-20
Identity = 63/223 (28.25%), Postives = 102/223 (45.74%), Query Frame = 3
Query:  351 CATSKSIGCN--STNILVKYGPNFK-DSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGT--RHKMYRQINEKIVTSVLHILSVQPHDFGD-YNCSVSTKYGSDMATIILLRKSET----PMLMIVG 989
            C  + S+G    S N+ V +GP    +  SL +    +G +    C   GNP   I W +  S  V++  ++L    ++ +D G Y+C+A V       K + L   GPP I +        G+  ++ C I+S P P  + I W +K   L  GT  R+ +     E+ V S L + ++ P DF   YNC+    +GSD   I L  +  +    P+ +I+G
Sbjct:  280 CEVTNSLGSTNVSRNVDVYFGPRMAAEPQSLQV---DLGSDAVFNCAWTGNPSLTIVWMKRGSGVVLSNENLLTLKSVRQEDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQTQQALHGEKGQIKCFIRSTPPP--DRIAWSWKETVLESGTSGRYTVETVNTEEGVISTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKEQGGSQESLPVAVIIG 497          

HSP 2 Score: 27.335 bits (59), Expect = 5.668e-20
Identity = 25/110 (22.73%), Postives = 41/110 (37.27%), Query Frame = 1
Query:    4 RYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDH 333
            R   V++L L   +++ G  + C A N    N K      +  V      +  V    +    +E  +V F CSA   P    + W  G   +  +    Y++    VDH
Sbjct:  171 RESTVSTLYLSPSNIETGQQIICRASNKAVPNGK------EASVTIDIQHLPLVNLSVEPQAVLEGSLVRFQCSAKANPPVTLYRWAKGGSIIKEVSGDTYEVI---VDH 271          
BLAST of NEPH-3 vs. Ensembl Medaka
Match: kirrel1a (kin of IRRE-like protein 1 [Source:NCBI gene;Acc:101168819])

HSP 1 Score: 80.1073 bits (196), Expect = 3.468e-17
Identity = 63/227 (27.75%), Postives = 98/227 (43.17%), Query Frame = 3
Query:  351 CATSKSIGCNSTNILV--KYGP-NFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNK--QLLEGTRHKMYRQINEKI------VTSVLHILSVQPHDF-GDYNCSVSTKYGSDMATIILLRKSETPMLMIVGAT 995
            C    ++G  + +ILV  ++GP    +    T+    +  ++ + C+  GNP   +TW +  SN V++  + L    +   D G Y+CKA V         + L   GPP I +  V Y   G+   + C I S P P  ++I W +K    +   GT  + Y     K+      V S L I +V   DF   YNC+    +G     I L  K E P+ +I   T
Sbjct:  282 CLVFNAVGKTNVSILVDVQFGPILLVEPQPKTV---DVNSDVTLNCKWAGNPPLTLTWFKKGSNMVLSNSNQLYLQSVSQADAGQYVCKAIVPRIGVGETEVTLTVNGPPIISSDPVQYAVRGERGEVKCYIASTPPP--DKIVWAWKENVWEKERGTLQERYTVEQSKLSAEGGGVLSTLTINNVMESDFLSTYNCTAWNSFGPGTMIITLEEKEEVPVGIIAVGT 503          

HSP 2 Score: 28.4906 bits (62), Expect = 3.468e-17
Identity = 15/47 (31.91%), Postives = 20/47 (42.55%), Query Frame = 1
Query:  193 IENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDH 333
            +E D V FTC A   P    + W  G   L   R+    +  T+ DH
Sbjct:  230 LEGDRVTFTCQAHANPPIMGYRWAKGGVVLQGARE---SVFTTKADH 273          
BLAST of NEPH-3 vs. Planmine SMEST
Match: SMESG000022777.1 (SMESG000022777.1)

