Chromosome 17 open reading frame 98

Overview
NameChromosome 17 open reading frame 98
Smed IDSMED30022841
Length (bp)755
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Chromosome 17 open reading frame 98 (SMED30022841) t-SNE clustered cells

Violin plots show distribution of expression levels for Chromosome 17 open reading frame 98 (SMED30022841) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Chromosome 17 open reading frame 98 (SMED30022841) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Chromosome 17 open reading frame 98 (SMED30022841) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Chromosome 17 open reading frame 98 vs. Ensembl Human
Match: C17orf98 (chromosome 17 open reading frame 98 [Source:HGNC Symbol;Acc:HGNC:34492])

HSP 1 Score: 126.716 bits (317), Expect = 5.376e-36
Identity = 68/144 (47.22%), Postives = 89/144 (61.81%), Query Frame = 3
Query:  186 EKSFILDCRAVSNISRDYSRANPKHGSVIPPYNGQRDKSANKYFQIKGVEDVLKRNQQSPPGSSIEGPILERFYISGEGAHYLIYRNNHGCGLSPEEFEGHSHYMSDIKDYNIGFNGKFGYRRNTPFLRKYPSSFGVLTKSPLY 617
            EK FILD  AVS  +R Y R+ PK  S IPPYN Q+D  A  YFQ   V  +L++  Q   G+  +G I++  +I G+G  YL  RN  G G S ++  GH HY +D+K  + GFNG+FGYRRNTP LR+  S FG +T  PL+
Sbjct:   12 EKGFILDGVAVSTAARAYGRSRPKLWSAIPPYNAQQDYHARSYFQSHVVPPLLRKTDQDHGGTGRDGWIVDYIHIFGQGQRYLNRRNWAGTGHSLQQVTGHDHYNADLKPID-GFNGRFGYRRNTPALRQSTSVFGEVTHFPLF 154          
BLAST of Chromosome 17 open reading frame 98 vs. Ensembl Human
Match: C17orf98 (chromosome 17 open reading frame 98 [Source:HGNC Symbol;Acc:HGNC:34492])

HSP 1 Score: 126.716 bits (317), Expect = 5.376e-36
Identity = 68/144 (47.22%), Postives = 89/144 (61.81%), Query Frame = 3
Query:  186 EKSFILDCRAVSNISRDYSRANPKHGSVIPPYNGQRDKSANKYFQIKGVEDVLKRNQQSPPGSSIEGPILERFYISGEGAHYLIYRNNHGCGLSPEEFEGHSHYMSDIKDYNIGFNGKFGYRRNTPFLRKYPSSFGVLTKSPLY 617
            EK FILD  AVS  +R Y R+ PK  S IPPYN Q+D  A  YFQ   V  +L++  Q   G+  +G I++  +I G+G  YL  RN  G G S ++  GH HY +D+K  + GFNG+FGYRRNTP LR+  S FG +T  PL+
Sbjct:   12 EKGFILDGVAVSTAARAYGRSRPKLWSAIPPYNAQQDYHARSYFQSHVVPPLLRKTDQDHGGTGRDGWIVDYIHIFGQGQRYLNRRNWAGTGHSLQQVTGHDHYNADLKPID-GFNGRFGYRRNTPALRQSTSVFGEVTHFPLF 154          
BLAST of Chromosome 17 open reading frame 98 vs. Ensembl Xenopus
Match: drp2 (dystrophin related protein 2 [Source:Xenbase;Acc:XB-GENE-994502])

HSP 1 Score: 154.451 bits (389), Expect = 2.231e-46
Identity = 79/160 (49.38%), Postives = 102/160 (63.75%), Query Frame = 3
Query:  138 IYRTPPSPTTEFLRTKEKSFILDCRAVSNISRDYSRANPKHGSVIPPYNGQRDKSANKYFQIKGVEDVLKRNQQSPPGSSIEGPILERFYISGEGAHYLIYRNNHGCGLSPEEFEGHSHYMSDIKDYNIGFNGKFGYRRNTPFLRKYPSSFGVLTKSPLY 617
            + R  P P+   L+ +E+ F+LDC AV  ISRDYS + PK GSVIPPYN QRD     YF  + V  +L++  QS  G+S  G + +RF   G  A YL+ RNN G G SPE   GH  ++S +K    G+NG+FGYRRNTP LR+ PS FG +T+SPLY
Sbjct:   37 LSRFAPGPSLAELQARERRFVLDCVAVERISRDYSGSLPKLGSVIPPYNSQRDPHVRAYFHSRPVPPLLQKTGQSHGGTSTYGELADRFQYKGAAALYLLTRNNAGAGHSPEHNRGHGFFLSSVKPV-FGYNGQFGYRRNTPSLRRMPSPFGTVTRSPLY 195          
BLAST of Chromosome 17 open reading frame 98 vs. Ensembl Xenopus
Match: C17orf98 (chromosome 17 open reading frame 98 [Source:NCBI gene;Acc:100495435])