HSP 1 Score: 656.751 bits (1693), Expect = 0.000e+0
Identity = 334/335 (99.70%), Postives = 335/335 (100.00%), Query Frame = 3
Query:  336 KKITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGATXXXXXXXXXXXXXXXXXQRRKFKDEYMKGNPSSPEIPLHHEAKSTLIDSDCQCNPNLYSWIPQSFDVKSQNDVLSKIHYQDGNFWPNSQEIESCYSNSVPDSQSSNKSVKITKHD 1340
            KKITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGATIIFLFILLVIIVVLCICQRRKFKDEYMKGNPSSPEIPLHHEAKSTLIDSDCQCNPNLYSWIPQSFDVKSQNDVLSKIHYQDGNFWPNSQEIESCYSNSVPDSQSSNKSVKITKH+
Sbjct:  327 KKITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGATIIFLFILLVIIVVLCICQRRKFKDEYMKGNPSSPEIPLHHEAKSTLIDSDCQCNPNLYSWIPQSFDVKSQNDVLSKIHYQDGNFWPNSQEIESCYSNSVPDSQSSNKSVKITKHE 661          

HSP 2 Score: 202.601 bits (514), Expect = 0.000e+0
Identity = 112/112 (100.00%), Postives = 112/112 (100.00%), Query Frame = 1
Query:    7 YDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKK 342
            YDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQIVVYTVPIVVINVYPKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKK
Sbjct:  217 YDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQIVVYTVPIVVINVYPKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKK 328          

HSP 3 Score: 256.529 bits (654), Expect = 6.569e-74
Identity = 125/142 (88.03%), Postives = 129/142 (90.85%), Query Frame = 1
Query: 1300 ANPVINQSRSPSMIIIFIKRNANTNPILYNMHTIGTNTLNRYSTNMPFTNLPIPREKDPRFCDSSQCTQYLYQNLYNPVVEHNSQLNPTESTASPIYIVKKPANKKHQIQFQTDFYSPGKPIIKNKLNSGSANMEMYTDHQH 1725
            +N V +   S   + I    NANTNPILYNMHTIGTNTLNRYSTNMPFTNLPIPREKDPRFCDSSQCTQYLYQNLYNPVVEHNSQLNPTESTASPIYIVKKPANKKHQIQFQTDFYSPGKPIIKNKLNSGSANMEMYTDHQ+
Sbjct:  642 SNSVPDSQSSNKSVKITKHENANTNPILYNMHTIGTNTLNRYSTNMPFTNLPIPREKDPRFCDSSQCTQYLYQNLYNPVVEHNSQLNPTESTASPIYIVKKPANKKHQIQFQTDFYSPGKPIIKNKLNSGSANMEMYTDHQN 783          
BLAST of NEPH-3 vs. Planmine SMEST
Match: SMESG000022777.1 (SMESG000022777.1)

HSP 1 Score: 655.981 bits (1691), Expect = 0.000e+0
Identity = 334/335 (99.70%), Postives = 335/335 (100.00%), Query Frame = 3
Query:  336 KKITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGATXXXXXXXXXXXXXXXXXQRRKFKDEYMKGNPSSPEIPLHHEAKSTLIDSDCQCNPNLYSWIPQSFDVKSQNDVLSKIHYQDGNFWPNSQEIESCYSNSVPDSQSSNKSVKITKHD 1340
            KKITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGATIIFLFILLVIIVVLCICQRRKFKDEYMKGNPSSPEIPLHHEAKSTLIDSDCQCNPNLYSWIPQSFDVKSQNDVLSKIHYQDGNFWPNSQEIESCYSNSVPDSQSSNKSVKITKH+
Sbjct:  324 KKITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKIVTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGATIIFLFILLVIIVVLCICQRRKFKDEYMKGNPSSPEIPLHHEAKSTLIDSDCQCNPNLYSWIPQSFDVKSQNDVLSKIHYQDGNFWPNSQEIESCYSNSVPDSQSSNKSVKITKHE 658          

HSP 2 Score: 202.216 bits (513), Expect = 0.000e+0
Identity = 112/112 (100.00%), Postives = 112/112 (100.00%), Query Frame = 1
Query:    7 YDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKK 342
            YDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQIVVYTVPIVVINVYPKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKK
Sbjct:  214 YDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQIVVYTVPIVVINVYPKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKK 325          

HSP 3 Score: 256.144 bits (653), Expect = 7.345e-74
Identity = 125/142 (88.03%), Postives = 129/142 (90.85%), Query Frame = 1
Query: 1300 ANPVINQSRSPSMIIIFIKRNANTNPILYNMHTIGTNTLNRYSTNMPFTNLPIPREKDPRFCDSSQCTQYLYQNLYNPVVEHNSQLNPTESTASPIYIVKKPANKKHQIQFQTDFYSPGKPIIKNKLNSGSANMEMYTDHQH 1725
            +N V +   S   + I    NANTNPILYNMHTIGTNTLNRYSTNMPFTNLPIPREKDPRFCDSSQCTQYLYQNLYNPVVEHNSQLNPTESTASPIYIVKKPANKKHQIQFQTDFYSPGKPIIKNKLNSGSANMEMYTDHQ+
Sbjct:  639 SNSVPDSQSSNKSVKITKHENANTNPILYNMHTIGTNTLNRYSTNMPFTNLPIPREKDPRFCDSSQCTQYLYQNLYNPVVEHNSQLNPTESTASPIYIVKKPANKKHQIQFQTDFYSPGKPIIKNKLNSGSANMEMYTDHQN 780          
BLAST of NEPH-3 vs. Planmine SMEST
Match: SMESG000071657.1 (SMESG000071657.1)

HSP 1 Score: 181.415 bits (459), Expect = 1.133e-57
Identity = 124/370 (33.51%), Postives = 205/370 (55.41%), Query Frame = 3
Query:  312 KDNSSRSWKK--ITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLL-EGTRHKMYRQINEKIVTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGATXXXXXXXXXXXXXXXXXQRRKFKDEYMKGNPSSPEIPLHHEA---KSTLIDSDCQCNPNLYSWIP-------QSFDVKSQNDVLSKIHYQDGNF-WPNSQEIESCYSNSVPDSQSSNKSVKITKHDYYIYKKERQHQSN 1379
            K  ++R+  K  + C A +   G +   + VKYGP FKD DS  +Y A+IG+++ + C  D NP   I WQR S+N++I  G+IL R +IQ  DFG YIC A V+ F  + K I L ++  P I+         G+S +  C I SIP  N N+I W+++ ++L+ + T++ +  +       S+L I ++Q  DFG YNCSV+T  GS    ++L + S  P+++IVG T+    +++++I+ LC+C+R    ++Y KG+P++  I  ++     KS   + D QC PN + WIP       +S  V+   DV  +   ++G+       ++ S Y++S+P SQ+  K ++    D  +YK+E    SN
Sbjct:  316 KIKATRTMNKAVVKCIANNGKEGHDLRMLNVKYGPQFKD-DSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSPIPLILIVGGTVFITMVMMIVIIALCVCKRGICSNKYQKGSPTN-RINSNNSTDPLKSPQFEMDYQCQPNFFQWIPNNNREQVKSSFVRYGQDVDDRSSIRNGSINQYRGLDMCSTYTSSIPGSQNGEKPIRNPDID-DVYKEEFYPSSN 682          

HSP 2 Score: 62.7734 bits (151), Expect = 1.133e-57
Identity = 38/108 (35.19%), Postives = 55/108 (50.93%), Query Frame = 1
Query:   10 DVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQXXXXXXXXXXXXXXXKKQN--NIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRV 327
            D  ++L+ K+  L NG  +KC A N G+  +K N+  A+  +       + +    QN  N F END +  +CSA GRP  F W W I D  ++N     YK+K TR 
Sbjct:  217 DSFSTLKAKVNQLLNGKSIKCSATNRGF--EKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRT 322          
BLAST of NEPH-3 vs. Planmine SMEST
Match: SMESG000074081.1 (SMESG000074081.1)