HSP 1 Score: 103.219 bits (256), Expect = 8.370e-27
Identity = 59/142 (41.55%), Postives = 83/142 (58.45%), Query Frame = 3
Query:  186 EKSFILDCRAVSNISRDYSRANPKHGSVIPPYNGQRDKSANKYFQIKGVEDVLKRNQQSPPGSSIEGPILERFYISGEGAHYLIYRNNHGCGLSPEEFEGHSHYMSDIKDYNIGFNGKFGYRRNTPFLRKYPSSFGVLTKSP 611
            EK FILD  AV  ++ +     PK    IPPYN QRD  A  YFQ   V ++L++  Q   G+S+ G I++++Y+ GEGA YL  RN  G G     + GH+   +      +G+NG++GYRRN P LR+ PS+FG +T  P
Sbjct:   26 EKGFILDGMAVRTLTGE--ERFPKLWGGIPPYNAQRDPHAAAYFQNPTVRNLLRKTGQGNGGTSMNGRIVDKYYVRGEGAVYLNLRNCSGSGHCQMHYTGHN---APSWLPMLGYNGQYGYRRNVPTLRQTPSAFGEITPFP 162          
BLAST of Chromosome 17 open reading frame 98 vs. Ensembl Mouse
Match: 1700001P01Rik (RIKEN cDNA 1700001P01 gene [Source:MGI Symbol;Acc:MGI:1919465])