HSP 1 Score: 120.553 bits (301), Expect = 1.004e-27
Identity = 82/250 (32.80%), Postives = 124/250 (49.60%), Query Frame = 3
Query:  342 ITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITW--QRISSNEVIAR----GSILLRNDIQ----------------------ADDFGDYICKAAVKEFPERHKYIYLGEKGPPEI-KNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKN---KQLLEGTRHKMYRQINEKIVTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGAT 995
            + C     + G +   + V+Y P   DS  L   AA +G+ + ++CRAD NP   ITW   + SS E++A     G+  L+ D Q                      AD+ G +IC A    FP   K +++G+   P+I  N  +   + G S R+SC I SIP P+  +I W FKN   K +   +++++Y +     V S L+I  V   D+G YNCSVS  YG   +TI L+   ETPM+ I+G++
Sbjct:  375 VNCSERHTANGSSQIILRVQYSPIILDS-ILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQMSSYSSMTLLSISDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIW-FKNLNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGTYNCSVSNPYGRVSSTIELIPPVETPMIFIIGSS 622          
BLAST of NEPH-3 vs. Planmine SMEST
Match: SMESG000053066.1 (SMESG000053066.1)

HSP 1 Score: 103.99 bits (258), Expect = 5.874e-23
Identity = 66/220 (30.00%), Postives = 107/220 (48.64%), Query Frame = 3
Query:  348 CCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNE---VIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLLEGTRHKMYRQINEKI---VTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVG 989
            C     +I      + + Y P+ +D  S    A  + +++ + C A GNP+P I W +I S +   ++ R    +      +D+G+Y C A    F    K + +G  GPP+I      +    +  +L+CTI+SIP P+  +I W  +N ++++     M +   E I   V   L I++V   DFG YNCSV T+YGSD  +I L +     ML+ V 
Sbjct:  248 CAVLPVTIASKEIELSISYPPSIEDLQSNITIATHLRKSIHLSCIATGNPKPKIYWFKIVSGKQEILLTRQPSFILQMSTHNDYGEYQCHALSPGFDRAVKRVIVGTPGPPKIYGSPKIFSELLKPIKLTCTIRSIPAPSPKQIIWT-RNYKIVDVPDRIMTKM--EWIPGGVIMTLIIVAVSYEDFGVYNCSVFTEYGSDYFSITLYQTENLSMLLCVA 464          
The following BLAST results are available for this feature:
BLAST of NEPH-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIRREL31.523e-1927.60kirre like nephrin family adhesion molecule 3 [Sou... [more]
KIRREL18.646e-1832.07kirre like nephrin family adhesion molecule 1 [Sou... [more]
KIRREL11.001e-1732.07kirre like nephrin family adhesion molecule 1 [Sou... [more]
KIRREL31.306e-1726.61kirre like nephrin family adhesion molecule 3 [Sou... [more]
KIRREL11.402e-1732.07kirre like nephrin family adhesion molecule 1 [Sou... [more]
back to top
BLAST of NEPH-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syg-19.728e-1325.70Synaptogenesis protein syg-1 [Source:UniProtKB/Sw... [more]
syg-11.024e-1225.70Synaptogenesis protein syg-1 [Source:UniProtKB/Sw... [more]
pxn-21.096e-929.05PeroXidasiN (Drosophila peroxidase) homolog [Sour... [more]
rig-51.661e-822.33NeuRonal IGCAM [Source:UniProtKB/TrEMBL;Acc:H2FLI... [more]
wrk-12.186e-825.84Wrapper/Rega-1/Klingon homolog [Source:UniProtKB/... [more]
back to top
BLAST of NEPH-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rst4.429e-2230.04gene:FBgn0003285 transcript:FBtr0343758[more]
rst4.429e-2230.04gene:FBgn0003285 transcript:FBtr0070562[more]
kirre7.668e-1829.74gene:FBgn0028369 transcript:FBtr0332492[more]
kirre7.668e-1829.74gene:FBgn0028369 transcript:FBtr0309498[more]
kirre7.668e-1829.74gene:FBgn0028369 transcript:FBtr0070560[more]
back to top
BLAST of NEPH-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kirrel3a5.608e-2027.27kirre like nephrin family adhesion molecule 3a [So... [more]
kirrel3a6.816e-2027.27kirre like nephrin family adhesion molecule 3a [So... [more]