HSP 1 Score: 122.094 bits (305), Expect = 2.123e-34
Identity = 64/147 (43.54%), Postives = 91/147 (61.90%), Query Frame = 3
Query:  177 RTKEKSFILDCRAVSNISRDYSRANPKHGSVIPPYNGQRDKSANKYFQIKGVEDVLKRNQQSPPGSSIEGPILERFYISGEGAHYLIYRNNHGCGLSPEEFEGHSHYMSDIKDYNIGFNGKFGYRRNTPFLRKYPSSFGVLTKSPLY 617
            R  EKSF+LD  AVS +++ YS   PK  S IPPYN Q D  + +YF+ + V  +L++  Q   G+  +G I++ F+I G+G  YL  RN  G G S ++  GH +Y S+ K    G NG+FGYRRNTP LR++ S FG +T  P++
Sbjct:    9 RRLEKSFVLDGVAVSTMAQAYSIMRPKLWSAIPPYNPQLDHHSRRYFRSRVVPPILRKTDQDHGGTGRDGWIVDYFHIFGQGQRYLNRRNWAGAGHSLQQVSGHDYYNSNPKAITTGLNGRFGYRRNTPALRQHTSVFGEVTPFPIF 155          
BLAST of Chromosome 17 open reading frame 98 vs. UniProt/SwissProt
Match: sp|A8MV24|CQ098_HUMAN (Uncharacterized protein C17orf98 OS=Homo sapiens OX=9606 GN=C17orf98 PE=4 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 2.582e-35
Identity = 68/144 (47.22%), Postives = 89/144 (61.81%), Query Frame = 3
Query:  186 EKSFILDCRAVSNISRDYSRANPKHGSVIPPYNGQRDKSANKYFQIKGVEDVLKRNQQSPPGSSIEGPILERFYISGEGAHYLIYRNNHGCGLSPEEFEGHSHYMSDIKDYNIGFNGKFGYRRNTPFLRKYPSSFGVLTKSPLY 617
            EK FILD  AVS  +R Y R+ PK  S IPPYN Q+D  A  YFQ   V  +L++  Q   G+  +G I++  +I G+G  YL  RN  G G S ++  GH HY +D+K  + GFNG+FGYRRNTP LR+  S FG +T  PL+
Sbjct:   12 EKGFILDGVAVSTAARAYGRSRPKLWSAIPPYNAQQDYHARSYFQSHVVPPLLRKTDQDHGGTGRDGWIVDYIHIFGQGQRYLNRRNWAGTGHSLQQVTGHDHYNADLKPID-GFNGRFGYRRNTPALRQSTSVFGEVTHFPLF 154          
BLAST of Chromosome 17 open reading frame 98 vs. UniProt/SwissProt
Match: sp|Q9DAQ5|CQ098_MOUSE (Uncharacterized protein C17orf98 homolog OS=Mus musculus OX=10090 PE=2 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 1.485e-33
Identity = 64/147 (43.54%), Postives = 91/147 (61.90%), Query Frame = 3
Query:  177 RTKEKSFILDCRAVSNISRDYSRANPKHGSVIPPYNGQRDKSANKYFQIKGVEDVLKRNQQSPPGSSIEGPILERFYISGEGAHYLIYRNNHGCGLSPEEFEGHSHYMSDIKDYNIGFNGKFGYRRNTPFLRKYPSSFGVLTKSPLY 617
            R  EKSF+LD  AVS +++ YS   PK  S IPPYN Q D  + +YF+ + V  +L++  Q   G+  +G I++ F+I G+G  YL  RN  G G S ++  GH +Y S+ K    G NG+FGYRRNTP LR++ S FG +T  P++
Sbjct:    9 RRLEKSFVLDGVAVSTMAQAYSIMRPKLWSAIPPYNPQLDHHSRRYFRSRVVPPILRKTDQDHGGTGRDGWIVDYFHIFGQGQRYLNRRNWAGAGHSLQQVSGHDYYNSNPKAITTGLNGRFGYRRNTPALRQHTSVFGEVTPFPIF 155          
BLAST of Chromosome 17 open reading frame 98 vs. TrEMBL
Match: A0A210R124 (Uncharacterized protein C17orf98 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT05037 PE=4 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 1.265e-52
Identity = 89/165 (53.94%), Postives = 108/165 (65.45%), Query Frame = 3
Query:  114 SNKSKHNKIYRTPPSPTTEFLRTKEKSFILDCRAVSNISRDYSRANPKHGSVIPPYNGQRDKSANKYFQIKGVEDVLKRNQQSPPGSSIEGPILERFYISGEGAHYLIYRNNHGCGLSPEEFEGHSHYMSDIKDYNIGFNGKFGYRRNTPFLRKYPSSFGVLTKS 608
            S K +HNKIYRTP +P  E L  KEK F+LDC A S+IS DYS+ NPK G VIPPYN QRD   + YFQ +GV+  L   +Q PPG S+EGP+ + F   G G  YL  RN  G G S E  +GHS +M  I+  N G+NG FGYRRNTP+LR  PS FG  ++S
Sbjct:   12 SLKGRHNKIYRTPGTPPPEVLMEKEKGFVLDCNAASSISTDYSKTNPKLGPVIPPYNSQRDTHVDPYFQFQGVQKTLALTKQDPPGCSLEGPVADYFNDKGTGYQYLSLRNKFGAGHSRELVDGHSQFMKGIEPVN-GYNGPFGYRRNTPWLRAEPSPFGTASRS 175          
BLAST of Chromosome 17 open reading frame 98 vs. TrEMBL
Match: K1QVW1 (Uncharacterized protein C17orf98 OS=Crassostrea gigas OX=29159 GN=CGI_10025311 PE=4 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 4.398e-51