kirrel3a6.816e-2027.27kirre like nephrin family adhesion molecule 3a [So... [more]
kirrel3a9.923e-2027.27kirre like nephrin family adhesion molecule 3a [So... [more]
KIRREL35.464e-1929.13kirre like nephrin family adhesion molecule 3 [Sou... [more]
back to top
BLAST of NEPH-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
igfbp42.189e-2330.00insulin like growth factor binding protein 4 [Sour... [more]
igfbp42.259e-2330.00insulin like growth factor binding protein 4 [Sour... [more]
igfbp42.373e-2330.00insulin like growth factor binding protein 4 [Sour... [more]
igfbp42.396e-2330.00insulin like growth factor binding protein 4 [Sour... [more]
igfbp42.580e-2330.00insulin like growth factor binding protein 4 [Sour... [more]
back to top
BLAST of NEPH-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kirrel38.218e-2027.73kirre like nephrin family adhesion molecule 3 [Sou... [more]
Kirrel38.218e-2027.73kirre like nephrin family adhesion molecule 3 [Sou... [more]
Kirrel31.076e-1927.73kirre like nephrin family adhesion molecule 3 [Sou... [more]
Kirrel31.082e-1927.73kirre like nephrin family adhesion molecule 3 [Sou... [more]
Kirrel9.610e-1928.83kirre like nephrin family adhesion molecule 1 [Sou... [more]
back to top
BLAST of NEPH-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08180|ICCR_DROME3.391e-2130.04Irregular chiasm C-roughest protein OS=Drosophila ... [more]
sp|Q6X936|KIRR1_RAT4.879e-1828.83Kin of IRRE-like protein 1 OS=Rattus norvegicus OX... [more]
sp|Q80W68|KIRR1_MOUSE5.844e-1828.83Kin of IRRE-like protein 1 OS=Mus musculus OX=1009... [more]
sp|Q8BR86|KIRR3_MOUSE5.660e-1726.61Kin of IRRE-like protein 3 OS=Mus musculus OX=1009... [more]
sp|Q8IZU9|KIRR3_HUMAN5.754e-1726.61Kin of IRRE-like protein 3 OS=Homo sapiens OX=9606... [more]
back to top
BLAST of NEPH-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJJ73.652e-7099.40NEPH-3 (Fragment) OS=Schmidtea mediterranea OX=793... [more]
A0A0H3YFE92.417e-5433.51NEPH-2 OS=Schmidtea mediterranea OX=79327 GN=NEPH-... [more]
A0A4S2MJS29.272e-5137.67Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2MJ831.015e-5037.67Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A419PMQ91.212e-5037.67Kin of IRRE-like protein 3 OS=Clonorchis sinensis ... [more]
back to top
BLAST of NEPH-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIRREL39.744e-2128.64kirre like nephrin family adhesion molecule 3 [Sou... [more]
KIRREL39.751e-2128.64kirre like nephrin family adhesion molecule 3 [Sou... [more]
kirrel3a1.958e-2027.40kirre like nephrin family adhesion molecule 3a [So... [more]
kirrel3l1.180e-1728.05kirre like nephrin family adhesion molecule 3, lik... [more]
kirrel3l1.195e-1728.05kirre like nephrin family adhesion molecule 3, lik... [more]
back to top
BLAST of NEPH-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010550.19.511e-1830.41pep scaffold:Pmarinus_7.0:GL479154:26986:35474:-1 ... [more]
igdcc32.674e-926.78immunoglobulin superfamily, DCC subclass, member 3... [more]
cntn3b4.561e-924.88contactin 3b [Source:ZFIN;Acc:ZDB-GENE-130530-645][more]
pxdn1.611e-825.27peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2][more]
ENSPMAT00000004605.18.541e-822.93pep scaffold:Pmarinus_7.0:GL476854:241038:246210:-... [more]
back to top
BLAST of NEPH-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NEPH-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO303507.067e-1429.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340583.448e-1029.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO351851.140e-926.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495585.981e-926.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO274771.944e-826.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of NEPH-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIRREL31.444e-2128.77kirre like nephrin family adhesion molecule 3 [Sou... [more]