Identity = 86/171 (50.29%), Postives = 115/171 (67.25%), Query Frame = 3
Query:   96 MSNSARSNKSKHNKIYRTPPSPTTEFLRTKEKSFILDCRAVSNISRDYSRANPKHGSVIPPYNGQRDKSANKYFQIKGVEDVLKRNQQSPPGSSIEGPILERFYISGEGAHYLIYRNNHGCGLSPEEFEGHSHYMSDIKDYNIGFNGKFGYRRNTPFLRKYPSSFGVLTKS 608
            M +++ S K + NKIYRTP +P  +    KEK F+LDC AVS+IS DYS+ NPK G VIPPYN Q+DK  ++YF+  GV + L++  Q+  G+SIEGP+ + F   G G  YL  RN  G G S E  +GH+ +M  ++   IG+NGKFGYRRNTP+LRK PS FG  ++S
Sbjct:    1 MPSNSASEKGRENKIYRTPSTPPPDVQLEKEKGFVLDCSAVSSISTDYSKTNPKLGPVIPPYNSQKDKHVDEYFEFIGVNETLEKTGQTEGGTSIEGPVADYFNDKGTGFQYLSLRNQFGAGHSGETTDGHAQFMQGVQPV-IGYNGKFGYRRNTPWLRKDPSPFGTGSRS 170          
BLAST of Chromosome 17 open reading frame 98 vs. TrEMBL
Match: A0A3S0ZV24 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_016289 PE=4 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 4.540e-51
Identity = 89/174 (51.15%), Postives = 117/174 (67.24%), Query Frame = 3
Query:   93 KMSNSARSNKSKHNKIYRTPPSPTTEFLRTKEKSFILDCRAVSNISRDYSRANPKHGSVIPPYNGQRDKSANKYFQIKGVEDVLKRNQQS-PPGSSIEGPILERFYISGEGAHYLIYRNNHGCGLSPEEFEGHSHYMSDIKDYNIGFNGKFGYRRNTPFLRKYPSSFGVLTKSP 611
            K + S+ + K + NKIYRTPP+P    L  KEKSF+LDC A S+ISRDY +ANPK G VIPPYN Q+DK  + YF+  GV+  L++  Q+    SSIEGP+L+RF   G G +YL  RN  G G S +  +GH+ +M  IK  + G+NGK+G+RRNTP+LRK P+ F   T SP
Sbjct:   34 KQTRSSSAQKGRANKIYRTPPTPDQGDLLVKEKSFVLDCNATSSISRDYCQANPKLGPVIPPYNSQKDKHVDNYFRFYGVDSTLRKTGQAGETASSIEGPVLDRFNDKGAGFNYLSLRNQFGAGHSQDVIDGHAQFMQGIKAVS-GYNGKYGFRRNTPWLRKTPTPFEPATISP 206          
BLAST of Chromosome 17 open reading frame 98 vs. TrEMBL
Match: A0A1I8GS26 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 4.969e-51
Identity = 91/186 (48.92%), Postives = 120/186 (64.52%), Query Frame = 3
Query:   93 KMSNSARSNKSKHNKIYRTPPSPTTEFLRTKEKSFILDCRAVSNISRDYSRANPKHGSVIPPYNGQRDKSANKYFQIKGVEDVLKRNQQSPPGSSIEGPILERFYISGEGAHYLIYRNN-HGCGLSPEEFEGHS----HYMSDIKDYN------IGFNGKFGYRRNTPFLRKYPSSFGVLTKSPLY 617
            K +  A +  S+ NK+YRTPP+P ++ L  +E+SF+LD R +++IS DYSRANPK GSVIPPYN Q+D     YF   GV+  L +N+Q+PPG+ +EGP +ERF+ SG G  YL  RN   G G S EE  GH     H   +I  Y        G+NG+FGYRR TP LR+ PS FGV T++P+Y
Sbjct:   49 KTNKQAAAKPSRRNKLYRTPPTPDSDALFERERSFVLDSRVMASISEDYSRANPKVGSVIPPYNAQKDNYVKTYFDFIGVKKTLNKNKQNPPGTCVEGPAMERFFTSGHGKQYLTPRNERQGNGYSNEERMGHGKLWRHPNPEIAQYERQPPEFQGYNGRFGYRRTTPRLRQEPSPFGVNTETPIY 234          
BLAST of Chromosome 17 open reading frame 98 vs. TrEMBL
Match: A0A1I8HLN7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 5.337e-51
Identity = 91/186 (48.92%), Postives = 120/186 (64.52%), Query Frame = 3
Query:   93 KMSNSARSNKSKHNKIYRTPPSPTTEFLRTKEKSFILDCRAVSNISRDYSRANPKHGSVIPPYNGQRDKSANKYFQIKGVEDVLKRNQQSPPGSSIEGPILERFYISGEGAHYLIYRNN-HGCGLSPEEFEGHS----HYMSDIKDYN------IGFNGKFGYRRNTPFLRKYPSSFGVLTKSPLY 617
            K +  A +  S+ NK+YRTPP+P ++ L  +E+SF+LD R +++IS DYSRANPK GSVIPPYN Q+D     YF   GV+  L +N+Q+PPG+ +EGP +ERF+ SG G  YL  RN   G G S EE  GH     H   +I  Y        G+NG+FGYRR TP LR+ PS FGV T++P+Y
Sbjct:   58 KTNKQAAAKPSRRNKLYRTPPTPDSDALFERERSFVLDSRVMASISEDYSRANPKVGSVIPPYNAQKDNYVKTYFDFIGVKKTLNKNKQNPPGTCVEGPAMERFFTSGHGKQYLTPRNERQGNGYSNEERMGHGKLWRHPNPEIAQYERQPPEFQGYNGRFGYRRTTPRLRQEPSPFGVNTETPIY 243          
BLAST of Chromosome 17 open reading frame 98 vs. Ensembl Nematostella
Match: EDO37553 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFG2])