KIRREL31.455e-2128.77kirre like nephrin family adhesion molecule 3 [Sou... [more]
KIRREL31.564e-2128.77kirre like nephrin family adhesion molecule 3 [Sou... [more]
KIRREL35.668e-2028.25kirre like nephrin family adhesion molecule 3 [Sou... [more]
kirrel1a3.468e-1727.75kin of IRRE-like protein 1 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of NEPH-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022777.16.569e-7499.70SMESG000022777.1[more]
SMESG000022777.17.345e-7499.70SMESG000022777.1[more]
SMESG000071657.11.133e-5733.51SMESG000071657.1[more]
SMESG000074081.11.004e-2732.80SMESG000074081.1[more]
SMESG000053066.15.874e-2330.00SMESG000053066.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30022844
GenBankAKN21716.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022844 ID=SMED30022844|Name=NEPH-3|organism=Schmidtea mediterranea sexual|type=transcript|length=2279bp
TTTAGATATGATGTTGTAAATAGTTTGGAATTGAAAATTGTCAGTTTGAA
GAACGGAAACTGGTTGAAATGCTTAGCTATAAATAATGGATATACAAATC
AAAAATTAAATTATACTTCAGCTCAAATCGTAGTTTATACAGTTCCAATT
GTCGTTATCAATGTCTATCCAAAGAAACAAAATAATATTTTCATTGAAAA
TGACATAGTCGAATTTACTTGCTCAGCTTCTGGACGGCCAAGCGACTTTC
ATTGGGCATGGACTATTGGAGACGAATCGTTAGTCAATATTCGAGATCCT
AAATATAAGTTAAAGATAACTCGAGTCGATCATGGAAAAAAATAACTTGC
TGTGCAACGTCAAAATCAATAGGATGCAATTCTACAAATATTTTAGTAAA
ATATGGTCCAAACTTCAAAGATTCAGATTCGTTAACTATATATGCAGCGT
CAATTGGAGAGAACATGCAAATGGAATGTAGAGCTGATGGAAACCCTGAG
CCACTGATAACGTGGCAAAGGATTTCTAGCAATGAAGTTATAGCTCGAGG
TTCGATTTTATTACGTAATGATATTCAAGCAGACGATTTCGGCGATTACA
TTTGTAAAGCTGCTGTGAAAGAATTTCCAGAAAGACATAAATATATTTAT
CTTGGAGAAAAAGGACCTCCAGAAATCAAAAACCCTTCTGTTAGTTACGG
ACGTGAAGGCCAAAGTGCAAGGCTGAGTTGCACAATTAAATCAATTCCAT
TTCCGAACGACAATGAAATAAAATGGATTTTTAAAAATAAACAACTTTTG
GAAGGGACAAGACATAAAATGTACAGACAGATAAATGAAAAGATTGTCAC
CTCTGTTTTGCATATTTTATCCGTTCAACCTCACGATTTCGGAGATTATA
ACTGTTCAGTTTCAACAAAATATGGATCAGACATGGCAACGATAATTTTG
TTAAGAAAAAGTGAAACTCCTATGCTGATGATTGTTGGAGCAACGATAAT
ATTTTTGTTTATATTATTAGTAATAATTGTGGTGCTTTGCATTTGCCAGA
GACGGAAGTTTAAAGATGAATATATGAAAGGAAATCCTTCAAGCCCGGAA
ATTCCACTGCATCATGAGGCAAAGTCAACATTAATTGACTCGGATTGTCA
ATGTAATCCAAATTTATACAGCTGGATTCCCCAGTCATTTGATGTGAAAT
CCCAAAATGATGTCCTTAGTAAAATACATTATCAGGATGGGAATTTTTGG
CCGAATTCCCAGGAAATTGAATCATGTTATTCCAACTCAGTGCCGGATAG
CCAATCCAGTAATAAATCAGTCAAGATCACCAAGCATGATTATTATATTT
ATAAAAAGGAACGCCAACACCAATCCAATACTATACAACATGCATACTAT
TGGAACAAATACTCTTAACAGATATTCTACAAATATGCCATTTACAAATC
TACCAATTCCTAGAGAAAAGGATCCCCGTTTCTGTGATTCATCTCAATGT
ACTCAATATCTTTATCAGAATCTTTATAATCCTGTTGTTGAGCATAATTC
CCAACTGAATCCTACCGAGAGTACGGCTAGTCCAATTTACATTGTAAAGA
AACCCGCCAACAAAAAACACCAAATACAATTCCAAACAGATTTTTATAGC
CCTGGAAAGCCAATTATTAAAAACAAATTAAATAGCGGTTCGGCTAACAT
GGAAATGTACACAGATCATCAACACCAAACTCATCTCAGATTATGCCAGC
AACATTTAAAATATTTTCATTTAAAACAAAAAAACTGATTTTTTTTCTAT
TAAAACAAAAATTCGCTTTATCAATTCTTTTTGATAAAATATTTGATTTG
TCAATCACAATGATTTTATGTATTGAAAATTATAATAAACTAGTAAATAA
ATTATTTATTTAATTAATGTTAGTTAATTTATAACATTTGCTATTTGATG
AATTTATCAGTGGAGTTTTGATCATTTTAAGTCACTGTGGAAAGGAGAAT
CAAAGTTTCCTTATTGTCAACGAGATGTATTATCAAATGAGTCGTGCAAC
GGAATCTTTTCATTTGGGCAATAATCGAATACTCTAGTAAACTGTCATTG
GTGGTCTACGTTGGGGGGGAGATTTGTTTACGTTGTTTTCCTTTGGATAT
CAACATTCACTTTCATCTATGTATATGAGATCAATGTAAATAGAAATATT
GATTTGTGTTGTTTTTCAGAACTCTATCAGAACAGAACTTTGGAATTTTT
CGATTTTTCGAAAACCACAAAATTCGGAC
back to top