HSP 1 Score: 140.584 bits (353), Expect = 6.491e-42
Identity = 70/147 (47.62%), Postives = 92/147 (62.59%), Query Frame = 3
Query:  150 PPSPTTEFLRTKEKSFILDCRAVSNISRDYSRANPKHGSVIPPYNGQRDKSANKYFQIKGVEDVLKRNQQSPPGSSIEGPILERFYISGEGAHYLIYRNNHGCGLSPEEFEGHSHYMSDIKDYNIGFNGKFGYRRNTPFLRKYPSSF 590
            PP  T E L+  EK F+LD  AVS ++ D  RANPK  + IPPYN Q+DK A  YF  + V+ +L R QQ PPG SI G  +++FY  G    YL YRN+ G G S  +  GH  +M ++   N G++G FG+RRNTP+LR+ PS F
Sbjct:   17 PPQRTPEELKLLEKGFVLDNIAVSTLADDSGRANPKMNTAIPPYNAQKDKHATDYFTKRTVQRLLTRTQQRPPGDSIMGKQMDKFYTRGMMGAYLTYRNSAGAGHSKGQVGGHGMFMENLPPIN-GWHGPFGFRRNTPWLRRQPSVF 162          
BLAST of Chromosome 17 open reading frame 98 vs. Ensembl Nematostella
Match: EDO28497 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6A9])

HSP 1 Score: 65.855 bits (159), Expect = 1.716e-14
Identity = 31/62 (50.00%), Postives = 40/62 (64.52%), Query Frame = 3
Query:  174 LRTKEKSFILDCRAVSNISRDYSRANPKHGSVIPPYNGQRDKSANKYFQIKGVEDVLKRNQQ 359
            L+  EK F+LD  AVS ++ D  RANPK  + IPPYN Q+DK A  YF  + V+ +L R QQ
Sbjct:    2 LKLLEKGFVLDNIAVSTLADDSGRANPKMNTAIPPYNAQKDKHATDYFTKRTVQRLLTRTQQ 63          
BLAST of Chromosome 17 open reading frame 98 vs. Planmine SMEST
Match: SMESG000007056.1 (SMESG000007056.1)

HSP 1 Score: 357.066 bits (915), Expect = 8.902e-127
Identity = 174/175 (99.43%), Postives = 174/175 (99.43%), Query Frame = 3
Query:   96 MSNSARSNKSKHNKIYRTPPSPTTEFLRTKEKSFILDCRAVSNISRDYSRANPKHGSVIPPYNGQRDKSANKYFQIKGVEDVLKRNQQSPPGSSIEGPILERFYISGEGAHYLIYRNNHGCGLSPEEFEGHSHYMSDIKDYNIGFNGKFGYRRNTPFLRKYPSSFGVLTKSPLYN 620
            MSNSARSNKSKHNKIYRTPPSPTTEFLRTKEKSFILDCRAVSNISRDYSRANPKHGSVIPPYNGQRDKSANKYFQIKGVEDVLKRNQQSPPGSSIEGPILERFYISGEGAHYLI RNNHGCGLSPEEFEGHSHYMSDIKDYNIGFNGKFGYRRNTPFLRKYPSSFGVLTKSPLYN
Sbjct:    1 MSNSARSNKSKHNKIYRTPPSPTTEFLRTKEKSFILDCRAVSNISRDYSRANPKHGSVIPPYNGQRDKSANKYFQIKGVEDVLKRNQQSPPGSSIEGPILERFYISGEGAHYLISRNNHGCGLSPEEFEGHSHYMSDIKDYNIGFNGKFGYRRNTPFLRKYPSSFGVLTKSPLYN 175          
The following BLAST results are available for this feature:
BLAST of Chromosome 17 open reading frame 98 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
C17orf985.376e-3647.22chromosome 17 open reading frame 98 [Source:HGNC S... [more]
C17orf985.376e-3647.22chromosome 17 open reading frame 98 [Source:HGNC S... [more]
back to top
BLAST of Chromosome 17 open reading frame 98 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromosome 17 open reading frame 98 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromosome 17 open reading frame 98 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromosome 17 open reading frame 98 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
drp22.231e-4649.38dystrophin related protein 2 [Source:Xenbase;Acc:X... [more]
C17orf988.370e-2741.55chromosome 17 open reading frame 98 [Source:NCBI g... [more]
back to top
BLAST of Chromosome 17 open reading frame 98 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
1700001P01Rik2.123e-3443.54RIKEN cDNA 1700001P01 gene [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Chromosome 17 open reading frame 98 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|A8MV24|CQ098_HUMAN2.582e-3547.22Uncharacterized protein C17orf98 OS=Homo sapiens O... [more]
sp|Q9DAQ5|CQ098_MOUSE1.485e-3343.54Uncharacterized protein C17orf98 homolog OS=Mus mu... [more]
back to top
BLAST of Chromosome 17 open reading frame 98 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210R1241.265e-5253.94Uncharacterized protein C17orf98 OS=Mizuhopecten y... [more]
K1QVW14.398e-5150.29Uncharacterized protein C17orf98 OS=Crassostrea gi... [more]
A0A3S0ZV244.540e-5151.15Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A1I8GS264.969e-5148.92Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HLN75.337e-5148.92Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Chromosome 17 open reading frame 98 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromosome 17 open reading frame 98 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromosome 17 open reading frame 98 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromosome 17 open reading frame 98 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO375536.491e-4247.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO284971.716e-1450.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Chromosome 17 open reading frame 98 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromosome 17 open reading frame 98 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000007056.18.902e-12799.43SMESG000007056.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022841 ID=SMED30022841|Name=Chromosome 17 open reading frame 98|organism=Schmidtea mediterranea sexual|type=transcript|length=755bp
CACAAGCAGAATTTTATTCAGTCTAATTGCTGTACAAATTCAAAATTTAA
TCTGCTCATTGTATAAAATAACCTTAAATAAATTTATTTAGAAAAATGTC
AAATTCTGCAAGAAGTAATAAATCAAAACATAACAAAATCTATCGTACTC
CACCGTCACCAACTACAGAATTCTTACGAACTAAGGAAAAAAGTTTTATA
TTAGATTGTAGAGCTGTGTCCAACATCTCGAGAGATTACTCAAGAGCAAA
TCCTAAACATGGCTCCGTTATTCCTCCATACAATGGCCAGAGAGATAAAT
CAGCAAATAAATATTTTCAAATTAAAGGTGTGGAAGACGTGTTAAAACGT
AACCAACAATCTCCGCCTGGATCAAGCATTGAAGGACCAATACTTGAAAG
GTTTTACATAAGCGGGGAAGGGGCTCATTATTTAATATATAGAAACAATC
ACGGTTGCGGCTTGTCACCTGAAGAATTTGAAGGACATTCTCATTATATG
AGTGATATAAAAGATTACAATATTGGATTCAATGGAAAATTTGGATATAG
AAGAAACACTCCTTTTCTGAGAAAGTATCCTTCTTCATTTGGAGTCTTGA
CAAAATCACCTTTATATAATTAGCGATAATTTTTTATGAGATTATCATAG
TCAGATAAGAAACTTTATTGAAAAAAGAACTCTACAACTTATTGAATATT
TTTTTATATTTGAAATTTTGAGAATTAATTTTTTTCATAAAATAAAGTTA
TTTAG
back to top

protein sequence of SMED30022841-orf-1

>SMED30022841-orf-1 ID=SMED30022841-orf-1|Name=SMED30022841-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=176bp
MSNSARSNKSKHNKIYRTPPSPTTEFLRTKEKSFILDCRAVSNISRDYSR
ANPKHGSVIPPYNGQRDKSANKYFQIKGVEDVLKRNQQSPPGSSIEGPIL
ERFYISGEGAHYLIYRNNHGCGLSPEEFEGHSHYMSDIKDYNIGFNGKFG
YRRNTPFLRKYPSSFGVLTKSPLYN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000074oocyte
PLANA:0000096ventral epidermis
PLANA:0000231vitelline gland
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR028027DUF4542
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR028027Protein of unknown function DUF4542PFAMPF15075DUF4542coord: 31..165
e-value: 2.8E-45
score: 154.0
IPR028027Protein of unknown function DUF4542PANTHERPTHR34221FAMILY NOT NAMEDcoord: 11..173
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..23
NoneNo IPR availablePANTHERPTHR34221:SF2coord: 11..173