protein sequence of SMED30022844-orf-1

>SMED30022844-orf-1 ID=SMED30022844-orf-1|Name=SMED30022844-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=318bp
MQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAA
VKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDN
EIKWIFKNKQLLEGTRHKMYRQINEKIVTSVLHILSVQPHDFGDYNCSVS
TKYGSDMATIILLRKSETPMLMIVGATIIFLFILLVIIVVLCICQRRKFK
DEYMKGNPSSPEIPLHHEAKSTLIDSDCQCNPNLYSWIPQSFDVKSQNDV
LSKIHYQDGNFWPNSQEIESCYSNSVPDSQSSNKSVKITKHDYYIYKKER
QHQSNTIQHAYYWNKYS*
back to top

protein sequence of SMED30022844-orf-2

>SMED30022844-orf-2 ID=SMED30022844-orf-2|Name=SMED30022844-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=115bp
FRYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQIVVYTVPI
VVINVYPKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDP
KYKLKITRVDHGKK*
back to top

protein sequence of SMED30022844-orf-3

>SMED30022844-orf-3 ID=SMED30022844-orf-3|Name=SMED30022844-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=194bp
MMSLVKYIIRMGIFGRIPRKLNHVIPTQCRIANPVINQSRSPSMIIIFIK
RNANTNPILYNMHTIGTNTLNRYSTNMPFTNLPIPREKDPRFCDSSQCTQ
YLYQNLYNPVVEHNSQLNPTESTASPIYIVKKPANKKHQIQFQTDFYSPG
KPIIKNKLNSGSANMEMYTDHQHQTHLRLCQQHLKYFHLKQKN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000142posterior region of the whole animal
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR003599Ig_sub
IPR003598Ig_sub2
IPR013783Ig-like_fold
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane