SMED30022829

Overview
NameSMED30022829
Smed IDSMED30022829
Length (bp)4654
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30022829 (SMED30022829) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30022829 (SMED30022829) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30022829 (SMED30022829) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30022829 (SMED30022829) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022829

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30022829SMESG000031930.1 SmedASXL_072384SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30022829SMESG000031930.1 dd_Smed_v4_15963_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30022829SMESG000031930.1 dd_Smed_v4_15963_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30022829SMESG000031930.1 dd_Smed_v4_15963_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30022829 vs. Ensembl Human
Match: DHX8 (DEAH-box helicase 8 [Source:NCBI gene;Acc:1659])

HSP 1 Score: 469.929 bits (1208), Expect = 3.333e-142
Identity = 242/574 (42.16%), Postives = 350/574 (60.98%), Query Frame = -2
Query: 1102 QAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASL--------ADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKP 2793
            QAV +N I++++GETGSGKTTQI QY+ EAG      IG TQPRR+AA+++AKRV+EE  C LG EVGY IRF+  +S  T I ++TDG+LL  C+IDP L+ Y +I++DEAHER++ TDV  G+LK  V+KR D+++I+TSAT+D  +FS YF   P+  I G+ +P+  +Y      D L   L  V+ +IHL +  GDILVFLTG+E+I+  C  L         D+  L++ P+Y A+  E Q ++F P     RKVV+ATNIAETS+TIDGI +V+D G+VK+  +N +  +  L    ISQ+QA QR GR GRT  G CYRLYT+  +             + +L    L L AM I D  +F ++DAP M  L+   E+L  LG LD    +T LG+ +  FP+EP + K+L  S   GCS  + T+ +M+  + +F   K+ +      K++F    GD+ T L +YNSWK N  S  WC EN I   ++     IR Q++G++ R+ L V     +  +  +QKAI SGFF+N ++ +  E Y  +  +++V++H SS L+  +P
Sbjct:  576 QAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVM-QIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVR--VQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQP 1146          
BLAST of SMED30022829 vs. Ensembl Human
Match: DHX8 (DEAH-box helicase 8 [Source:NCBI gene;Acc:1659])

HSP 1 Score: 469.159 bits (1206), Expect = 1.423e-141
Identity = 242/574 (42.16%), Postives = 350/574 (60.98%), Query Frame = -2
Query: 1102 QAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASL--------ADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKP 2793
            QAV +N I++++GETGSGKTTQI QY+ EAG      IG TQPRR+AA+++AKRV+EE  C LG EVGY IRF+  +S  T I ++TDG+LL  C+IDP L+ Y +I++DEAHER++ TDV  G+LK  V+KR D+++I+TSAT+D  +FS YF   P+  I G+ +P+  +Y      D L   L  V+ +IHL +  GDILVFLTG+E+I+  C  L         D+  L++ P+Y A+  E Q ++F P     RKVV+ATNIAETS+TIDGI +V+D G+VK+  +N +  +  L    ISQ+QA QR GR GRT  G CYRLYT+  +             + +L    L L AM I D  +F ++DAP M  L+   E+L  LG LD    +T LG+ +  FP+EP + K+L  S   GCS  + T+ +M+  + +F   K+ +      K++F    GD+ T L +YNSWK N  S  WC EN I   ++     IR Q++G++ R+ L V     +  +  +QKAI SGFF+N ++ +  E Y  +  +++V++H SS L+  +P
Sbjct:  576 QAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVM-QIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVR--VQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQP 1146          
BLAST of SMED30022829 vs. Ensembl Human
Match: DHX8 (DEAH-box helicase 8 [Source:NCBI gene;Acc:1659])

HSP 1 Score: 469.159 bits (1206), Expect = 1.423e-141
Identity = 242/574 (42.16%), Postives = 350/574 (60.98%), Query Frame = -2
Query: 1102 QAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASL--------ADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKP 2793
            QAV +N I++++GETGSGKTTQI QY+ EAG      IG TQPRR+AA+++AKRV+EE  C LG EVGY IRF+  +S  T I ++TDG+LL  C+IDP L+ Y +I++DEAHER++ TDV  G+LK  V+KR D+++I+TSAT+D  +FS YF   P+  I G+ +P+  +Y      D L   L  V+ +IHL +  GDILVFLTG+E+I+  C  L         D+  L++ P+Y A+  E Q ++F P     RKVV+ATNIAETS+TIDGI +V+D G+VK+  +N +  +  L    ISQ+QA QR GR GRT  G CYRLYT+  +             + +L    L L AM I D  +F ++DAP M  L+   E+L  LG LD    +T LG+ +  FP+EP + K+L  S   GCS  + T+ +M+  + +F   K+ +      K++F    GD+ T L +YNSWK N  S  WC EN I   ++     IR Q++G++ R+ L V     +  +  +QKAI SGFF+N ++ +  E Y  +  +++V++H SS L+  +P
Sbjct:  576 QAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVM-QIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVR--VQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQP 1146          
BLAST of SMED30022829 vs. Ensembl Human
Match: DHX35 (DEAH-box helicase 35 [Source:HGNC Symbol;Acc:HGNC:15861])

HSP 1 Score: 402.519 bits (1033), Expect = 8.588e-123
Identity = 226/590 (38.31%), Postives = 348/590 (58.98%), Query Frame = -2
Query: 1102 VRNNPIIVIVGETGSGKTTQIPQYILEAG-INDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEI-TKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFN----------IVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASLADI----------KNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLKDLCHIFLKLTAMDIDP-FNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITD-LGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQ--DP--IQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKP 2787
            + N   +VIVGETG GK+TQIPQY+ EAG   +G+++G+TQPRR+AA+ +A RVAEE    LG EVGY IRFD  + ++ T+I FLTDG+L+   ++DP L+ Y VI++DEAHER++ TD+ +G+LK + +KR DLR+I+ SAT+D ++F ++FN             +L +EG+ FP+   Y      D +   ++ VV +IH  +  GD+L FLTG+E++E   + L +           ++L V P+Y  +    Q KVF+ V ++ RKV+VATN+AETSITI GI +VID G+VK   +N    +  L  V +SQ+ ANQR GR GR+ SG CYRLYT++ F+   +   PE+   +L  + L+L A+ ID    FH++  P    +++  E L  LG LDK  ++T+ LG  +  FP+ P   K+L  S  +GCS  + ++ AM+  + +F+     +     +  +F+ E GD+ T LNIY ++  + K + WC E+ ++ + +   + +R QL        L V +  P      DP  + + I+SGFF N +R  S+  Y  +     +H+H +S LY  KP
Sbjct:   67 IENYQTVVIVGETGCGKSTQIPQYLAEAGWTAEGRVVGVTQPRRVAAVTVAGRVAEERGAVLGHEVGYCIRFDDCTDQLATRIKFLTDGMLVREMMVDPLLTKYSVIMLDEAHERTLYTDIAIGLLKKIQKKRGDLRLIVASATLDADKFRDFFNQNETSDPARDTCVILTVEGRTFPVDIFYLQSPVPDYIKSTVETVV-KIHQTEGDGDVLAFLTGQEEVETVVSMLIEQARALARTGMKRHLRVLPMYAGLPSFEQMKVFERVSRSVRKVIVATNVAETSITISGIVYVIDCGFVKLRAYNPRTAIECLVVVPVSQASANQRAGRGGRSRSGKCYRLYTEEAFDKLPQSTVPEMQRSNLAPVILQLKALGIDNVLRFHFMSPPPAQSMVQALELLYALGGLDKDCRLTEPLGMRIAEFPLNPMFAKMLLESGNFGCSQEILSIAAMMQIQNIFVVPPNQKSHAIRVHRKFAVEEGDHLTMLNIYEAFIKHNKDSKWCQEHFLNYKGLVRAATVREQL------KKLLVKFQVPRKSSEGDPDLVLRCIVSGFFANAARFHSTGAYRTIRDDHELHIHPASVLYAEKP 649          
BLAST of SMED30022829 vs. Ensembl Human
Match: DHX16 (DEAH-box helicase 16 [Source:HGNC Symbol;Acc:HGNC:2739])

HSP 1 Score: 408.683 bits (1049), Expect = 2.563e-121
Identity = 221/579 (38.17%), Postives = 343/579 (59.24%), Query Frame = -2
Query: 1099 AVRNNPIIVIVGETGSGKTTQIPQYILEAG-INDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASLAD--------IKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMV-LEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDP---IQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKPN 2790
            A+ N+ +++I GETGSGKTTQIPQY+ E G  N G  I  TQPRR+AA+++A RVA EM  +LG EVGY IRF+  +SE T + ++TDG+LL   + +P L++Y V++VDEAHER++ TD+  G++K +   RP+L+V++ SAT+D  RFS +F+  PV  I G+ FP+   Y      D L   +  V+ +IH+ +  GDILVFLTG+E+IE  C  L D        I+ L+V P+Y  +  + Q ++F+P     RKVVVATNIAETS+TI+GI +V+D G+ K+  +N    +  L     S++ ANQR GR GR ++G C+RLYT   ++   +E       +  L ++ L L ++ I D  +F +LD P    LL   E+L  LG L+   ++T  G+ +   PV+P + K++ AS KY CS  + T+ AM+ +   +F   K+      + +  F    GD+   LN+Y  W  +G S+ WC EN +   ++     +R QL G+L+R ++ ++      CQ     ++KAI +G+F + +R   S  Y  V +++ V +H +S L++ +P 
Sbjct:  411 AIANHQVLIIEGETGSGKTTQIPQYLFEEGYTNKGMKIACTQPRRVAAMSVAARVAREMGVKLGNEVGYSIRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYSVVMVDEAHERTLHTDILFGLIKDVARFRPELKVLVASATMDTARFSTFFDGAPVFRIPGRRFPVDIFYTKAPEADYLEACVVSVL-QIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRLGSKIRELLVLPIYANLPSDMQARIFQPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFCKQKSYNPRTGMESLTVTPCSKASANQRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEIQRTSLGNVVLLLKSLGIHDLMHFDFLDPPPYETLLLALEQLYALGALNHLGELTTSGRKMAELPVDPMLSKMILASEKYSCSEEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPGGDHLVLLNVYTQWAESGYSSQWCYENFVQFRSMRRARDVREQLEGLLERVEVGLSS-----CQGDYIRVRKAITAGYFYHTARLTRS-GYRTVKQQQTVFIHPNSSLFEQQPR 982          
BLAST of SMED30022829 vs. Ensembl Celegans
Match: mog-5 (Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 [Source:UniProtKB/Swiss-Prot;Acc:Q09530])

HSP 1 Score: 458.759 bits (1179), Expect = 2.580e-138
Identity = 239/575 (41.57%), Postives = 352/575 (61.22%), Query Frame = -2
Query: 1102 FQAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASL--------ADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDIDPF-NFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKP 2796
             +A+ +N I+V+VGETGSGKTTQ+ QY +EAG+     IG TQPRR+AA+++AKRVAEE  C+LG +VGY IRF+  +S+ T I ++TDG+LL  C+IDP LS Y +I++DEAHER++ TDV  G+LK    KRP+L++IITSAT+D  +FS YF   P+  I G+ FP+  +Y      D L      V+ +IHL +  GD+LVFLTG+E+I+  C  L         D+  L++ P+YGA+  E Q ++F P    +RKVV+ATNIAETS+TIDGI +V+D G+VK+  +N +  +  L    ISQ+ A QR GR GRT  G CYRLYT+  F             + +L    L+L AM I+   +F ++DAP +  ++     L  L  LD    +T LG+ +  FP+EP++ K+L  S   GCS  + T+ AM+  + +F   KE +      K++F    GD+ T L +YNSWK +  S  WC EN I V +++    IR QL+G++ R+ L +     ++ +  +QKAI SGFF+N ++ +  E Y  +   + V++H SS  ++ +P
Sbjct:  550 MEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVM-QIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRDVSR--VQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQP 1121          
BLAST of SMED30022829 vs. Ensembl Celegans
Match: mog-4 (Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4 [Source:UniProtKB/Swiss-Prot;Acc:O45244])

HSP 1 Score: 426.017 bits (1094), Expect = 2.242e-128
Identity = 228/578 (39.45%), Postives = 355/578 (61.42%), Query Frame = -2
Query: 1099 QAVRNNPIIVIVGETGSGKTTQIPQYILEAGI-NDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKE-SGDILVFLTGEEDIENCCASLAD--------IKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMV-LEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKPN 2793
            +AV+ + +++I GETGSGKTTQ+PQY+ EAG    GK IG TQPRR+AA+++A RVA+E+ C+LG +VGY IRF+  +SE T + ++TDG+LL   + +P L++Y V+++DEAHER++ TD+  G++K +   R DL+++I+SAT+D E+FS++F+  P+  I G+ FP+   Y      D +   +  ++ +IHL +   GDILVFLTG+E+IE    +L +        IK L+  P+Y  +  + Q K+F+P  K+ RKVV+ATNIAETS+TIDGI +VID G+ K++ F+    V  L  V IS++ ANQR GR GRT  G C+RLYT   ++   +E       + +L ++ L L ++ I D  +F +LD P    L+   E+L  LG L+   ++T LG+ +  FP +P + K++ AS KY CS  + T+ AM+     +F   K       S +  F   AGD+ T +N+YN W+ +  S  WC+EN +   T++    +R QL+G+L+R ++        +    I+KAI +G+F NVS+ +++  Y  V  K   H H +SCL++  P 
Sbjct:  375 EAVKEHQVLIIEGETGSGKTTQLPQYLYEAGFCEGGKRIGCTQPRRVAAMSVAARVADEVGCKLGTQVGYSIRFEDCTSEKTVLKYMTDGMLLREFLNEPDLASYSVMMIDEAHERTLHTDILFGLVKDIARFRKDLKLLISSATLDAEKFSSFFDDAPIFRIPGRRFPVDIYYTQAPEADYVDAAIVTIM-QIHLTQPLPGDILVFLTGQEEIETVQEALMERSKALGSKIKELIPLPVYANLPSDLQAKIFEPTPKDARKVVLATNIAETSVTIDGINYVIDPGFSKQNSFDARSGVEHLHVVTISKAAANQRAGRAGRTGPGKCFRLYTAWAYKHELEEQPIPEIQRTNLGNVVLMLKSLGIHDLVHFDFLDPPPQETLVIALEQLYALGALNHRGELTKLGRRMAEFPCDPCMSKMIIASEKYECSEEIVTIAAMLSCNAAVFYRPKAQVIHADSARKGFWSPAGDHITLMNVYNKWQESSFSQRWCVENYVQHRTMKRARDVRDQLVGLLERVEIETKSSTDTI---KIRKAITAGYFYNVSKLDNTGHYKTVKHKHTTHPHPNSCLFEETPR 948          
BLAST of SMED30022829 vs. Ensembl Celegans
Match: mog-1 (Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-1 [Source:UniProtKB/Swiss-Prot;Acc:P34498])

HSP 1 Score: 409.838 bits (1052), Expect = 1.913e-121
Identity = 219/568 (38.56%), Postives = 337/568 (59.33%), Query Frame = -2
Query: 1114 VRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNI-VPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCC-------ASLADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDIDP-FNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLY 2787
            +R N +++IVGETGSGKTTQ+ QY+LE G  D  +IG TQPRR+AA+++A+RVA+EM  +LG +VGY IRF+  +SE T I ++TDGILL  C+ D  L  Y  II+DEAHERS++TDV  G+L+ ++ KR DL++I+TSAT+D ++F+++F    P   I G+ FP+   +      D +   +K+ V  IHL    GDIL+F+ G+EDIE  C         L +   L V P+Y  +  + Q K+F+      RK +VATNIAETS+T+DGI FVID G+ K   +N    +  L    +SQ+ ANQR GR GRT  G CYRLYT+ +F+    +       + +L ++ L L ++ +D    FH++DAP    +L    +L  LG LD   ++T +G+ +  FP++P + K+L  S++ GCS  + T+ +M+    +F   K   +   + K +F     D+ TFLN+Y  W+ +  SA WC +N + V+ ++++  +R QL  +++  DL +  +      D ++K I S +F N +R +   +Y NV       LH +S L+
Sbjct:  454 IRENNVVIIVGETGSGKTTQLAQYLLEDGFGDSGLIGCTQPRRVAAMSVARRVADEMGVDLGQDVGYAIRFEDCTSEKTIIKYMTDGILLRECLGDGSLDQYSAIIMDEAHERSLNTDVLFGLLREVIAKRADLKLIVTSATMDADKFADFFGGNCPTFTIPGRTFPVELFHARTPVEDYVDAAVKQAVT-IHLGGMDGDILIFMPGQEDIECTCEMIKEKLGELDEAPPLAVLPIYSQLPSDLQAKIFQRAPGGMRKAIVATNIAETSLTVDGILFVIDPGFCKMKVYNPRIGMDALSIFPVSQASANQRTGRAGRTGPGQCYRLYTERQFKDELLKSTVPEIQRTNLANVVLLLKSLGVDDLLKFHFMDAPPQDNMLNSMYQLWTLGALDNTGQLTPMGRKMVEFPLDPTLSKMLIMSAEMGCSDEVLTIVSMLSVPAIFFRPKGREEEADAKKEKFQVPESDHLTFLNVYIQWRTHKYSAKWCADNYLHVKALKKVREVRAQLKEIMQ--DLKLPLISNGSEWDIVRKCICSAYFHNAARLKGIGEYVNVRTGIPCFLHPTSALF 1018          
BLAST of SMED30022829 vs. Ensembl Celegans
Match: mog-1 (Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-1 [Source:UniProtKB/Swiss-Prot;Acc:P34498])

HSP 1 Score: 409.838 bits (1052), Expect = 1.913e-121
Identity = 219/568 (38.56%), Postives = 337/568 (59.33%), Query Frame = -2
Query: 1114 VRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNI-VPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCC-------ASLADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDIDP-FNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLY 2787
            +R N +++IVGETGSGKTTQ+ QY+LE G  D  +IG TQPRR+AA+++A+RVA+EM  +LG +VGY IRF+  +SE T I ++TDGILL  C+ D  L  Y  II+DEAHERS++TDV  G+L+ ++ KR DL++I+TSAT+D ++F+++F    P   I G+ FP+   +      D +   +K+ V  IHL    GDIL+F+ G+EDIE  C         L +   L V P+Y  +  + Q K+F+      RK +VATNIAETS+T+DGI FVID G+ K   +N    +  L    +SQ+ ANQR GR GRT  G CYRLYT+ +F+    +       + +L ++ L L ++ +D    FH++DAP    +L    +L  LG LD   ++T +G+ +  FP++P + K+L  S++ GCS  + T+ +M+    +F   K   +   + K +F     D+ TFLN+Y  W+ +  SA WC +N + V+ ++++  +R QL  +++  DL +  +      D ++K I S +F N +R +   +Y NV       LH +S L+
Sbjct:  454 IRENNVVIIVGETGSGKTTQLAQYLLEDGFGDSGLIGCTQPRRVAAMSVARRVADEMGVDLGQDVGYAIRFEDCTSEKTIIKYMTDGILLRECLGDGSLDQYSAIIMDEAHERSLNTDVLFGLLREVIAKRADLKLIVTSATMDADKFADFFGGNCPTFTIPGRTFPVELFHARTPVEDYVDAAVKQAVT-IHLGGMDGDILIFMPGQEDIECTCEMIKEKLGELDEAPPLAVLPIYSQLPSDLQAKIFQRAPGGMRKAIVATNIAETSLTVDGILFVIDPGFCKMKVYNPRIGMDALSIFPVSQASANQRTGRAGRTGPGQCYRLYTERQFKDELLKSTVPEIQRTNLANVVLLLKSLGVDDLLKFHFMDAPPQDNMLNSMYQLWTLGALDNTGQLTPMGRKMVEFPLDPTLSKMLIMSAEMGCSDEVLTIVSMLSVPAIFFRPKGREEEADAKKEKFQVPESDHLTFLNVYIQWRTHKYSAKWCADNYLHVKALKKVREVRAQLKEIMQ--DLKLPLISNGSEWDIVRKCICSAYFHNAARLKGIGEYVNVRTGIPCFLHPTSALF 1018          
BLAST of SMED30022829 vs. Ensembl Celegans
Match: ddx-15 (Pre-mRNA-splicing factor ATP-dependent RNA helicase ddx-15 [Source:UniProtKB/Swiss-Prot;Acc:Q20875])

HSP 1 Score: 385.571 bits (989), Expect = 4.682e-117
Identity = 217/588 (36.90%), Postives = 342/588 (58.16%), Query Frame = -2
Query: 1117 FQAVRNNPIIVIVGETGSGKTTQIPQYILE--------AGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKE-SGDILVFLTGEEDIENCCASL--------ADIKNLVVFPLYGAIDYESQQKVFKPVEKNE------RKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDL---SVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCL 2796
             + +RNN  I +VGETGSGKTTQIPQ+ +E              +++  TQPRR+AA+++A RVAEEM   LG EVGY IRF+   SE T + + TDG+LL   +  P L  Y V+I+DEAHER+++TD+ +G++K +V  R D++V+I SAT+D  +F  YF   P+L + G+ FP+   + P    D L   ++ V+ +IH+ +E  GDIL+FLTG+E+IE  C  +        AD   L   PLY  +   +QQ++F+P   N       RK V++TNIAETS+TIDG+ FVID G+ K+  +N    V  L    IS++ A QR GR GRT  G C+RLYT+  + S  ++      L+ +L  + L+L  +   D  +F ++D P+   L++  E L  L  ++   ++T+LG ++  FP++P + K+L  S++  CS  + ++ AM+   + ++   E R      K+ F+   GD+ T LN+Y+S+K N +   WC +N I+  T++    +R QL  V+ + +L   S ++   +   + I+KA+++GFF  V+  E S  Y  V   ++V+LH S+ L
Sbjct:   86 MELLRNNQCITLVGETGSGKTTQIPQWAVEFMKQQQQGQPPGQARLVACTQPRRVAAMSVATRVAEEMDVVLGQEVGYSIRFEDCISERTVLKYCTDGMLLREAMNSPLLDKYKVLILDEAHERTLATDILMGLIKEIVRNRADIKVVIMSATLDAGKFQRYFEDCPLLSVPGRTFPVEIFFTPNAEKDYLEAAIRTVI-QIHMVEEVEGDILLFLTGQEEIEEACKRIDREIQALGADAGALSCIPLYSTLPPAAQQRIFEPAPPNRPNGAISRKCVISTNIAETSLTIDGVVFVIDPGFSKQKVYNPRIRVESLLVCPISKASAMQRAGRAGRTKPGKCFRLYTETAYGSEMQDQTYPEILRSNLGSVVLQLKKLGTEDLVHFDFMDPPAPETLMRALELLNYLQAINDDGELTELGSLMAEFPLDPQLAKMLITSTELNCSNEILSITAMLSVPQCWVRPNEMRTEADEAKARFAHIDGDHLTLLNVYHSFKQNQEDPQWCYDNFINYRTMKTADTVRTQLSRVMDKYNLRRVSTDFKSRDYYLN-IRKALVAGFFMQVAHLERSGHYVTVKDNQLVNLHPSTVL 671          
BLAST of SMED30022829 vs. Ensembl Fly
Match: pea (gene:FBgn0086895 transcript:FBtr0087518)

HSP 1 Score: 451.055 bits (1159), Expect = 4.141e-135
Identity = 236/574 (41.11%), Postives = 348/574 (60.63%), Query Frame = -2
Query: 1102 QAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASL--------ADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKP 2793
            +AV +N I++++GETGSGKTTQI QY+ E G      IG TQPRR+AA+++AKRVAEE  C LG EVGY IRF+  +S  T I ++TDG+LL  C+++ +L +Y VI++DEAHER++ TDV  G+LK  V+KRP+L++I+TSAT+D  +FS YF   P+  I G+ FP+  +Y      D L   L  V+ +IHL +  GDIL+FLTG+E+I+  C  L         D+  L++ P+Y A+  E Q ++F P     RKVV+ATNIAETS+TIDGI +V+D G+VK+  +N +  +  L    ISQ+ A QR GR GRT  G  YRLYT+  +             + +L    L+L  M I D  +F ++DAP +  L+   E+L  L  LD    +T LG+ +  FP+EP + K+L  S    CS  + T+ +M+  + +F   K+ +      K++F+   GD+ T L +YNSWK N  S  WC EN + + T++    +R QL+G++ R+ L V     N  +  IQKAI SGFF+N ++ +  E Y  +   ++V++H SS L+  +P
Sbjct:  597 KAVTDNQILIVIGETGSGKTTQITQYLGECGFTARGKIGCTQPRRVAAMSVAKRVAEEYGCRLGQEVGYTIRFEDCTSPETIIKYMTDGMLLRECLMEAELKSYSVIMLDEAHERTIHTDVLFGLLKTAVQKRPELKLIVTSATLDAVKFSQYFFKAPIFTIPGRTFPVEVLYTKEPETDYLDASLITVM-QIHLREPPGDILLFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPAGSRKVVIATNIAETSLTIDGIFYVVDPGFVKQKVYNSKTGMDSLVVTPISQAAAKQRAGRAGRTGPGKTYRLYTERAYRDEMLPTPVPEIQRTNLATTVLQLKTMGINDLLHFDFMDAPPVESLVMALEQLHSLSALDDEGLLTRLGRRMAEFPLEPNLSKMLIMSVALQCSDEILTIVSMLSVQNVFYRPKDKQALADQKKAKFNQAEGDHLTLLAVYNSWKNNKFSNAWCYENFVQIRTLKRSQDVRKQLLGIMDRHKLDVVSAGKNSVR--IQKAICSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQP 1167          
BLAST of SMED30022829 vs. Ensembl Fly
Match: l(2)37Cb (gene:FBgn0086444 transcript:FBtr0081163)

HSP 1 Score: 420.624 bits (1080), Expect = 2.051e-127
Identity = 224/576 (38.89%), Postives = 352/576 (61.11%), Query Frame = -2
Query: 1102 AVRNNPIIVIVGETGSGKTTQIPQYILEAGIN-DGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASLAD--------IKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMV-LEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLS-VNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKP 2790
            AV+ + +++I GETGSGKTTQ+PQY++EAG   D KMIG TQPRR+AA+++A RVAEEM  +LG EVGY IRF+  +S+ T + ++TDG L    + +P L++Y V+I+DEAHER++ TD+  G++K +   RP+L+++I+SAT+D E+FS +F+  P+  I G+ +P+   Y      D +      V+ +IH  +  GDILVFLTG+++IE C   L D        I+ L+V P+Y  +  + Q K+F+P   N RKV++ATNIAETS+TID I +VID G+ K+++FN    +  L  V IS++ ANQR GR GRT+ G C+RLYT   ++   ++       + +L +  L L A+ I D  +F +LD P    L+   E+L  LG L+ + ++T LG+ +  FPV+P +GK+L AS KY CS  + T+ AM+ +   +F   K+      + +  F+   GD+ + L +YN W     S  WC EN I   +++    +R QL+G+++R ++  V+ LP  +    ++KA  +G+F +V+R      Y  +   + V +H +S L++  P
Sbjct:  264 AVKEHQVLIIEGETGSGKTTQVPQYLVEAGFTKDKKMIGCTQPRRVAAMSVAARVAEEMGVKLGNEVGYSIRFEDCTSDRTILKYMTDGTLHREFLSEPDLASYSVMIIDEAHERTLHTDILFGLVKDIARFRPELKLLISSATLDAEKFSAFFDDAPIFRIPGRRYPVDIFYTKAPEADYIDACCVSVL-QIHATQPLGDILVFLTGQDEIETCQEVLHDRVKRLGSKIRELIVIPVYANLPSDMQAKIFEPTPPNARKVILATNIAETSLTIDNIIYVIDPGFAKQNNFNSRTGMESLMVVPISKASANQRAGRAGRTAPGKCFRLYTAWAYKHELEDNTVPEIQRINLGNAVLMLKALGINDLIHFDFLDPPPHETLVLALEQLYALGALNHHGELTKLGRRMAEFPVDPMMGKMLLASEKYKCSEEMVTIAAMLSVNSAIFYRPKDKIIHADTARKNFNHMHGDHLSLLQVYNQWAETDYSTQWCYENFIQYRSMKRARDVREQLVGLMQRVEIDMVSCLPETVN---VRKAATAGYFYHVARLSKGGHYKTIKHNQTVMIHPNSSLFEELP 835          
BLAST of SMED30022829 vs. Ensembl Fly
Match: Dhx15 (gene:FBgn0033160 transcript:FBtr0336909)

HSP 1 Score: 401.364 bits (1030), Expect = 2.180e-122
Identity = 216/572 (37.76%), Postives = 346/572 (60.49%), Query Frame = -2
Query: 1117 IVIVGETGSGKTTQIPQYILEAGINDG-KMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKE-SGDILVFLTGEEDIENCCASL--------ADIKNLVVFPLYGAIDYESQQKVFKPVEKNE------RKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDIDPF-NFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDL---SVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCL 2769
            IV+VGETGSGKTTQIPQ+ ++  ++ G K +  TQPRR+AA+++A+RV+EEM  +LG EVGY IRF+  S+  T + ++TDG+LL   + DP L  Y VI++DEAHER+++TD+ +G+LK ++ +R DL++++ SAT+D  +F  YF+  P++ + G+  P+   Y P    D L   ++ V+ +IH+ +E  GDIL+FLTG+E+IE  C  +        ++I  L   PLY  +    QQ++F+P           RKVVV+TNIAETS+TIDG+ FVID G+ K+  +N    V  L    IS++ A QR GR GRT  G C+RLYT+  F++  ++      L+ +L  + L+L  + ID   +F ++D P+   L++  E L  L  LD    +TDLG +++ FP++P + K+L AS ++ CS  + ++ AM+   + F+   E +K     K  F+   GD+ T LN+Y+++K + +  +WC EN I+  +++    +R QL  ++ R +L   S  +   +   + I+KA++ GFF  V+  E +  Y  +   + V LH S+CL
Sbjct:   91 IVLVGETGSGKTTQIPQWCVDFAVSKGRKGVSCTQPRRVAAMSVAQRVSEEMDVKLGEEVGYSIRFEDCSTAKTLLKYMTDGMLLREAMSDPMLDQYQVILLDEAHERTLATDILMGVLKEVIRQRSDLKLVVMSATLDAGKFQQYFDNAPLMKVPGRTHPVEIFYTPEPERDYLEAAIRTVI-QIHMCEEIEGDILMFLTGQEEIEEACKRIKREIDNLGSEIGELKCIPLYSTLPPNLQQRIFEPAPPPNANGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASAQQRSGRAGRTRPGKCFRLYTEKAFKNEMQDNTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALDDDGNLTDLGAVMSEFPLDPQLAKMLIASCQHNCSNEILSITAMLSVPQCFVRPNEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQSSEDPNWCYENFINFRSLKSADNVRQQLARIMDRFNLRRTSTEFTSKDYYVN-IRKALVQGFFMQVAHLERTGYYLTIKDNQNVQLHPSTCL 660          
BLAST of SMED30022829 vs. Ensembl Fly
Match: Dhx15 (gene:FBgn0033160 transcript:FBtr0088966)

HSP 1 Score: 401.364 bits (1030), Expect = 2.180e-122
Identity = 216/572 (37.76%), Postives = 346/572 (60.49%), Query Frame = -2
Query: 1117 IVIVGETGSGKTTQIPQYILEAGINDG-KMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKE-SGDILVFLTGEEDIENCCASL--------ADIKNLVVFPLYGAIDYESQQKVFKPVEKNE------RKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDIDPF-NFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDL---SVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCL 2769
            IV+VGETGSGKTTQIPQ+ ++  ++ G K +  TQPRR+AA+++A+RV+EEM  +LG EVGY IRF+  S+  T + ++TDG+LL   + DP L  Y VI++DEAHER+++TD+ +G+LK ++ +R DL++++ SAT+D  +F  YF+  P++ + G+  P+   Y P    D L   ++ V+ +IH+ +E  GDIL+FLTG+E+IE  C  +        ++I  L   PLY  +    QQ++F+P           RKVVV+TNIAETS+TIDG+ FVID G+ K+  +N    V  L    IS++ A QR GR GRT  G C+RLYT+  F++  ++      L+ +L  + L+L  + ID   +F ++D P+   L++  E L  L  LD    +TDLG +++ FP++P + K+L AS ++ CS  + ++ AM+   + F+   E +K     K  F+   GD+ T LN+Y+++K + +  +WC EN I+  +++    +R QL  ++ R +L   S  +   +   + I+KA++ GFF  V+  E +  Y  +   + V LH S+CL
Sbjct:   91 IVLVGETGSGKTTQIPQWCVDFAVSKGRKGVSCTQPRRVAAMSVAQRVSEEMDVKLGEEVGYSIRFEDCSTAKTLLKYMTDGMLLREAMSDPMLDQYQVILLDEAHERTLATDILMGVLKEVIRQRSDLKLVVMSATLDAGKFQQYFDNAPLMKVPGRTHPVEIFYTPEPERDYLEAAIRTVI-QIHMCEEIEGDILMFLTGQEEIEEACKRIKREIDNLGSEIGELKCIPLYSTLPPNLQQRIFEPAPPPNANGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASAQQRSGRAGRTRPGKCFRLYTEKAFKNEMQDNTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALDDDGNLTDLGAVMSEFPLDPQLAKMLIASCQHNCSNEILSITAMLSVPQCFVRPNEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQSSEDPNWCYENFINFRSLKSADNVRQQLARIMDRFNLRRTSTEFTSKDYYVN-IRKALVQGFFMQVAHLERTGYYLTIKDNQNVQLHPSTCL 660          
BLAST of SMED30022829 vs. Ensembl Fly
Match: l(1)G0007 (gene:FBgn0026713 transcript:FBtr0073900)

HSP 1 Score: 406.371 bits (1043), Expect = 2.664e-119
Identity = 219/569 (38.49%), Postives = 333/569 (58.52%), Query Frame = -2
Query: 1114 VRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCC----ASLADIKN---LVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYT----KDXXXXXXXXXXXXXFLKDLCHIFLKLTAMDIDPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLY 2787
            +R N +I+IVGETGSGKTTQ+ QY+ E G +   MIG TQPRR+AA+++AKRV++EM  +LG +VGY IRF+  +SE T I ++TDGILL   + DP+L +Y  II+DEAHERS+STDV  G+L+ +V +R DL++I+TSAT+D  +F+ +F  VP   I G+ FP+  ++      D +   +K+ + ++HL    GD+L+F+ G+EDIE  C      LA+I N   L + P+Y  +  + Q K+F+      RK VVATNIAETS+T+DGI +VIDSGY K   +N    +  L+   ISQ+ ANQR GR GRT  G  YRLYT    KDE  +          L +   +   L  +D+    FH++D P    +L    +L  LG LD    +T LG+ +  FP++P   ++L  + + GCS  +  + +M+    +F   K        ++ +F     D+ T+LN+Y  W+ N  S+ WC E+ I ++ + ++  +R QL  ++ + +LSV  +   +  D ++K I S +F   +R +   +Y N+      HLH +S LY
Sbjct:  547 IRENSVIIIVGETGSGKTTQLTQYLHEDGYSKRGMIGCTQPRRVAAMSVAKRVSDEMDTQLGEDVGYAIRFEDCTSERTVIKYMTDGILLRESLRDPELDSYSAIIMDEAHERSLSTDVLFGLLREIVARRHDLKLIVTSATMDSSKFATFFGNVPTFTIPGRTFPVDVMFSKNTCEDYVESAVKQAL-QVHLTPNEGDMLIFMPGQEDIEVTCEVLEERLAEIDNAPALSILPIYSQLPSDLQAKIFQKSSDGLRKCVVATNIAETSLTVDGIIYVIDSGYCKLKVYNPRIGMDALQIYPISQANANQRSGRAGRTGPGQAYRLYTQRQYKDELLALTVPEIQRTNLANTVLLLKSLGVVDL--LQFHFMDPPPQDNILNSLYQLWILGALDHTGALTTLGRQMAEFPLDPPQCQMLIVACRMGCSAEVLIIVSMLSVPSIFYRPKGREDEADGVREKFQRPESDHLTYLNVYQQWRQNNYSSTWCNEHFIHIKAMRKVREVRQQLKDIMTQQNLSV--ISCGIDWDIVRKCICSAYFYQAARLKGIGEYVNLRTGMPCHLHPTSALY 1110          
BLAST of SMED30022829 vs. Ensembl Zebrafish
Match: AL833789.3 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:NCBI gene;Acc:606595])

HSP 1 Score: 468.003 bits (1203), Expect = 7.224e-142
Identity = 242/574 (42.16%), Postives = 348/574 (60.63%), Query Frame = -2
Query: 1102 QAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASL--------ADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKP 2793
            QAV +N I++++GETGSGKTTQI QY+ EAG      IG TQPRR+AA+++AKRV+EE  C LG EVGY IRF+  +S  T I ++TDG+LL  C+IDP L  Y +I++DEAHER++ TDV  G+LK  V+KR D+++I+TSAT+D  +FS YF   P+  I G+ +P+  +Y      D L   L  V+ +IHL +  GDILVFLTG+E+I+  C  L         D+  L++ P+Y A+  E Q ++F P     RKVV+ATNIAETS+TIDGI +V+D G+VK+  +N +  +  L    ISQ+QA QR GR GRT  G CYRLYT+  +             + +L    L L AM I D  +F ++DAP M  L+   E+L  LG LD    +T LG+ +  FP+EP + K+L  S   GCS  + T+ +M+  + +F   K+ +      K++F    GD+ T L +YNSWK N  S  WC EN I   ++     IR Q++G++ R+ L V        +  +QKAI SGFF+N ++ +  E Y  +  +++V++H SS L+  +P
Sbjct:  513 QAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLGQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRTDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEVLYTKEPETDYLDASLITVM-QIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVR--VQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQP 1083          
BLAST of SMED30022829 vs. Ensembl Zebrafish
Match: dhx8 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:ZFIN;Acc:ZDB-GENE-050809-39])

HSP 1 Score: 468.389 bits (1204), Expect = 1.678e-141
Identity = 242/574 (42.16%), Postives = 348/574 (60.63%), Query Frame = -2
Query: 1102 QAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASL--------ADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKP 2793
            QAV +N I++++GETGSGKTTQI QY+ EAG      IG TQPRR+AA+++AKRV+EE  C LG EVGY IRF+  +S  T I ++TDG+LL  C+IDP L  Y +I++DEAHER++ TDV  G+LK  V+KR D+++I+TSAT+D  +FS YF   P+  I G+ +P+  +Y      D L   L  V+ +IHL +  GDILVFLTG+E+I+  C  L         D+  L++ P+Y A+  E Q ++F P     RKVV+ATNIAETS+TIDGI +V+D G+VK+  +N +  +  L    ISQ+QA QR GR GRT  G CYRLYT+  +             + +L    L L AM I D  +F ++DAP M  L+   E+L  LG LD    +T LG+ +  FP+EP + K+L  S   GCS  + T+ +M+  + +F   K+ +      K++F    GD+ T L +YNSWK N  S  WC EN I   ++     IR Q++G++ R+ L V        +  +QKAI SGFF+N ++ +  E Y  +  +++V++H SS L+  +P
Sbjct:  566 QAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLGQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRTDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEVLYTKEPETDYLDASLITVM-QIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVR--VQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQP 1136          
BLAST of SMED30022829 vs. Ensembl Zebrafish
Match: dhx8 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:ZFIN;Acc:ZDB-GENE-050809-39])

HSP 1 Score: 453.366 bits (1165), Expect = 6.688e-136
Identity = 242/602 (40.20%), Postives = 349/602 (57.97%), Query Frame = -2
Query: 1102 QAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKE----------------------------SGDILVFLTGEEDIENCCASL--------ADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKP 2793
            QAV +N I++++GETGSGKTTQI QY+ EAG      IG TQPRR+AA+++AKRV+EE  C LG EVGY IRF+  +S  T I ++TDG+LL  C+IDP L  Y +I++DEAHER++ TDV  G+LK  V+KR D+++I+TSAT+D  +FS YF   P+  I G+ +P+  +Y      D L   L  V+ +IHL +                             +GDILVFLTG+E+I+  C  L         D+  L++ P+Y A+  E Q ++F P     RKVV+ATNIAETS+TIDGI +V+D G+VK+  +N +  +  L    ISQ+QA QR GR GRT  G CYRLYT+  +             + +L    L L AM I D  +F ++DAP M  L+   E+L  LG LD    +T LG+ +  FP+EP + K+L  S   GCS  + T+ +M+  + +F   K+ +      K++F    GD+ T L +YNSWK N  S  WC EN I   ++     IR Q++G++ R+ L V        +  +QKAI SGFF+N ++ +  E Y  +  +++V++H SS L+  +P
Sbjct:  566 QAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLGQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRTDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEVLYTKEPETDYLDASLITVM-QIHLTEPPGKLSNTILQNKIIKFEKQFQLIKIINCAGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVR--VQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQP 1164          
BLAST of SMED30022829 vs. Ensembl Zebrafish
Match: dhx16 (DEAH (Asp-Glu-Ala-His) box polypeptide 16 [Source:ZFIN;Acc:ZDB-GENE-030131-8589])

HSP 1 Score: 419.083 bits (1076), Expect = 3.845e-125
Identity = 229/576 (39.76%), Postives = 347/576 (60.24%), Query Frame = -2
Query: 1099 AVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKM-IGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASLAD--------IKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMV-LEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKPN 2790
            A+ ++ I+VI GETGSGKTTQIPQY+LE G   G M IG TQPRR+AA+++A RVA+EM  +LG EVGY IRF+  +SE T + ++TDG+LL   + +P L++Y VII+DEAHER++ TD+  G++K +   RPDL+V++ SAT+D ERFS++F+  PV  I G+ FP+   Y      D L   +  V+ +IH+ +  GD+LVFLTG+E+IE CC  L +        I  L+V P+Y  +  + Q K+F P     RKVVVATNIAETS+TIDGI +VID G+ K+  +N +  +  L     S++ ANQR GR GR ++G C+RLYT   F+   +E       + +L ++ L L ++ I D  +F ++D P    L+   E+L  LG L+   ++T LG+ +   PV+P + K++ AS +Y CS  + T+ AM+ +   +F   K+      + +  F    GD+   LN+Y  W  +G S  WC EN I   +++    +R QL G++ R  + V     N    PI+KA+ +G+F + +R  S   Y  V  ++ V++H +S L++ +P 
Sbjct:  424 AIGDHQILVIEGETGSGKTTQIPQYLLEEGYTKGGMKIGCTQPRRVAAMSVAARVAQEMSVKLGNEVGYSIRFEDCTSERTILKYMTDGMLLREFLTEPDLASYSVIIIDEAHERTLHTDILFGLIKDIARFRPDLKVLVASATLDTERFSSFFDDAPVFRIPGRRFPVDIYYTKAPEADYLEACVVSVL-QIHVTQSPGDVLVFLTGQEEIEACCELLQERCRRLGSKISELLVLPIYANLPSDMQAKIFNPTPPGARKVVVATNIAETSLTIDGIIYVIDPGFCKQKSYNAKTGMESLIVTPCSRASANQRAGRAGRVAAGKCFRLYTAWAFKHEMEETTVPEIQRTNLGNVVLLLKSLGINDLIHFDFMDPPPHETLVLALEQLYALGALNHLGELTKLGRRMAELPVDPMLSKMILASEQYKCSEEVLTIAAMLSVNNSIFYRPKDKVVHADNARMNFVVPGGDHLVLLNVYTQWVESGYSTQWCFENFIQFRSMKRARDVRDQLEGLMDR--IEVELCSSNGDSMPIRKAVTAGYFYHTARL-SKGGYKTVKHQQTVYVHPNSSLFEEQPR 995          
BLAST of SMED30022829 vs. Ensembl Zebrafish
Match: dhx16 (DEAH (Asp-Glu-Ala-His) box polypeptide 16 [Source:ZFIN;Acc:ZDB-GENE-030131-8589])

HSP 1 Score: 419.083 bits (1076), Expect = 3.845e-125
Identity = 229/576 (39.76%), Postives = 347/576 (60.24%), Query Frame = -2
Query: 1099 AVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKM-IGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASLAD--------IKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMV-LEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKPN 2790
            A+ ++ I+VI GETGSGKTTQIPQY+LE G   G M IG TQPRR+AA+++A RVA+EM  +LG EVGY IRF+  +SE T + ++TDG+LL   + +P L++Y VII+DEAHER++ TD+  G++K +   RPDL+V++ SAT+D ERFS++F+  PV  I G+ FP+   Y      D L   +  V+ +IH+ +  GD+LVFLTG+E+IE CC  L +        I  L+V P+Y  +  + Q K+F P     RKVVVATNIAETS+TIDGI +VID G+ K+  +N +  +  L     S++ ANQR GR GR ++G C+RLYT   F+   +E       + +L ++ L L ++ I D  +F ++D P    L+   E+L  LG L+   ++T LG+ +   PV+P + K++ AS +Y CS  + T+ AM+ +   +F   K+      + +  F    GD+   LN+Y  W  +G S  WC EN I   +++    +R QL G++ R  + V     N    PI+KA+ +G+F + +R  S   Y  V  ++ V++H +S L++ +P 
Sbjct:  424 AIGDHQILVIEGETGSGKTTQIPQYLLEEGYTKGGMKIGCTQPRRVAAMSVAARVAQEMSVKLGNEVGYSIRFEDCTSERTILKYMTDGMLLREFLTEPDLASYSVIIIDEAHERTLHTDILFGLIKDIARFRPDLKVLVASATLDTERFSSFFDDAPVFRIPGRRFPVDIYYTKAPEADYLEACVVSVL-QIHVTQSPGDVLVFLTGQEEIEACCELLQERCRRLGSKISELLVLPIYANLPSDMQAKIFNPTPPGARKVVVATNIAETSLTIDGIIYVIDPGFCKQKSYNAKTGMESLIVTPCSRASANQRAGRAGRVAAGKCFRLYTAWAFKHEMEETTVPEIQRTNLGNVVLLLKSLGINDLIHFDFMDPPPHETLVLALEQLYALGALNHLGELTKLGRRMAELPVDPMLSKMILASEQYKCSEEVLTIAAMLSVNNSIFYRPKDKVVHADNARMNFVVPGGDHLVLLNVYTQWVESGYSTQWCFENFIQFRSMKRARDVRDQLEGLMDR--IEVELCSSNGDSMPIRKAVTAGYFYHTARL-SKGGYKTVKHQQTVYVHPNSSLFEEQPR 995          
BLAST of SMED30022829 vs. Ensembl Xenopus
Match: rps15a (ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE-981311])

HSP 1 Score: 472.626 bits (1215), Expect = 5.686e-149
Identity = 243/575 (42.26%), Postives = 350/575 (60.87%), Query Frame = -2
Query: 1099 QAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASL--------ADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKPN 2793
            QAV +N I++++GETGSGKTTQI QY+ EAG      IG TQPRR+AA+++AKRV+EE  C LG EVGY IRF+  +S  T I ++TDG+LL  C+IDP L+ Y +I++DEAHER++ TDV  G+LK  V+KRPD+++I+TSAT+D  +FS YF   P+  I G+ +P+  +Y      D L   L  V+ +IHL +  GDILVFLTG+E+I+  C  L         D+  L++ P+Y A+  E Q ++F P     RKVV+ATNIAETS+TIDGI +V+D G+VK+  +N +  +  L    ISQ+QA QR GR GRT  G CYRLYT+  +             + +L    L L AM I D  +F ++DAP M  L+   E+L  LG LD    +T LG+ +  FP+EP + K+L  S   GCS  + T+ +M+  + +F   K+ +      K++F    GD+ T L +YNSWK N  S  WC EN I   ++     IR Q++G++ R+ L V        +  +QKAI SGFF+N ++ +  E Y  +  +++V++H SS L+  +P 
Sbjct:   52 QAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRPDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVM-QIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVR--VQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPE 623          
BLAST of SMED30022829 vs. Ensembl Xenopus
Match: rps15a (ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE-981311])

HSP 1 Score: 467.233 bits (1201), Expect = 1.623e-146
Identity = 244/577 (42.29%), Postives = 351/577 (60.83%), Query Frame = -2
Query: 1102 QAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASL--------ADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVF---SIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKP 2793
            QAV +N I++++GETGSGKTTQI QY+ EAG      IG TQPRR+AA+++AKRV+EE  C LG EVGY IRF+  +S  T I ++TDG+LL  C+IDP L+ Y +I++DEAHER++ TDV  G+LK  V+KRPD+++I+TSAT+D  +FS YF   P+  I G+ +P+  +Y      D L   L  V+ +IHL +  GDILVFLTG+E+I+  C  L         D+  L++ P+Y A+  E Q ++F P     RKVV+ATNIAETS+TIDGI +V+D G+VK+  +N +  +  L    ISQ+QA QR GR GRT  G CYRLYT+  +             + +L    L L AM I D  +F ++DAP M  L+   E+L  LG LD    +T LG+ +  FP+EP + K+L  S   GCS  + T+ +M+  + +F     +R +V      K++F    GD+ T L +YNSWK N  S  WC EN I   ++     IR Q++G++ R+ L V        +  +QKAI SGFF+N ++ +  E Y  +  +++V++H SS L+  +P
Sbjct:   52 QAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRPDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVM-QIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVF-----YRPKVRIPDQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVR--VQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQP 620          
BLAST of SMED30022829 vs. Ensembl Xenopus
Match: rps15a (ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE-981311])

HSP 1 Score: 465.307 bits (1196), Expect = 2.780e-146
Identity = 243/574 (42.33%), Postives = 348/574 (60.63%), Query Frame = -2
Query: 1102 QAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASL--------ADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKP 2793
            QAV +N I++++GETGSGKTTQI QY+ EAG      IG TQPRR+AA+++AKRV+EE  C LG EVGY IRF+  +S  T I ++TDG+LL  C+IDP L+ Y +I++DEAHER++ TDV  G+LK  V+KRPD+++I+TSAT+D  +FS YF   P+  I G+ +P+  +Y      D L   L  V+ +IHL +  GDILVFLTG+E+I+  C  L         D+  L++ P+Y A+  E Q ++F P     RKVV+ATNIAETS+TIDGI +V+D G+VK+  +N +  +  L    ISQ+QA QR GR GRT  G CYRLYT+  +             + +L    L L AM I D  +F ++DAP M  L+   E+L  LG LD    +T LG+ +  FP+EP + K+L  S   GCS  + T+ +M+  + +F   K+ +      K++F    GD+ T L +YNSWK N  S  WC EN I   ++     IR Q++  L R+ L V        +  +QKAI SGFF+N ++ +  E Y  +  +++V++H SS L+  +P
Sbjct:   52 QAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRPDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVM-QIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQILFHLCRHKLDVVSCGKATVR--VQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQP 622          
BLAST of SMED30022829 vs. Ensembl Xenopus
Match: rps15a (ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE-981311])

HSP 1 Score: 460.685 bits (1184), Expect = 2.129e-144
Identity = 241/576 (41.84%), Postives = 346/576 (60.07%), Query Frame = -2
Query: 1102 QAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASL--------ADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQL--IGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKP 2793
            QAV +N I++++GETGSGKTTQI QY+ EAG      IG TQPRR+AA+++AKRV+EE  C LG EVGY IRF+  +S  T I ++TDG+LL  C+IDP L+ Y +I++DEAHER++ TDV  G+LK  V+KRPD+++I+TSAT+D  +FS YF   P+  I G+ +P+  +Y      D L   L  V+ +IHL +  GDILVFLTG+E+I+  C  L         D+  L++ P+Y A+  E Q ++F P     RKVV+ATNIAETS+TIDGI +V+D G+VK+  +N +  +  L    ISQ+QA QR GR GRT  G CYRLYT+  +             + +L    L L AM I D  +F ++DAP M  L+   E+L  LG LD    +T LG+ +  FP+EP + K+L  S   GCS  + T+ +M+  + +F   K+ +      K++F    GD+ T L +YNSWK N  S  WC EN I   ++     IR Q+  + V+     +V           +QKAI SGFF+N ++ +  E Y  +  +++V++H SS L+  +P
Sbjct:   52 QAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRPDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVM-QIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMHKLDVVSCGKATVR----------VQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQP 616          
BLAST of SMED30022829 vs. Ensembl Xenopus
Match: rps15a (ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE-981311])

HSP 1 Score: 459.914 bits (1182), Expect = 5.636e-144
Identity = 241/576 (41.84%), Postives = 346/576 (60.07%), Query Frame = -2
Query: 1102 QAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASL--------ADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQL--IGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKP 2793
            QAV +N I++++GETGSGKTTQI QY+ EAG      IG TQPRR+AA+++AKRV+EE  C LG EVGY IRF+  +S  T I ++TDG+LL  C+IDP L+ Y +I++DEAHER++ TDV  G+LK  V+KRPD+++I+TSAT+D  +FS YF   P+  I G+ +P+  +Y      D L   L  V+ +IHL +  GDILVFLTG+E+I+  C  L         D+  L++ P+Y A+  E Q ++F P     RKVV+ATNIAETS+TIDGI +V+D G+VK+  +N +  +  L    ISQ+QA QR GR GRT  G CYRLYT+  +             + +L    L L AM I D  +F ++DAP M  L+   E+L  LG LD    +T LG+ +  FP+EP + K+L  S   GCS  + T+ +M+  + +F   K+ +      K++F    GD+ T L +YNSWK N  S  WC EN I   ++     IR Q+  + V+     +V           +QKAI SGFF+N ++ +  E Y  +  +++V++H SS L+  +P
Sbjct:   52 QAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRPDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVM-QIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMHKLDVVSCGKATVR----------VQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQP 616          
BLAST of SMED30022829 vs. Ensembl Mouse
Match: Dhx8 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:MGI Symbol;Acc:MGI:1306823])

HSP 1 Score: 469.929 bits (1208), Expect = 2.048e-142
Identity = 242/574 (42.16%), Postives = 350/574 (60.98%), Query Frame = -2
Query: 1102 QAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASL--------ADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKP 2793
            QAV +N I++++GETGSGKTTQI QY+ EAG      IG TQPRR+AA+++AKRV+EE  C LG EVGY IRF+  +S  T I ++TDG+LL  C+IDP L+ Y +I++DEAHER++ TDV  G+LK  V+KR D+++I+TSAT+D  +FS YF   P+  I G+ +P+  +Y      D L   L  V+ +IHL +  GDILVFLTG+E+I+  C  L         D+  L++ P+Y A+  E Q ++F P     RKVV+ATNIAETS+TIDGI +V+D G+VK+  +N +  +  L    ISQ+QA QR GR GRT  G CYRLYT+  +             + +L    L L AM I D  +F ++DAP M  L+   E+L  LG LD    +T LG+ +  FP+EP + K+L  S   GCS  + T+ +M+  + +F   K+ +      K++F    GD+ T L +YNSWK N  S  WC EN I   ++     IR Q++G++ R+ L V     +  +  +QKAI SGFF+N ++ +  E Y  +  +++V++H SS L+  +P
Sbjct:  547 QAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVM-QIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVR--VQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQP 1117          
BLAST of SMED30022829 vs. Ensembl Mouse
Match: Dhx8 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:MGI Symbol;Acc:MGI:1306823])

HSP 1 Score: 469.929 bits (1208), Expect = 9.585e-142
Identity = 242/574 (42.16%), Postives = 350/574 (60.98%), Query Frame = -2
Query: 1102 QAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASL--------ADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKP 2793
            QAV +N I++++GETGSGKTTQI QY+ EAG      IG TQPRR+AA+++AKRV+EE  C LG EVGY IRF+  +S  T I ++TDG+LL  C+IDP L+ Y +I++DEAHER++ TDV  G+LK  V+KR D+++I+TSAT+D  +FS YF   P+  I G+ +P+  +Y      D L   L  V+ +IHL +  GDILVFLTG+E+I+  C  L         D+  L++ P+Y A+  E Q ++F P     RKVV+ATNIAETS+TIDGI +V+D G+VK+  +N +  +  L    ISQ+QA QR GR GRT  G CYRLYT+  +             + +L    L L AM I D  +F ++DAP M  L+   E+L  LG LD    +T LG+ +  FP+EP + K+L  S   GCS  + T+ +M+  + +F   K+ +      K++F    GD+ T L +YNSWK N  S  WC EN I   ++     IR Q++G++ R+ L V     +  +  +QKAI SGFF+N ++ +  E Y  +  +++V++H SS L+  +P
Sbjct:  600 QAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVM-QIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVR--VQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQP 1170          
BLAST of SMED30022829 vs. Ensembl Mouse
Match: Dhx35 (DEAH (Asp-Glu-Ala-His) box polypeptide 35 [Source:MGI Symbol;Acc:MGI:1918965])

HSP 1 Score: 406.371 bits (1043), Expect = 2.772e-124
Identity = 229/590 (38.81%), Postives = 346/590 (58.64%), Query Frame = -2
Query: 1102 VRNNPIIVIVGETGSGKTTQIPQYILEAG-INDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEI-TKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFN----------IVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASLADI----------KNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLKDLCHIFLKLTAMDIDP-FNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITD-LGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQ----DPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKP 2787
            V N   +VIVGETG GK+TQIPQY+ EAG   +G+++G+TQPRR+AA+ +A RVA+E    LG EVGY IRFD  +  + T+I FLTDG+L+   ++DP L+ Y VI++DEAHER++ TD+ +G+LK + +KR DLR+I+ SAT+D E+F ++FN              L +EG+ FP+   Y      D +   +  VV +IH  +  GDIL FLTG+E++E   + L +           K+L V P+Y  +    Q KVF+ V  + RKV+VATN+AETSITI GI +VID G++K   +N    +  L  V +SQ+ ANQR GR GR  SG CYRLYT++ F+   +   PE+   +L  + L+L A+ ID    FH++  P    +++  E L  LG LDK  ++T+ LG  +  FP+ P   K+L  S  +GCS  + ++ AM+  + +F+     + +   +  +F+ E GD+ T LN+Y ++  + KS+ WC E+ ++ + +   + +R QL        L V +  P +      DP+ + I+SGFF N +R  SS  Y  +     +H+H +S LY  KP
Sbjct:   67 VENYQTVVIVGETGCGKSTQIPQYLAEAGWTAEGRVVGVTQPRRVAAVTVAGRVADERGAVLGHEVGYCIRFDDCTDPLATRIKFLTDGMLVREMMVDPLLTKYSVIMLDEAHERTLYTDIAIGLLKKIQKKRGDLRLIVASATLDAEKFRDFFNQNETSDPARDTSVTLTVEGRTFPVDIFYLQSPVPDYIKATVDTVV-KIHQTEGDGDILAFLTGQEEVETVVSMLIEQARALARTGMKKHLRVLPMYAGLPSFEQMKVFERVSHSVRKVIVATNVAETSITISGIVYVIDCGFMKLRAYNPRTAIECLVVVPVSQASANQRAGRGGRNRSGKCYRLYTEEAFDQLPQSTVPEMQRSNLAPVILQLKALGIDNVLRFHFMSPPPAQSMVQALELLYALGGLDKDCRLTEPLGMRIAEFPLNPMFAKMLLESGNFGCSQEVLSIAAMMQIQNVFVFPSNQKSQATRVHRKFAVEEGDHLTMLNVYEAFIKHNKSSQWCQEHFLNYKGLVRAATVRDQL------KKLLVKFQVPKVSSEGDPDPVLRCIVSGFFANAARFHSSGAYRTIRDDHELHIHPASVLYAEKP 649          
BLAST of SMED30022829 vs. Ensembl Mouse
Match: Dhx16 (DEAH (Asp-Glu-Ala-His) box polypeptide 16 [Source:MGI Symbol;Acc:MGI:1916442])

HSP 1 Score: 406.371 bits (1043), Expect = 1.198e-120
Identity = 219/576 (38.02%), Postives = 341/576 (59.20%), Query Frame = -2
Query: 1099 AVRNNPIIVIVGETGSGKTTQIPQYILEAG-INDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASLAD--------IKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMV-LEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKPN 2790
            A+ N+ +++I GETGSGKTTQIPQY+ E G    G  I  TQPRR+AA+++A RVA EM  +LG EVGY IRF+  +SE T + ++TDG+LL   + +P L++Y V++VDEAHER++ TD+  G++K +   RP+L+V++ SAT+D  RFS +F+  PV  I G+ FP+   Y      D L   +  V+ +IH+ +  GDILVFLTG+E+IE  C  L D        I+ L+V P+Y  +  + Q ++F+P     RKVVVATNIAETS+TI+GI +V+D G+ K+  +N    +  L     S++ ANQR GR GR ++G C+RLYT   ++   +E       +  L ++ L L ++ I D  +F +LD P    LL   E+L  LG L+   ++T  G+ +   PV+P + K++ AS KY CS  + T+ AM+ +   +F   K+      + +  F    GD+   LN+Y  W  +G S+ WC EN +   ++     +R QL G+L+R ++ +     +  +  ++KAI SG+F + +R   S  Y  V +++ V +H +S L++ +P 
Sbjct:  414 AIANHQVLIIEGETGSGKTTQIPQYLFEEGYTKKGMKIACTQPRRVAAMSVAARVAREMGVKLGNEVGYSIRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYSVVMVDEAHERTLHTDILFGLIKDVARFRPELKVLVASATLDTARFSAFFDDAPVFRIPGRRFPVDIFYTKAPEADYLEACVVSVL-QIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRLGSKIRELLVLPIYANLPSDMQARIFQPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFCKQKSYNPRTGMESLTVTPCSKASANQRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEIQRTSLGNVVLLLKSLGIHDLMHFDFLDPPPYETLLLALEQLYALGALNHLGELTTSGRKMAELPVDPMLSKMILASEKYSCSEEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPGGDHLVLLNVYTQWAESGYSSQWCYENFVQFRSMRRARDVREQLEGLLERVEVGLTSCQGDYVR--VRKAITSGYFYHTARLTRS-GYRTVKQQQTVFIHPNSSLFEQQPR 985          
BLAST of SMED30022829 vs. Ensembl Mouse
Match: Dhx35 (DEAH (Asp-Glu-Ala-His) box polypeptide 35 [Source:MGI Symbol;Acc:MGI:1918965])

HSP 1 Score: 394.045 bits (1011), Expect = 3.827e-120
Identity = 224/576 (38.89%), Postives = 339/576 (58.85%), Query Frame = -2
Query: 1144 VRNNPIIVIVGETGSGKTTQIPQYILEAG-INDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEI-TKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFN----------IVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASLADI----------KNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLKDLCHIFLKLTAMDIDP-FNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITD-LGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQ----DPIQKAILSGFFKNVSRHESSEKYFNVYRKKI 2787
            V N   +VIVGETG GK+TQIPQY+ EAG   +G+++G+TQPRR+AA+ +A RVA+E    LG EVGY IRFD  +  + T+I FLTDG+L+   ++DP L+ Y VI++DEAHER++ TD+ +G+LK + +KR DLR+I+ SAT+D E+F ++FN              L +EG+ FP+   Y      D +   +  VV +IH  +  GDIL FLTG+E++E   + L +           K+L V P+Y  +    Q KVF+ V  + RKV+VATN+AETSITI GI +VID G++K   +N    +  L  V +SQ+ ANQR GR GR  SG CYRLYT++ F+   +   PE+   +L  + L+L A+ ID    FH++  P    +++  E L  LG LDK  ++T+ LG  +  FP+ P   K+L  S  +GCS  + ++ AM+  + +F+     + +   +  +F+ E GD+ T LN+Y ++  + KS+ WC E+ ++ + +   + +R QL        L V +  P +      DP+ + I+SGFF N +R  SS  Y  +Y + I
Sbjct:   67 VENYQTVVIVGETGCGKSTQIPQYLAEAGWTAEGRVVGVTQPRRVAAVTVAGRVADERGAVLGHEVGYCIRFDDCTDPLATRIKFLTDGMLVREMMVDPLLTKYSVIMLDEAHERTLYTDIAIGLLKKIQKKRGDLRLIVASATLDAEKFRDFFNQNETSDPARDTSVTLTVEGRTFPVDIFYLQSPVPDYIKATVDTVV-KIHQTEGDGDILAFLTGQEEVETVVSMLIEQARALARTGMKKHLRVLPMYAGLPSFEQMKVFERVSHSVRKVIVATNVAETSITISGIVYVIDCGFMKLRAYNPRTAIECLVVVPVSQASANQRAGRGGRNRSGKCYRLYTEEAFDQLPQSTVPEMQRSNLAPVILQLKALGIDNVLRFHFMSPPPAQSMVQALELLYALGGLDKDCRLTEPLGMRIAEFPLNPMFAKMLLESGNFGCSQEVLSIAAMMQIQNVFVFPSNQKSQATRVHRKFAVEEGDHLTMLNVYEAFIKHNKSSQWCQEHFLNYKGLVRAATVRDQL------KKLLVKFQVPKVSSEGDPDPVLRCIVSGFFANAARFHSSGAYRVIYNEVI 635          
BLAST of SMED30022829 vs. UniProt/SwissProt
Match: sp|A2A4P0|DHX8_MOUSE (ATP-dependent RNA helicase DHX8 OS=Mus musculus OX=10090 GN=Dhx8 PE=2 SV=1)

HSP 1 Score: 469.929 bits (1208), Expect = 6.705e-141
Identity = 242/574 (42.16%), Postives = 350/574 (60.98%), Query Frame = -2
Query: 1102 QAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASL--------ADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKP 2793
            QAV +N I++++GETGSGKTTQI QY+ EAG      IG TQPRR+AA+++AKRV+EE  C LG EVGY IRF+  +S  T I ++TDG+LL  C+IDP L+ Y +I++DEAHER++ TDV  G+LK  V+KR D+++I+TSAT+D  +FS YF   P+  I G+ +P+  +Y      D L   L  V+ +IHL +  GDILVFLTG+E+I+  C  L         D+  L++ P+Y A+  E Q ++F P     RKVV+ATNIAETS+TIDGI +V+D G+VK+  +N +  +  L    ISQ+QA QR GR GRT  G CYRLYT+  +             + +L    L L AM I D  +F ++DAP M  L+   E+L  LG LD    +T LG+ +  FP+EP + K+L  S   GCS  + T+ +M+  + +F   K+ +      K++F    GD+ T L +YNSWK N  S  WC EN I   ++     IR Q++G++ R+ L V     +  +  +QKAI SGFF+N ++ +  E Y  +  +++V++H SS L+  +P
Sbjct:  600 QAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVM-QIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVR--VQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQP 1170          
BLAST of SMED30022829 vs. UniProt/SwissProt
Match: sp|Q14562|DHX8_HUMAN (ATP-dependent RNA helicase DHX8 OS=Homo sapiens OX=9606 GN=DHX8 PE=1 SV=1)

HSP 1 Score: 469.159 bits (1206), Expect = 6.833e-141
Identity = 242/574 (42.16%), Postives = 350/574 (60.98%), Query Frame = -2
Query: 1102 QAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASL--------ADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKP 2793
            QAV +N I++++GETGSGKTTQI QY+ EAG      IG TQPRR+AA+++AKRV+EE  C LG EVGY IRF+  +S  T I ++TDG+LL  C+IDP L+ Y +I++DEAHER++ TDV  G+LK  V+KR D+++I+TSAT+D  +FS YF   P+  I G+ +P+  +Y      D L   L  V+ +IHL +  GDILVFLTG+E+I+  C  L         D+  L++ P+Y A+  E Q ++F P     RKVV+ATNIAETS+TIDGI +V+D G+VK+  +N +  +  L    ISQ+QA QR GR GRT  G CYRLYT+  +             + +L    L L AM I D  +F ++DAP M  L+   E+L  LG LD    +T LG+ +  FP+EP + K+L  S   GCS  + T+ +M+  + +F   K+ +      K++F    GD+ T L +YNSWK N  S  WC EN I   ++     IR Q++G++ R+ L V     +  +  +QKAI SGFF+N ++ +  E Y  +  +++V++H SS L+  +P
Sbjct:  576 QAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVM-QIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVR--VQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQP 1146          
BLAST of SMED30022829 vs. UniProt/SwissProt
Match: sp|Q54F05|DHX8_DICDI (ATP-dependent RNA helicase dhx8 OS=Dictyostelium discoideum OX=44689 GN=dhx8 PE=3 SV=1)

HSP 1 Score: 462.225 bits (1188), Expect = 5.983e-139
Identity = 245/576 (42.53%), Postives = 354/576 (61.46%), Query Frame = -2
Query: 1099 FQAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASL--------ADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKPN 2796
             QAV  + ++V++GETGSGKTTQ+ QY+ EAG      IG TQPRR+AA++++KRVAEE  C+LG EVGY IRF+  +S  T I F+TDGILL  C++DP LS Y VII+DEAHER++STDV  G+LK  +++RP+L+V+ITSAT++ E+FS YF    +  I G+ FP+   Y      D L   L  V+ +IHL++  GDIL+FLTG+E+I+  C  L        +++ +L++ P+Y A+  E Q K+F+P     RKVV+ATNIAETS+TIDGI +VID G+ K+  FN ++ +  L    ISQ+ A QR GR GRT  G CYRLYT+  F++           + +L +  L + AM I D  NF ++D P +  L+   E+L  LG LD+   +T LG+ +  FP++P + K+L AS   GCS  + T+ AM+  + +F   KE +      K++F    GD+ T LN+Y SWK +  S  WC EN +   ++     +R QLI ++ R  L +     N  +  IQKAI SGFF N S+ + +E Y  +   + V++H SS L+   P+
Sbjct:  518 LQAVSEHQLLVVIGETGSGKTTQMAQYLAEAGYGTRGKIGCTQPRRVAAMSVSKRVAEEFGCQLGQEVGYAIRFEDCTSPETIIKFMTDGILLRECLLDPNLSAYSVIILDEAHERTISTDVLFGLLKQALQRRPELKVLITSATLEAEKFSKYFMNAQLFIIPGRTFPVDIRYTKDPEADYLDASLITVM-QIHLSEPPGDILLFLTGQEEIDAACQILYERMKSLGSNVPDLIILPVYSALPSEMQTKIFEPAPPGSRKVVIATNIAETSLTIDGIYYVIDPGFSKQKCFNPKNGMDSLVVAPISQAAARQRSGRAGRTGPGKCYRLYTESAFKNEMLASSIPEIQRTNLGNTVLTMKAMGINDLLNFDFMDPPPVQTLVSAMEQLYSLGALDEEGLLTRLGRKMAEFPLDPQLSKMLIASVDLGCSDEILTVVAMLSVQNVFYRPKEKQALADQKKAKFFQPEGDHLTLLNVYESWKNSKFSNPWCFENFVQARSLRRAQDVRKQLITIMDRYKLDIISAGRNYTK--IQKAICSGFFANASKKDPNEGYKTLVEGQPVYIHPSSTLFNRNPD 1090          
BLAST of SMED30022829 vs. UniProt/SwissProt
Match: sp|Q09530|MOG5_CAEEL (Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 OS=Caenorhabditis elegans OX=6239 GN=mog-5 PE=1 SV=1)

HSP 1 Score: 458.759 bits (1179), Expect = 3.282e-137
Identity = 239/575 (41.57%), Postives = 352/575 (61.22%), Query Frame = -2
Query: 1102 FQAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASL--------ADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDIDPF-NFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKP 2796
             +A+ +N I+V+VGETGSGKTTQ+ QY +EAG+     IG TQPRR+AA+++AKRVAEE  C+LG +VGY IRF+  +S+ T I ++TDG+LL  C+IDP LS Y +I++DEAHER++ TDV  G+LK    KRP+L++IITSAT+D  +FS YF   P+  I G+ FP+  +Y      D L      V+ +IHL +  GD+LVFLTG+E+I+  C  L         D+  L++ P+YGA+  E Q ++F P    +RKVV+ATNIAETS+TIDGI +V+D G+VK+  +N +  +  L    ISQ+ A QR GR GRT  G CYRLYT+  F             + +L    L+L AM I+   +F ++DAP +  ++     L  L  LD    +T LG+ +  FP+EP++ K+L  S   GCS  + T+ AM+  + +F   KE +      K++F    GD+ T L +YNSWK +  S  WC EN I V +++    IR QL+G++ R+ L +     ++ +  +QKAI SGFF+N ++ +  E Y  +   + V++H SS  ++ +P
Sbjct:  550 MEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVM-QIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRDVSR--VQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQP 1121          
BLAST of SMED30022829 vs. UniProt/SwissProt
Match: sp|O42643|PRP22_SCHPO (Pre-mRNA-splicing factor ATP-dependent RNA helicase prp22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prp22 PE=1 SV=1)

HSP 1 Score: 454.521 bits (1168), Expect = 4.872e-136
Identity = 245/577 (42.46%), Postives = 356/577 (61.70%), Query Frame = -2
Query: 1114 FQAVRNNPIIVIVGETGSGKTTQIPQYILEAG-INDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASLAD--------IKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDX-XXXXXXXXXXXXFLKDLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLC----QDPIQKAILSGFFKNVSRHESSEK-YFNVYRKKIVHLHTSSCLY 2796
             +AV  N I+V++GETGSGKTTQI QY+ E G  +D KMIG TQPRR+AA+++AKRVAEE+ C +G EVGY IRF+ ++S +T+I ++TDG+L   C++DP LS Y VII+DEAHER+V+TDV  G+LK  V KRPDL++I+TSAT+D ERFS+YF   P+  I G+ +P+  +Y      D L   L  V+ +IHL++  GDILVFLTG+E+I+  C  L +        I  LV+ P+Y A+  E Q ++F+P     RKVV+ATNIAETS+TIDGI +V+D G+VK+S F+ +  +  L    ISQ+QA QR GR GRT  G CYRLYT+            PEI  ++L H  L L AM I D  NF ++D P    ++   + L  L  LD    +T LG+ +  FP+EP + KVL  S + GCS  + ++ AM+    ++   +E ++     +++F++   D+ T LN+Y +WK+N  S +WC E+ I    +     +R QLI ++ R      Y  P +     ++ I +A+ SG+F NV++ +S E  Y  +     V++H S  L+
Sbjct:  520 LEAVSKNQILVLLGETGSGKTTQITQYLAEEGYTSDSKMIGCTQPRRVAAMSVAKRVAEEVGCRVGEEVGYTIRFEDKTSRMTQIKYMTDGMLQRECLVDPLLSKYSVIILDEAHERTVATDVLFGLLKGTVLKRPDLKLIVTSATLDAERFSSYFYKCPIFTIPGRSYPVEIMYTKQPEADYLDAALMTVM-QIHLSEGPGDILVFLTGQEEIDTSCEILYERSKMLGDSIPELVILPVYSALPSEIQSRIFEPAPPGGRKVVIATNIAETSLTIDGIYYVVDPGFVKQSCFDPKLGMDSLIVTPISQAQARQRSGRAGRTGPGKCYRLYTESAYRNEMLPSPIPEIQRQNLSHTILMLKAMGINDLLNFDFMDPPPAQTMIAALQNLYALSALDDEGLLTPLGRKMADFPMEPQLSKVLITSVELGCSEEMLSIIAMLSVPNIWSRPREKQQEADRQRAQFANPESDHLTLLNVYTTWKMNRCSDNWCYEHYIQARGMRRAEDVRKQLIRLMDR------YRHPVVSCGRKRELILRALCSGYFTNVAKRDSHEGCYKTIVENAPVYMHPSGVLF 1089          
BLAST of SMED30022829 vs. TrEMBL
Match: D5JG69 (DEAH box polypeptide 8-like protein B (Fragment) OS=Dugesia japonica OX=6161 GN=DHX-8B PE=2 SV=1)

HSP 1 Score: 603.979 bits (1556), Expect = 0.000e+0
Identity = 300/453 (66.23%), Postives = 376/453 (83.00%), Query Frame = -2
Query: 1096 RSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLN-KESGDILVFLTGEEDIENCCASLADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLKDLCHIFLKLTAMDIDPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKPNL 2451
            R+V +D+ LG+LK LVE R DLRVIITSATI+ E FS YFN +PVL IEGK+FP+ +IY PIDSID L   +K +V +IH N +E+G ILVFLTGEEDIENCC +L+ I  LVV PLY +IDYESQ KVF+PV  NERKV++ATNIAETSITIDGIKFVIDSG+VK+S+FN E+NV +L+TV+ISQSQANQRKGR GRT+SG CYRLY++D+++SFE EIEPEI+ KDLC +FLKLT+M++DPF F Y+D+P + VLLKCAEELRDLGC+++ NKIT++GKIVN FPVEPAIGKVLY SSKYGCS+N+  MFAMVLEK LF++ K  +KR++ +KS+FSD  GDY  + NI+N W  NGKS DWC +NCI VE+I+E+S IR QLIG+++  +LSV    P  CQ+ +QK+ILSGF+KNV RHE+S+KYFN+ RKK+++LH SSCL KSKP+L
Sbjct:    1 RTVFSDIILGVLKQLVETRQDLRVIITSATINHESFSEYFNHIPVLRIEGKMFPVKDIYMPIDSIDSLIDQIKSIVIKIHCNDQENGHILVFLTGEEDIENCCEALSTIPKLVVMPLYASIDYESQNKVFEPVRTNERKVIIATNIAETSITIDGIKFVIDSGFVKQSYFNYEENVDILQTVKISQSQANQRKGRAGRTNSGCCYRLYSEDDYKSFESEIEPEIYRKDLCQVFLKLTSMELDPFKFQYMDSPHVNVLLKCAEELRDLGCINENNKITEIGKIVNHFPVEPAIGKVLYTSSKYGCSINVINMFAMVLEKNLFLTDKASKKRIYKLKSKFSDLYGDYSMYSNIFNHWMNNGKSMDWCDDNCIKVESIDEMSLIRDQLIGIMQWMNLSVEEQIPESCQNSVQKSILSGFYKNVCRHENSDKYFNIKRKKLIYLHPSSCLIKSKPDL 453          
BLAST of SMED30022829 vs. TrEMBL
Match: A0A4W4FHJ1 (Uncharacterized protein OS=Electrophorus electricus OX=8005 GN=dhx8 PE=4 SV=1)

HSP 1 Score: 473.781 bits (1218), Expect = 5.573e-146
Identity = 244/574 (42.51%), Postives = 350/574 (60.98%), Query Frame = -2
Query: 1102 QAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASL--------ADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKP 2793
            QAV +N I++++GETGSGKTTQI QY+ EAG      IG TQPRR+AA+++AKRV+EE  C LG EVGY IRF+  +S  T I ++TDG+LL  C+IDP LS Y +I++DEAHER++ TDV  G+LK  V+KRPD+++I+TSAT+D  +FS YF   P+  I G+ +P+  +Y      D L   L  V+ +IHL +  GDILVFLTG+E+I+  C  L         D+  L++ P+Y A+  E Q ++F P     RKVV+ATNIAETS+TIDGI +V+D G+VK+  +N +  +  L    ISQ+QA QR GR GRT  G CYRLYT+  +             + +L    L L AM I D  +F ++DAP M  L+   E+L  LG LD    +T LG+ +  FP+EP + K+L  S   GCS  + T+ +M+  + +F   K+ +      K++F    GD+ T L +YNSWK N  S  WC EN I   ++     IR Q++G++ R+ L V        +  +QKAI SGFF+N ++ +  E Y  +  +++V++H SS L+  +P
Sbjct:   52 QAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLSQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRPDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEVLYTKEPETDYLDASLITVM-QIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVR--VQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQP 622          
BLAST of SMED30022829 vs. TrEMBL
Match: A0A4W4FHZ8 (Uncharacterized protein OS=Electrophorus electricus OX=8005 GN=dhx8 PE=4 SV=1)

HSP 1 Score: 473.396 bits (1217), Expect = 5.899e-146
Identity = 244/575 (42.43%), Postives = 350/575 (60.87%), Query Frame = -2
Query: 1099 QAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASL--------ADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKPN 2793
            QAV +N I++++GETGSGKTTQI QY+ EAG      IG TQPRR+AA+++AKRV+EE  C LG EVGY IRF+  +S  T I ++TDG+LL  C+IDP LS Y +I++DEAHER++ TDV  G+LK  V+KRPD+++I+TSAT+D  +FS YF   P+  I G+ +P+  +Y      D L   L  V+ +IHL +  GDILVFLTG+E+I+  C  L         D+  L++ P+Y A+  E Q ++F P     RKVV+ATNIAETS+TIDGI +V+D G+VK+  +N +  +  L    ISQ+QA QR GR GRT  G CYRLYT+  +             + +L    L L AM I D  +F ++DAP M  L+   E+L  LG LD    +T LG+ +  FP+EP + K+L  S   GCS  + T+ +M+  + +F   K+ +      K++F    GD+ T L +YNSWK N  S  WC EN I   ++     IR Q++G++ R+ L V        +  +QKAI SGFF+N ++ +  E Y  +  +++V++H SS L+  +P 
Sbjct:   52 QAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLSQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRPDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEVLYTKEPETDYLDASLITVM-QIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVR--VQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPE 623          
BLAST of SMED30022829 vs. TrEMBL
Match: F6XRY4 (Ribosomal protein S15a OS=Xenopus tropicalis OX=8364 GN=dnaaf4 PE=4 SV=1)

HSP 1 Score: 472.626 bits (1215), Expect = 8.928e-146
Identity = 243/575 (42.26%), Postives = 350/575 (60.87%), Query Frame = -2
Query: 1099 QAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASL--------ADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKPN 2793
            QAV +N I++++GETGSGKTTQI QY+ EAG      IG TQPRR+AA+++AKRV+EE  C LG EVGY IRF+  +S  T I ++TDG+LL  C+IDP L+ Y +I++DEAHER++ TDV  G+LK  V+KRPD+++I+TSAT+D  +FS YF   P+  I G+ +P+  +Y      D L   L  V+ +IHL +  GDILVFLTG+E+I+  C  L         D+  L++ P+Y A+  E Q ++F P     RKVV+ATNIAETS+TIDGI +V+D G+VK+  +N +  +  L    ISQ+QA QR GR GRT  G CYRLYT+  +             + +L    L L AM I D  +F ++DAP M  L+   E+L  LG LD    +T LG+ +  FP+EP + K+L  S   GCS  + T+ +M+  + +F   K+ +      K++F    GD+ T L +YNSWK N  S  WC EN I   ++     IR Q++G++ R+ L V        +  +QKAI SGFF+N ++ +  E Y  +  +++V++H SS L+  +P 
Sbjct:   52 QAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRPDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVM-QIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVR--VQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPE 623          
BLAST of SMED30022829 vs. TrEMBL
Match: A0A091E849 (ATP-dependent RNA helicase DHX8 (Fragment) OS=Corvus brachyrhynchos OX=85066 GN=N302_08224 PE=4 SV=1)

HSP 1 Score: 469.544 bits (1207), Expect = 3.344e-145
Identity = 242/575 (42.09%), Postives = 349/575 (60.70%), Query Frame = -2
Query: 1099 QAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASL--------ADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKPN 2793
            QAV +N I++++GETGSGKTTQI QY+ EAG      IG TQPRR+AA+++AKRV+EE  C LG EVGY IRF+  +S  T I ++TDG+LL  C+IDP L+ Y +I++DEAHER++ TDV  G+LK  V+KR D+++I+TSAT+D  +FS YF   P+  I G+ +P+  +Y      D L   L  V+ +IHL +  GDILVFLTG+E+I+  C  L         D+  L++ P+Y A+  E Q ++F P     RKVV+ATNIAETS+TIDGI +V+D G+VK+  +N +  +  L    ISQ+QA QR GR GRT  G CYRLYT+  +             + +L    L L AM I D  +F ++DAP M  L+   E+L  LG LD    +T LG+ +  FP+EP + K+L  S   GCS  + T+ +M+  + +F   K+ +      K++F    GD+ T L +YNSWK N  S  WC EN I   ++     IR Q++G++ R+ L V        +  +QKAI SGFF+N ++ +  E Y  +  +++V++H SS L+  +P 
Sbjct:   27 QAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVM-QIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVR--VQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPE 598          
BLAST of SMED30022829 vs. Ensembl Cavefish
Match: dhx8 (DEAH-box helicase 8 [Source:NCBI gene;Acc:103035799])

HSP 1 Score: 467.618 bits (1202), Expect = 2.070e-141
Identity = 242/574 (42.16%), Postives = 348/574 (60.63%), Query Frame = -2
Query: 1102 QAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASL--------ADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKP 2793
            QAV +N I++++GETGSGKTTQI QY+ EAG      IG TQPRR+AA+++AKRV+EE  C LG EVGY IRF+  +S  T I ++TDG+LL  C+IDP L  Y +I++DEAHER++ TDV  G+LK  V+KR D+++I+TSAT+D  +FS YF   P+  I G+ +P+  +Y      D L   L  V+ +IHL +  GDILVFLTG+E+I+  C  L         D+  L++ P+Y A+  E Q ++F P     RKVV+ATNIAETS+TIDGI +V+D G+VK+  +N +  +  L    ISQ+QA QR GR GRT  G CYRLYT+  +             + +L    L L AM I D  +F ++DAP M  L+   E+L  LG LD    +T LG+ +  FP+EP + K+L  S   GCS  + T+ +M+  + +F   K+ +      K++F    GD+ T L +YNSWK N  S  WC EN I   ++     IR Q++G++ R+ L V        +  +QKAI SGFF+N ++ +  E Y  +  +++V++H SS L+  +P
Sbjct:  557 QAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLGQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRTDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEVLYTKEPETDYLDASLITVM-QIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVFSCGKATVR--VQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQP 1127          
BLAST of SMED30022829 vs. Ensembl Cavefish
Match: dhx8 (DEAH-box helicase 8 [Source:NCBI gene;Acc:103035799])

HSP 1 Score: 466.848 bits (1200), Expect = 8.836e-141
Identity = 242/574 (42.16%), Postives = 348/574 (60.63%), Query Frame = -2
Query: 1102 QAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASL--------ADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKP 2793
            QAV +N I++++GETGSGKTTQI QY+ EAG      IG TQPRR+AA+++AKRV+EE  C LG EVGY IRF+  +S  T I ++TDG+LL  C+IDP L  Y +I++DEAHER++ TDV  G+LK  V+KR D+++I+TSAT+D  +FS YF   P+  I G+ +P+  +Y      D L   L  V+ +IHL +  GDILVFLTG+E+I+  C  L         D+  L++ P+Y A+  E Q ++F P     RKVV+ATNIAETS+TIDGI +V+D G+VK+  +N +  +  L    ISQ+QA QR GR GRT  G CYRLYT+  +             + +L    L L AM I D  +F ++DAP M  L+   E+L  LG LD    +T LG+ +  FP+EP + K+L  S   GCS  + T+ +M+  + +F   K+ +      K++F    GD+ T L +YNSWK N  S  WC EN I   ++     IR Q++G++ R+ L V        +  +QKAI SGFF+N ++ +  E Y  +  +++V++H SS L+  +P
Sbjct:  596 QAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLGQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRTDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEVLYTKEPETDYLDASLITVM-QIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVFSCGKATVR--VQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQP 1166          
BLAST of SMED30022829 vs. Ensembl Cavefish
Match: dhx16 (DEAH-box helicase 16 [Source:NCBI gene;Acc:103040087])

HSP 1 Score: 419.853 bits (1078), Expect = 8.771e-126
Identity = 228/576 (39.58%), Postives = 349/576 (60.59%), Query Frame = -2
Query: 1099 AVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKM-IGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASLAD--------IKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMV-LEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKPN 2790
            A+R++ I+VI GETGSGKTTQIPQY++E G   G M IG TQPRR+AA++++ RVA+E+  +LG EVGY IRF+  +SE T + ++TDG+LL   + +P L++Y VII+DEAHER++ TD+  G++K +   RPDL+V++ SAT+D ERFS +F+  PV  I G+ FP+   Y      D L   +  V+ +IH+ +  GDILVFLTG+E+IE+CC +L +        I  L+V P+Y  +  + Q K+F P     RKVVVATNIAETS+TIDGI +VID G+ K+  +N    +  L     S++ ANQR GR GR ++G C+RLYT   F+   +E       + +L ++ L L ++ I D  +F ++D P    L+   E+L  LG L+   ++T LG+ +   PV+P + K++ AS +Y CS  + T+ AM+ +   +F   K+      + +  F    GD+   LN+Y  W  +G S  WC EN I   +++    +R QL G+++R  + V     N    PI+K+I +G+F + +R  S   Y  V  ++ V++H +S L++ +P 
Sbjct:  423 AIRDHQILVIEGETGSGKTTQIPQYLMEDGYTKGGMKIGCTQPRRVAAMSVSARVAQEVGVKLGNEVGYSIRFEDCTSERTVLKYMTDGMLLREFLTEPDLASYSVIIIDEAHERTLHTDILFGLIKDIARFRPDLKVLVASATLDTERFSCFFDDAPVFRIPGRRFPVDIFYTKAPEADYLDACVVSVL-QIHVTQPPGDILVFLTGQEEIESCCENLQERCRRLGSKISELLVLPIYANLPSDMQAKIFNPTPPGARKVVVATNIAETSLTIDGIIYVIDPGFCKQKSYNARTGMESLIVTPCSRASANQRAGRAGRVAAGKCFRLYTAWAFKHEMEETTVPEIQRTNLGNVVLLLKSLGINDLIHFDFMDPPPHETLVLALEQLYALGALNHLGELTKLGRRMAELPVDPMLSKMILASEQYKCSEEVLTIAAMLSVNNSIFYRPKDKVVHADNARMNFIVPGGDHLVLLNVYTQWVESGFSTQWCFENFIQFRSMKRARDVREQLEGLMER--IEVEVCSANGDSTPIRKSITAGYFYHTARL-SKGGYKTVKHQQTVYVHPNSSLFEEQPR 994          
BLAST of SMED30022829 vs. Ensembl Cavefish
Match: dhx16 (DEAH-box helicase 16 [Source:NCBI gene;Acc:103040087])

HSP 1 Score: 419.468 bits (1077), Expect = 1.115e-125
Identity = 228/576 (39.58%), Postives = 349/576 (60.59%), Query Frame = -2
Query: 1099 AVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKM-IGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASLAD--------IKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMV-LEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKPN 2790
            A+R++ I+VI GETGSGKTTQIPQY++E G   G M IG TQPRR+AA++++ RVA+E+  +LG EVGY IRF+  +SE T + ++TDG+LL   + +P L++Y VII+DEAHER++ TD+  G++K +   RPDL+V++ SAT+D ERFS +F+  PV  I G+ FP+   Y      D L   +  V+ +IH+ +  GDILVFLTG+E+IE+CC +L +        I  L+V P+Y  +  + Q K+F P     RKVVVATNIAETS+TIDGI +VID G+ K+  +N    +  L     S++ ANQR GR GR ++G C+RLYT   F+   +E       + +L ++ L L ++ I D  +F ++D P    L+   E+L  LG L+   ++T LG+ +   PV+P + K++ AS +Y CS  + T+ AM+ +   +F   K+      + +  F    GD+   LN+Y  W  +G S  WC EN I   +++    +R QL G+++R  + V     N    PI+K+I +G+F + +R  S   Y  V  ++ V++H +S L++ +P 
Sbjct:  390 AIRDHQILVIEGETGSGKTTQIPQYLMEDGYTKGGMKIGCTQPRRVAAMSVSARVAQEVGVKLGNEVGYSIRFEDCTSERTVLKYMTDGMLLREFLTEPDLASYSVIIIDEAHERTLHTDILFGLIKDIARFRPDLKVLVASATLDTERFSCFFDDAPVFRIPGRRFPVDIFYTKAPEADYLDACVVSVL-QIHVTQPPGDILVFLTGQEEIESCCENLQERCRRLGSKISELLVLPIYANLPSDMQAKIFNPTPPGARKVVVATNIAETSLTIDGIIYVIDPGFCKQKSYNARTGMESLIVTPCSRASANQRAGRAGRVAAGKCFRLYTAWAFKHEMEETTVPEIQRTNLGNVVLLLKSLGINDLIHFDFMDPPPHETLVLALEQLYALGALNHLGELTKLGRRMAELPVDPMLSKMILASEQYKCSEEVLTIAAMLSVNNSIFYRPKDKVVHADNARMNFIVPGGDHLVLLNVYTQWVESGFSTQWCFENFIQFRSMKRARDVREQLEGLMER--IEVEVCSANGDSTPIRKSITAGYFYHTARL-SKGGYKTVKHQQTVYVHPNSSLFEEQPR 961          
BLAST of SMED30022829 vs. Ensembl Cavefish
Match: dhx16 (DEAH-box helicase 16 [Source:NCBI gene;Acc:103040087])

HSP 1 Score: 419.083 bits (1076), Expect = 3.126e-125
Identity = 228/576 (39.58%), Postives = 349/576 (60.59%), Query Frame = -2
Query: 1099 AVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKM-IGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASLAD--------IKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMV-LEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKPN 2790
            A+R++ I+VI GETGSGKTTQIPQY++E G   G M IG TQPRR+AA++++ RVA+E+  +LG EVGY IRF+  +SE T + ++TDG+LL   + +P L++Y VII+DEAHER++ TD+  G++K +   RPDL+V++ SAT+D ERFS +F+  PV  I G+ FP+   Y      D L   +  V+ +IH+ +  GDILVFLTG+E+IE+CC +L +        I  L+V P+Y  +  + Q K+F P     RKVVVATNIAETS+TIDGI +VID G+ K+  +N    +  L     S++ ANQR GR GR ++G C+RLYT   F+   +E       + +L ++ L L ++ I D  +F ++D P    L+   E+L  LG L+   ++T LG+ +   PV+P + K++ AS +Y CS  + T+ AM+ +   +F   K+      + +  F    GD+   LN+Y  W  +G S  WC EN I   +++    +R QL G+++R  + V     N    PI+K+I +G+F + +R  S   Y  V  ++ V++H +S L++ +P 
Sbjct:  423 AIRDHQILVIEGETGSGKTTQIPQYLMEDGYTKGGMKIGCTQPRRVAAMSVSARVAQEVGVKLGNEVGYSIRFEDCTSERTVLKYMTDGMLLREFLTEPDLASYSVIIIDEAHERTLHTDILFGLIKDIARFRPDLKVLVASATLDTERFSCFFDDAPVFRIPGRRFPVDIFYTKAPEADYLDACVVSVL-QIHVTQPPGDILVFLTGQEEIESCCENLQERCRRLGSKISELLVLPIYANLPSDMQAKIFNPTPPGARKVVVATNIAETSLTIDGIIYVIDPGFCKQKSYNARTGMESLIVTPCSRASANQRAGRAGRVAAGKCFRLYTAWAFKHEMEETTVPEIQRTNLGNVVLLLKSLGINDLIHFDFMDPPPHETLVLALEQLYALGALNHLGELTKLGRRMAELPVDPMLSKMILASEQYKCSEEVLTIAAMLSVNNSIFYRPKDKVVHADNARMNFIVPGGDHLVLLNVYTQWVESGFSTQWCFENFIQFRSMKRARDVREQLEGLMER--IEVEVCSANGDSTPIRKSITAGYFYHTARL-SKGGYKTVKHQQTVYVHPNSSLFEEQPR 994          
BLAST of SMED30022829 vs. Ensembl Sea Lamprey
Match: dhx8 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:ZFIN;Acc:ZDB-GENE-050809-39])

HSP 1 Score: 462.225 bits (1188), Expect = 5.102e-145
Identity = 236/574 (41.11%), Postives = 350/574 (60.98%), Query Frame = -2
Query: 1102 QAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASL--------ADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKP 2793
            QAV +N I++++GETGSGKTTQI QY+ EAG      IG TQPRR+AA+++AKRV+EE  C LG EVGY IRF+  +S  TKI ++TDG+LL  C+ID +L  Y V+++DEAHER++ TDV  G+LK  +++R D+++I+TSAT+D  +FS YF   P+  I G+ +P+  +Y      D L   L  V+ +IHL +  GDIL+FLTG+E+I+  C  L         ++  L++ P+Y A+  E Q ++F P     RKVV+ATNIAETS+TIDGI +V+D G+VK+  +N +  +  L    ISQ+QA QR GR GRT  G  YRLYT+  +             + +L    L L AM I D  +F ++DAP M  L+   E+L  LG LD    +T LG+ +  FP+EP + K+L  S   GCS  + T+ +M+  + +F   K+ +      K++F+   GD+ T L +YNSWK N  S  WC EN +   T+     +R Q++G++ R+ L V        +  +QKA+LSGFF+N ++ +  E Y  +  +++V++H SS L+  +P
Sbjct:  113 QAVNDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETKIKYMTDGMLLRECLIDSELMQYSVVMLDEAHERTIHTDVLFGLLKKTIKRRLDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVM-QIHLTEPPGDILLFLTGQEEIDTACEILYERMKSLGPEVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKTYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYQLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFNQAEGDHLTLLAVYNSWKNNKFSNAWCYENFVQARTLRRAQDVRKQMLGIMDRHKLDVVSCAKATVR--VQKAVLSGFFRNAAKKDPQEGYRTLVDQQVVYIHPSSALFNRQP 683          
BLAST of SMED30022829 vs. Ensembl Sea Lamprey
Match: dhx34 (DEAH (Asp-Glu-Ala-His) box polypeptide 34 [Source:ZFIN;Acc:ZDB-GENE-061207-30])

HSP 1 Score: 290.812 bits (743), Expect = 2.380e-81
Identity = 178/520 (34.23%), Postives = 298/520 (57.31%), Query Frame = -2
Query: 1288 VRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPI---------DSIDCLTGV-LKEVVNEIHLNKESGDILVFLTGEEDI----ENCCASLADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLKDLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSW---KINGK--SADWCLENCIDVETIEEISRIRHQLIGVL 2787
            VR + ++V+ G+TG GK+TQ+PQY+L AG++    +  TQPRRIA +++AKRV+ E   E G+++GY+IRF+   +  TK+ FLT+G+LL     +  +S Y V+I+DE HER +  D+ LG+L+ L+  R DLR+++ SATI+ + FS Y    PVL + G+++PI  IY+P+         + ID    + + + ++  +   E GD+LVFL+G  DI    E   +   + K  +V  L+  +  E Q KVF    +  RK +V+TNIAETS+TIDG++F++DSG VK+  ++ +  +  L+   IS++ A QRKGR GRT  G C+RLY + E+++ E    PE+    L  + L++ +M + DP  F +L+ P    L    + L++ G LD+  ++T +G+++ + P++   GK+L      G    + T+ A +  +  F  +          +     + GD  T LN++N W   K  G+  S  WC  + ++ + + EI+ ++ Q   +L
Sbjct:  118 VRAHQVVVVAGDTGCGKSTQVPQYLLSAGMS---RVACTQPRRIACMSLAKRVSYESLGEHGSQIGYQIRFETSKTAATKVLFLTEGLLLRQMQTEGFMSRYDVLILDEVHERHLHCDLLLGVLRELLPLRDDLRLVLMSATINIQLFSRYLGDAPVLQVPGRLYPIQVIYRPVPEEEKTGKSERIDPRPYLRIMQSIDHKYPADERGDLLVFLSGMADIARVAEAAQSYAVETKRWIVLQLHSTLSAEQQDKVFDLAPEGVRKCIVSTNIAETSVTIDGVRFIVDSGKVKEMSYDPKAKMQRLQEFWISRASAEQRKGRAGRTGPGVCFRLYAESEYDALEPYAVPEVQRVPLDSVVLQMKSMGLGDPRLFGFLEPPPASSLETSMQFLQEQGALDEQEELTPIGRVLATLPLDVLTGKMLLVGCVLGAVEPVLTIAAAMSVQSPFHRNAHTNPDCSRARRSLESDHGDPLTLLNVFNEWVQVKSGGQVPSRKWCKRHGLEEQRLYEIANLQRQFKELL 634          
BLAST of SMED30022829 vs. Ensembl Sea Lamprey
Match: zgc:158828 (DEAH-box helicase 35 [Source:HGNC Symbol;Acc:HGNC:15861])

HSP 1 Score: 261.151 bits (666), Expect = 4.047e-74
Identity = 181/533 (33.96%), Postives = 280/533 (52.53%), Query Frame = -2
Query: 1264 IVIVGETGSGKTTQIPQYILEAG-INDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQS-SEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVP-----VLWIEGK---------VFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASLAD-------------IKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLKDLCHIFLKLTAMDIDP-FNFHYLDAPSMPVLLKCAEELRDL-GCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVN 2769
            +VIVGETG GK+TQIPQY+ EAG   +G ++ ITQPRR+AA  +A RVAEE    LG EVGY IRFD  S  + T+I FLTDG+L+   + DP L  Y  +++      +          + LVE        +TS+TI    FS  F         +LW  G+         ++P+ +  K             E + +IH +   GDIL FLTG+E++EN  +++ +              +++   P+Y  + Y  Q KVF+ V +N RKVVVATN+AETS+T+ GI FV+D G+VK   ++    V  L     S++ A QR GR GR+  G CYRLY + EF    +  EPE+   D+  + L+L A+ ID    F +L  P    +++  E L  L G     +  + LG  +  FP+ P   K+L  S  +GCS  + T+ AM+  + +F+S    + +    + +F+ E GD+ T LN++ ++  + KS+ WC ++ ++ + +     ++ QL  +L+R  +  N
Sbjct:   71 VVIVGETGCGKSTQIPQYLAEAGWTAEGHVVAITQPRRVAATTVAARVAEERGALLGHEVGYCIRFDDCSDPQATRIKFLTDGMLVREMMADPLLKKYSPLLLRFGDTTAPYPTACSSFNRSLVE--------VTSSTIPSS-FSRAFECQCCLADYILWRVGQCTNARSYILMYPVPDYVK----------TTVETIMKIHNDAADGDILAFLTGQEEVENVVSAVVEEVRAAAARSKGSLHRHVRALPMYAGLPYVDQMKVFERVGRNCRKVVVATNVAETSVTVPGIAFVVDCGFVKLRTYDPRRAVDALLVTPASRASAQQRAGRAGRSRPGKCYRLYPESEFAKLPEATEPEMRRSDMAPVILQLKALGIDNVLRFSFLSPPPAESMVQAVELLYALGGAWRDASSSSPLGVRMAEFPMGPMYAKMLLESGTFGCSKEIITIAAMMQIQNVFLSPPNQKIKAARQQRKFAVEEGDHMTMLNVFEAFVKHNKSSAWCQQHFLNYKGLVRAGALQDQLRKLLRRFHIPSN 584          
BLAST of SMED30022829 vs. Ensembl Sea Lamprey
Match: dhx33 (DEAH (Asp-Glu-Ala-His) box polypeptide 33 [Source:NCBI gene;Acc:796505])

HSP 1 Score: 221.861 bits (564), Expect = 2.643e-63
Identity = 141/374 (37.70%), Postives = 201/374 (53.74%), Query Frame = -2
Query: 1696 IVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPD-----LRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIE---NCCASLA-----DIKNLVVFPLYGAIDYESQQKVF-KPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPS 2769
            IVI G T  G TTQ+  +  E     G  +   QP    A+ +  R            VGY +RF+   S  T++ F+TDG+LL   + DP L     +++DEAHERS+ TD   G++K    +R +     L+VI+ SAT+D +RF +YFN  PVL++EG+  PI   Y      D L   L  +       +    IL FLTG+E+IE     C  L+      +  + V PLY A+ +  QQ+VF +   K  RKV++ATNIAETSITI G++ VID G VK   F+    + VL   ++SQ+QA QR GR+GR   G C RLYT+  F+S  +   PE+  + +L  + L L A+ I D  +F ++D PS
Sbjct:   61 IVIFGITAQGSTTQVKSWTGEQDCPPGGEVAYMQPSHTTAVCVPSRRDFYRQNRGRDVVGYTVRFEDVRSASTRVRFVTDGMLLREALGDPLLLATSAVVLDEAHERSLHTDTLFGVVKGAQRQRWEQKLRPLKVIVMSATMDVDRFVSYFNGAPVLYVEGRQHPIQIFYTREPHSDFLHATLITIFQTHQEQEAEHHILAFLTGQEEIEAMGRACRDLSRQLPPSVPRMCVVPLYAALPHAQQQRVFARAPPKGTRKVILATNIAETSITIPGVRTVIDCGLVKAKMFSPGTGMEVLALQKVSQAQAWQRAGRSGREGPGCCLRLYTEMHFQSLAENTTPELQSRCNLTSVLLHLLALGISDVASFDFMDKPS 434          
BLAST of SMED30022829 vs. Ensembl Sea Lamprey
Match: dqx1 (DEAQ box RNA-dependent ATPase 1 [Source:ZFIN;Acc:ZDB-GENE-150224-1])

HSP 1 Score: 204.912 bits (520), Expect = 1.278e-56
Identity = 135/442 (30.54%), Postives = 230/442 (52.04%), Query Frame = -2
Query: 1510 PIIVIVGETGSGKTTQIPQYILEAGIN---DGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENC-----------CASLADIKNLVVFPLY----GAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTS-SGWCYRLYTKDXXXXXXXXXXXXXFLKDLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMV 2775
            P+I++ GE G GK+TQIPQ+  E  ++   +   +   QP  +AA ++A RVA+EM   +G EVGY + F+   +  T + F TD +LL     DP+L  YG I++DE  ERS+STDV +G+L+ +  +RP LRV++ +     E    Y+  VP   + G+   ++      +  D +   +K +V EIH   + GD+LVFL  ++D                 +L +++ + + P +    GA+ Y++         +  R+VV+++ IAE++ + +G++FVIDSG   K+ +N            IS+SQA Q      R   +G C+RLY +  F+   +   P +   +L  + L L  +DI D     ++D P+     K  E+L  L  LD    ++++G I++  P++P + K L AS ++ C   + T+ AM+
Sbjct:   78 PVILVSGEPGVGKSTQIPQWCAEFALSRECEHGTVVCAQPHAMAATSLAVRVADEMDLNVGHEVGYSVPFEDCCTTDTILRFTTDEMLLRELTSDPQLDRYGAIVLDEVQERSLSTDVLMGLLRDVGRQRPGLRVVLVATPCAAEALHRYYGDVPWREVVGQQGQLVYTGVETEQRDVVRAAVK-LVLEIHRAAQPGDVLVFLPSDKDASTAYEQARREARQLSPALGELRLVPLLPGHPGGAGAL-YDAGGAAATAKGRGGRRVVLSSGIAESAFSFEGVRFVIDSGLETKNVYNPRIRADSQVVRPISRSQAEQTSCCAVRAGPAGKCFRLYPESVFKEMPELPPPRVLESNLTRLVLLLKRLDIADMGQCDFVDRPAPANRTKALEDLDYLAALDNDGNLSEVGIIMSEIPLDPQLAKALLASCEFDCVTEMLTLAAML 517          
BLAST of SMED30022829 vs. Ensembl Yeast
Match: PRP22 (DEAH-box RNA-dependent ATPase/ATP-dependent RNA helicase; associates with lariat intermediates before the second catalytic step of splicing; mediates ATP-dependent mRNA release from the spliceosome and unwinds RNA duplexes; required for proofreading the exon ligation reaction [Source:SGD;Acc:S000000815])

HSP 1 Score: 434.876 bits (1117), Expect = 4.822e-131
Identity = 237/570 (41.58%), Postives = 349/570 (61.23%), Query Frame = -2
Query: 1114 QAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASLAD--------IKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDX-XXXXXXXXXXXXFLKDLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLY 2793
            QAVR+N  +VIVGETGSGKTTQI QY+ E G ++  MIG TQPRR+AA+++AKRVAEE+ C++G +VGY IRF+  +   T+I ++TDG+L    ++DP++S Y VI++DEAHER+V+TDV   +LK    KRP+L+VI+TSAT++  +FS YF   P++ I GK FP+  +Y     +D +   L  V+ +IH+N+  GDILVFLTG+E+I++CC  L D        I  L++ P+Y A+  E Q K+F+P  K  RKVV ATNIAETSITIDGI +V+D G+ K + +N    +  L    ISQ+QANQRKGR GRT  G CYRLYT+   +    +   PEI  ++L H  L L AM I D   F ++D P   ++L    EL  L  LD   K+T+LGK ++ FP++P + + L +S    CS  + T+ +M+  + +F   K+ +    S K++F    GD+ T LN+Y  W+    S  +C  N +    ++    ++ Q+  + K+  + +  +  +   D I+K  +SGFF N ++ +S   Y  +     V +H SS LY
Sbjct:  494 QAVRDNQFLVIVGETGSGKTTQITQYLDEEGFSNYGMIGCTQPRRVAAVSVAKRVAEEVGCKVGHDVGYTIRFEDVTGPDTRIKYMTDGMLQREALLDPEMSKYSVIMLDEAHERTVATDVLFALLKKAAIKRPELKVIVTSATLNSAKFSEYFLNCPIINIPGKTFPVEVLYSQTPQMDYIEAALDCVI-DIHINEGPGDILVFLTGQEEIDSCCEILYDRVKTLGDSIGELLILPVYSALPSEIQSKIFEPTPKGSRKVVFATNIAETSITIDGIYYVVDPGFAKINIYNARAGIEQLIVSPISQAQANQRKGRAGRTGPGKCYRLYTESAFYNEMLENTVPEIQRQNLSHTILMLKAMGINDLLKFDFMDPPPKNLMLNALTELYHLQSLDDEGKLTNLGKEMSLFPMDPTLSRSLLSSVDNQCSDEIVTIISMLSVQNVFYRPKDRQLEADSKKAKFHHPYGDHLTLLNVYTRWQQANYSEQYCKTNFLHFRHLKRARDVKSQISMIFKK--IGLKLISCHSDPDLIRKTFVSGFFMNAAKRDSQVGYKTINGGTEVGIHPSSSLY 1060          
BLAST of SMED30022829 vs. Ensembl Yeast
Match: PRP43 (RNA helicase in the DEAH-box family; functions in both RNA polymerase I and polymerase II transcript metabolism; catalyzes removal of U2, U5, and U6 snRNPs from the postsplicing lariat-intron ribonucleoprotein complex; required for efficient biogenesis of both small- and large-subunit rRNAs; acts with Sqs1p to promote 20S to 18S rRNA processing catalyzed by endonuclease Nob1p [Source:SGD;Acc:S000003088])

HSP 1 Score: 408.297 bits (1048), Expect = 3.236e-125
Identity = 226/583 (38.77%), Postives = 352/583 (60.38%), Query Frame = -2
Query: 1117 RNNPIIVIVGETGSGKTTQIPQYIL--EAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASLA----------DIKNLVVFPLYGAIDYESQQKVFKPVEKNE-----RKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDIDPF-NFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSA----DWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVN---YLPPNLCQDPIQKAILSGFFKNVSRHESSEK-YFNVYRKKIVHLHTSSCL 2784
            +NN I+V VGETGSGKTTQIPQ++L  E    +   +  TQPRR+AA+++A+RVAEEM  +LG EVGY IRF+ ++S  T + ++TDG+LL   + D  LS Y  II+DEAHER+++TD+ +G+LK +V++RPDL++II SAT+D E+F  YFN  P+L + G+ +P+   Y P    D L   ++ V+ +IH  +E+GDIL+FLTGE++IE+    ++              L V+PLYG++    QQ++F+P  ++      RKVV++TNIAETS+TIDGI +V+D G+ K+  +N    V  L    IS++ A QR GR GRT  G C+RLYT++ F+    E      L+ +L    L+L  + ID   +F ++D P+   +++  EEL  L CLD    +T LG++ + FP++P +  +L  S ++ CS  + T+ AM+    +F+   + +KR    K+ F+   GD+ T LN+Y+++K +         WC ++ ++  ++     IR QL  ++ R +L +N   Y  P    D I+KA+ SGFF  V++  S  K Y  V   + V +H S+ L
Sbjct:  107 QNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQVACTQPRRVAAMSVAQRVAEEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDHDLSRYSCIILDEAHERTLATDILMGLLKQVVKRRPDLKIIIMSATLDAEKFQRYFNDAPLLAVPGRTYPVELYYTPEFQRDYLDSAIRTVL-QIHATEEAGDILLFLTGEDEIEDAVRKISLEGDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESHNGRPGRKVVISTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFQKELIEQSYPEILRSNLSSTVLELKKLGIDDLVHFDFMDPPAPETMMRALEELNYLACLDDEGNLTPLGRLASQFPLDPMLAVMLIGSFEFQCSQEILTIVAMLSVPNVFIRPTKDKKRADDAKNIFAHPDGDHITLLNVYHAFKSDEAYEYGIHKWCRDHYLNYRSLSAADNIRSQLERLMNRYNLELNTTDYESPKYF-DNIRKALASGFFMQVAKKRSGAKGYITVKDNQDVLIHPSTVL 687          
BLAST of SMED30022829 vs. Ensembl Yeast
Match: PRP16 (DEAH-box RNA helicase involved in second catalytic step of splicing and in exon ligation; exhibits ATP-dependent RNA unwinding activity; mediates the release of Yju2p and Cwc25p in the second step; in the absence of ATP, stabilizes the binding of Cwc25p to the spliceosome in the first catalytic step; missense mutation in human ortholog DHX38 associated with early-onset retinitis pigmentosa [Source:SGD;Acc:S000001794])

HSP 1 Score: 374.785 bits (961), Expect = 2.715e-110
Identity = 219/583 (37.56%), Postives = 339/583 (58.15%), Query Frame = -2
Query: 1114 VRNNPIIVIVGETGSGKTTQIPQYILEAG-IND-GKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRF-DKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKE--SGDILVFLTGEEDIENC-----------------CASLADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI--DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLY 2787
            +R N ++VI+GETGSGKTTQ+ QY+ E G  ND GK I +TQPRR+AAI++AKRVA EM   LG EVGY IRF D   SE TK+ F+TDGILL   ++D  L  Y  +I+DEAHERS++TD+ LG  K+L+ +R DL++IITSAT++ ++FS +F   P   I G+ FP+  IY      D +   + + V +IHL  +  SGDIL+F+TG+EDIE                    A+  +I ++ + P+Y A+  + Q K+F+ +   +RK+++ATNIAETS+TI GI++VID GY K   +N +  +  L    IS++ A+QR GR GRT+ G  YRLYT+D F+            + +L +  L L ++D+  +   F ++D P +   L    EL  +G +D   ++T LG  +  FP++P++ K+L  + + GCS  + T+ +M+   ++F   KE +K     +++F     D+ T LN++  W+ N  S+ WC ++ +  +++     IR QL+ +LK   + V  +      D I+K I SGF    ++      Y ++     V LH +S L+
Sbjct:  363 IRENQVVVIIGETGSGKTTQLAQYLYEEGYANDRGKSIVVTQPRRVAAISVAKRVAMEMQVPLGKEVGYSIRFEDVTDSECTKLKFVTDGILLRETLLDDTLDKYSCVIIDEAHERSLNTDILLGFFKILLARRRDLKLIITSATMNAKKFSAFFGNAPQFTIPGRTFPVQTIYTSNPVQDYVEAAVSQAV-KIHLANDCSSGDILIFMTGQEDIETTFDTLQEKFLQVYSKKFGTANFEEINDIEILPIYSALPADLQFKIFQDLHGTKRKIIIATNIAETSLTIKGIRYVIDCGYSKLKVYNPKIGLDSLVITPISKANADQRSGRAGRTAPGTAYRLYTEDTFKEDMYLQTIPEIQRTNLSNTLLLLKSLDVTDELSKFPFIDKPPLQTFLSSLYELWFIGAIDTSGQLTPLGLQMAKFPLQPSLSKILLIAVRNGCSDEMLTIVSMLSVPQVFYRPKERQKEADIARNKFFIAKSDHLTLLNVFEQWRANNFSSHWCNKHFVQYKSLVRARDIRDQLLTILKSQKIPV--ISSGKDWDIIKKCICSGFAHQAAKITGLRNYVHLKTGVSVQLHPTSALH 942          
BLAST of SMED30022829 vs. Ensembl Yeast
Match: PRP2 (RNA-dependent DExD/H-box ATPase; required for activation of spliceosome before first transesterification step in RNA splicing; implicated in rearranging and proofreading snRNA structure in catalytic activation of spliceosome; ortholog of human protein DHX16 [Source:SGD;Acc:S000005294])

HSP 1 Score: 357.836 bits (917), Expect = 5.230e-106
Identity = 207/534 (38.76%), Postives = 319/534 (59.74%), Query Frame = -2
Query: 1276 FQAVRNNPIIVIVGETGSGKTTQIPQYILEAGIND-GKM-IGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRF-DKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKE-SGDILVFLTGEEDIENCCASLADI--------KNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTK----DXXXXXXXXXXXXXFLKDLCHIFLKLTAMDIDPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKY----GCSLNLATMFAMVLEK-KLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQL------IGVLKRND 2796
             Q ++ N +++I+GETGSGKTTQ+PQY++E G  D GK+ I ITQPRR+AA ++A RVA+EM+  LG EVGY+IRF DK +   T + ++TDG+LL   + D KLS Y  I++DEAHER+++TD+ +G+LK ++ +RP L+++I+SAT++ ++FS +F+  P+  + G+ +P+   Y      + +   +  +  +IH  +   GDILVFLTG+E+IE     L +I        K +++ P+Y  +  E Q K+F+P  +N RKVV+ATNIAETS+TIDGI++VID G+VK++ +     +  L TV  S++  +QR GR GR   G C+R++TK     E E   K       L +   + L L   D+    F  +D PS+P L K  E L  LG L+    IT LGK++  FP EP   KVLY ++ +    G      T+ +M+ E   LF+  K  R    S+ SE      D+  +L I+N W+ +  S  WC ++ I  +T+  +  IR+QL      +G++++ND
Sbjct:  233 LQEIKKNQVLIIMGETGSGKTTQLPQYLVEDGFTDQGKLQIAITQPRRVAATSVAARVADEMNVVLGKEVGYQIRFEDKTTPNKTVLKYMTDGMLLREFLTDSKLSKYSCIMIDEAHERTLATDILIGLLKDILPQRPTLKLLISSATMNAKKFSEFFDNCPIFNVPGRRYPVDIHYTLQPEANYIHAAITTIF-QIHTTQSLPGDILVFLTGQEEIERTKTKLEEIMSKLGSRTKQMIITPIYANLPQEQQLKIFQPTPENCRKVVLATNIAETSLTIDGIRYVIDPGFVKENSYVPSTGMTQLLTVPCSRASVDQRAGRAGRVGPGKCFRIFTKWSYLHELELMPKPEITRTNLSNTVLLLLSLGVTDL--IKFPLMDKPSIPTLRKSLENLYILGALNSKGTITRLGKMMCEFPCEPEFAKVLYTAATHEQCQGVLEECLTIVSMLHETPSLFIGQK--RDAAASVLSEVE---SDHILYLEIFNQWRNSKFSRSWCQDHKIQFKTMLRVRNIRNQLFRCSEKVGLVEKND 758          
BLAST of SMED30022829 vs. Ensembl Yeast
Match: DHR2 (Predominantly nucleolar DEAH-box ATP-dependent RNA helicase; required for 18S rRNA synthesis [Source:SGD;Acc:S000001561])

HSP 1 Score: 342.428 bits (877), Expect = 5.803e-102
Identity = 213/595 (35.80%), Postives = 327/595 (54.96%), Query Frame = -2
Query: 1105 VRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKM--IGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVE-KRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASL----------ADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLKDLCHIFLKLTAMDIDP-FNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGC-SLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDY-----------FTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKR---NDLSVNYLPPNLCQD-----PIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSK 2787
            + +NP+ V++GETGSGK+TQIPQ++LE   +  K   I +TQPRR+AAIN+A RVA+E  C+LG +VGY +RFD  ++  T++ +LTDG+LL   +++  L  Y VI++DEAHER+V TD+ LG LK L++  RPDLR+I+ SAT+  E+FS +FN  P+L++EG+ F + + Y    + D +  V++  + +I+  +E GDIL FL G+E+I+     +          A +  +V +PLY A+    Q  VF P++  +RKVV +TNIAETS+TI G+KFV+DSG  K   +  +  +  L TV ISQ+ A QR GR GR S G  +RLY + ++    K+ EPEI   D+    L L    +D   N+ + + P    ++   +EL +LG LD   KIT  G+ +   P++P +  VL  +S+ GC S  +  +  + +E  L   S E R  V   +    +    Y             F  +  S   + +  DWC   CI +   + + R+R QL    KR   +    +     + +D      I K  L+GF KN +       Y  V   + + +H SS L+ +K
Sbjct:   94 IESNPVTVLIGETGSGKSTQIPQFVLEKLYDTKKHGSIAVTQPRRVAAINLATRVAQEHGCKLGEQVGYSVRFDNTTTTRTRLKYLTDGMLLRELMMNSDLREYSVIVIDEAHERTVLTDLILGFLKSLIQGPRPDLRIIVMSATLQAEKFSEFFNNAPILFVEGRKFDVKQYYLKAPTDDIVDAVIRCCI-QINQGEELGDILCFLPGQEEIDKAVTIMEKIAKYVSDEAPVPLIVPYPLYAALPAVQQSLVFAPIKGFKRKVVFSTNIAETSVTISGVKFVVDSGLRKVKVWRHQLGLATLLTVPISQASAMQRSGRAGRESEGKSFRLYCESDYVKLPKQSEPEIARSDVTSPVLMLKRYGVDDLLNWTWFENPGKEAIVMGLQELYELGALDTRGKITKRGQQMALLPLQPHLSSVLIKASEVGCLSQVIDIVSCLSVENLLLNPSPEERDEVNERRLSLCNAGKRYGDLIMLKELFDIYFYELGKSQDASSERNDWCKGLCISIRGFKNVIRVRDQLRVYCKRLFSSISEEDEESKKIGEDGELISKILKCFLTGFIKNTAIGMPDRSYRTVSTGEPISIHPSSMLFMNK 687          
BLAST of SMED30022829 vs. Ensembl Nematostella
Match: EDO32531 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUS3])

HSP 1 Score: 382.489 bits (981), Expect = 2.488e-116
Identity = 217/580 (37.41%), Postives = 339/580 (58.45%), Query Frame = -2
Query: 1102 VRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPD-----LRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKE-SGDILVFLTGEEDIENCCASLADIK--------NLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLKDLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYN---KITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKP 2787
            +RN   ++IVGETGSGKTTQIPQY+ EA +    +I  TQPRR+AAI++A+RV+ EM  +LG EVGY +RF+  +S  T+I ++TDG+LL   + D  L  Y VII+DEAHER++ TDV  GI+K     R D     L++++ SAT++  +FS YF    VL+IEG+  P+  +Y     +D +   L  ++ ++H  K   GDILVFLTG+++IE+    ++D           L+V P++ A+    Q +VF+P     RKV+++TNIAETS+TI G+K+VID+GYVK   F+ +  + +L    +S++QA QR GR GR  SG CYRLYT+++FE   +   PEI   +L  + L+L A+ I D  +F ++D PS   +    ++L  L  L + N   K+T LG+ +  FP+EP + KV+ AS   GCS  + T+ A++    +  + +  R     ++ +F    GD  T LNIY ++K  G +  WC E+ I+   ++ +  IR QL  +  R ++ +     +     +++ +  G F N +  +    Y  +  ++ V +H SS L+ SKP
Sbjct:   71 IRNRQNVIIVGETGSGKTTQIPQYLYEAKVARNSVIACTQPRRVAAISIAQRVSREMGVQLGEEVGYTVRFEDVTSTKTRIKYMTDGMLLRESIGDSLLKRYSVIILDEAHERTIHTDVLFGIVKGAQISRKDKGMLPLKIVVMSATLEAHQFSEYFGSAEVLYIEGRQHPVELMYAVEPQVDYMHAALITIM-QLHQEKPLGGDILVFLTGQDEIESLSKLVSDCSLHCPPDCPQLLVCPMFAALPSSQQMQVFRPAIPGARKVILSTNIAETSVTIPGVKYVIDTGYVKAKGFHPKTGLDMLRVQPVSKAQARQRLGRAGRECSGVCYRLYTEEQFEQLAEATVPEIQRCNLSSVILQLMALGIADIASFDFMDKPSADAIDGALKQLVILEALQEINGDYKLTSLGQKMAQFPLEPRLAKVILASETLGCSEEILTVVALLSVDSITYTPQSKRDHALKVRKKFLSSEGDQITLLNIYRAYKQCGMNKSWCAEHFINTRVMKLVMDIRKQLREICIRLEIKLQSCGKD--SATLRQCLCRGLFMNSAELQLDGTYQTLNHRETVAIHPSSSLFMSKP 647          
BLAST of SMED30022829 vs. Ensembl Nematostella
Match: EDO45861 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRP1])

HSP 1 Score: 345.125 bits (884), Expect = 5.111e-104
Identity = 217/555 (39.10%), Postives = 319/555 (57.48%), Query Frame = -2
Query: 1168 IVIVGETGSGKTTQIPQYILEAG-INDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRF-DKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNI----------VPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASLADIKN--------LVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLKDLCHIFLKLTAMDIDPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITD-LGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKY 2769
            ++IVGETG GK+TQ+ +Y+LE+G   DGK IGITQPRR+AAI +A RVAEE     G EVGY +RF D    ++T I F+TDGILL   + DP LS+Y VI++DEAHER++ TDV LG+LK + +KRPDLR+I++SAT+D E F ++FN             VL +EG+ +P+  I   I  +        E    IHL +  GDILVFLTG+E++E+  + L +           L V P+Y  + YE Q  VFK    N RKV+VATN+AE SITIDGI +V+D G+VK   ++    +  L    ISQ+ A QR GR GR  +G  YRLYT+D     +    PE+  +    I LK   +D +   F +   P    +++  E L  L  LD   K+ D LG  +  FP+EP I K+L  S ++ CS  + T+ AM+  K +F++    +      + +FS   GD+ T LN++ ++  + KS+ WC +N ++ + +    +IR QL  +L+   + +     ++  D + + I++GFF N +R+  S  Y
Sbjct:   58 VIIVGETGCGKSTQV-KYLLESGWTADGKKIGITQPRRVAAITVAIRVAEERDTFAGQEVGYCVRFNDCFDPKLTSIKFMTDGILLREVMGDPLLSSYSVIMIDEAHERTLHTDVLLGLLKKIKKKRPDLRIIVSSATLDAEMFKDFFNTNITNDKSKDTAAVLSVEGRSYPV-NIEYAISPVANYLQSAVETAMGIHLEEGPGDILVFLTGQEEVESAVSKLIERARGMPKGSSYLKVLPMYSGLPYEEQMLVFKRPPPNTRKVIVATNVAEASITIDGIVYVVDCGFVKLRAYSPATGIESLVVTEISQASAEQRAGRAGRVRAGKAYRLYTEDALHELKPVTVPEMQ-RYFIGILLKSMGID-NVLRFDFPARPPAQSMVRGLELLYALDALDDNGKLVDPLGVQMAEFPLEPMIAKMLLISGEFKCSEEILTIAAMLQIKNVFVTPSSQKAASEHARRKFSVYEGDHLTQLNVHRAFLKHKKSSRWCHDNFVNYKGLMHSVKIREQLKKLLQHFKIPIVSCDGDV--DQVCRCIVAGFFSNAARYHPSGCY 606          
BLAST of SMED30022829 vs. Ensembl Nematostella
Match: EDO49560 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGM4])

HSP 1 Score: 318.931 bits (816), Expect = 9.353e-96
Identity = 168/449 (37.42%), Postives = 252/449 (56.12%), Query Frame = -2
Query: 1102 LKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASL--------ADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKP 2418
            +K  V++RPDL++I+TSAT+D  +FS +F   P+  I G+ FP+  +Y      D L   L  V+ +IHL +  GDILVFLTG+E+I+  C  L         D+  L++ P+Y A+  E Q ++F P     RK V+ATNIAETS+TIDGI +V+D G+VK++ +N +  +  L    ISQ+QA QR GR GRT  G CYRLYT+  +             + +L    L L AM I D  +F ++D P M  ++   E L  L  LD    +T LG+ +  FP+EP + K+L  S   GCS  + T+ +M+  + +F   K+ +      K++F    GD+ T L +YNSWK N  S  WC EN +   ++     IR Q++G++ R+ L V     +  +  +QKAI SGFF+N +R +  E Y  V   ++V++H SS L+  +P
Sbjct:    1 MKKAVQRRPDLKLIVTSATLDAVKFSTFFFEAPIFTIPGRTFPVEILYTKEAESDYLDAALITVM-QIHLTEPPGDILVFLTGQEEIDTACEILYERTKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKCVIATNIAETSLTIDGIYYVVDPGFVKQNVYNSKSGMDALVVTPISQAQAKQRSGRAGRTGPGKCYRLYTERAYRDEMLATAVPEIQRTNLASTILSLKAMGINDLLSFDFMDPPPMETMISAMEALHSLSALDNEGLLTRLGRRMAEFPLEPQLSKMLIQSVHLGCSDEILTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNAWCFENFVQARSLRRAQDIRKQMLGLMDRHKLDVVSCGKHTAR--VQKAITSGFFRNAARKDPQEGYRTVVDNQVVYIHPSSALFNRQP 446          
BLAST of SMED30022829 vs. Ensembl Nematostella
Match: EDO32629 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUG0])

HSP 1 Score: 301.212 bits (770), Expect = 3.517e-90
Identity = 168/469 (35.82%), Postives = 271/469 (57.78%), Query Frame = -2
Query: 1195 FLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKE-SGDILVFLTGEEDIENCCASL--------ADIKNLVVFPLYGAIDYESQQKVFKPVEKNE------RKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDIDPF-NFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQD---PIQKAILSGFFKNV 2541
            ++TDG+LL   + DP L  Y VI++DEAHER+++TD+ +G+LK + ++R DL++II SAT+D  +F +YF+  P++ I G+  P+   Y P    D L   ++ V+ +IH+ +E  GDIL+FLTG+E+IE  C  +        ++I  L   PLY  +    QQ++F+    +       RK VVATNIAETS+TIDG+ FVID G+ K+  +N    V  L    IS++ A QR GR GRT  G C+RLYT+  F+           L+ +L  + L+L  + ID   +F ++D P+   L++  E L  LG LD    +T+LG ++  FP++P + K++ AS ++ CS  + ++ +M+   ++F+   E +K     K +F+   GD+ T LN+Y+++K N +   WC +N I   +++    +R QL  ++ R +L       N  +D    I+KA++SGFF  V
Sbjct:    2 YMTDGMLLREAMTDPLLDRYAVILLDEAHERTLATDILMGLLKEVAKQRDDLKIIIMSATLDAGKFQDYFDHCPLMTIPGRTHPVEIFYTPEPERDYLEAAIRTVI-QIHMVEEVKGDILLFLTGQEEIEEACKRIKKEVDNLGSEIGELKCIPLYSTLPPTQQQRIFEAAPPDRPNGAIGRKCVVATNIAETSLTIDGVVFVIDPGFSKQKVYNPRIRVESLLVSAISRASAQQRAGRAGRTRPGKCFRLYTEKAFQEEMPPNTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLGALDDNGDLTELGSMMAEFPLDPQLAKMVIASCEFNCSNEILSITSMLSVPQVFLRPNEAKKAADESKMKFAHIDGDHLTLLNVYHAYKQNHEDTQWCYDNFIQHRSMKSADNVRGQLARIMDRFNLQRRSTDFN-SRDYYLNIRKALVSGFFMQV 468          
BLAST of SMED30022829 vs. Ensembl Nematostella
Match: EDO35622 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKZ8])

HSP 1 Score: 299.671 bits (766), Expect = 1.390e-85
Identity = 153/320 (47.81%), Postives = 214/320 (66.88%), Query Frame = -2
Query: 1849 VRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCC-------ASLADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSG 2787
            VR+N +++IVGETGSGKTTQ+ QY+ E G  +  MIG TQPRR+AA+++AKRV+EEM C LG EVGY IRF+  +S+ T I ++TDGILL   + +  L +Y VII+DEAHERS++TDV  G+L+ +V +R DL++I+TSAT+D ++F+++F  VP   I G+ FP+   +      D +   +K+ + +IHL    GDILVF+ G+EDIE  C       A + +   L V P+Y  +  + Q K+F+      RK VVATNIAETS+T+DGI FVID+GY K   +N +  +  L+   ISQ+ ANQR GR GRT  G
Sbjct:  540 VRDNQVVIIVGETGSGKTTQLTQYMHEDGYTNYGMIGCTQPRRVAAMSVAKRVSEEMDCSLGEEVGYAIRFEDVTSDKTMIKYMTDGILLRESLRESDLDHYSVIIMDEAHERSLNTDVLFGLLRDVVSRRRDLKLIVTSATMDAQKFADFFGNVPTYKIPGRTFPVEIFFTRTVMEDYVDSAVKQAL-QIHLTPSKGDILVFMPGQEDIEVTCELISERLAEVEEAPPLAVLPIYSQLPSDLQAKIFQKAPDGVRKCVVATNIAETSLTVDGIMFVIDAGYCKLKVYNPKIGMDALQVYPISQANANQRSGRAGRTGPG 858          
BLAST of SMED30022829 vs. Ensembl Medaka
Match: dhx8 (DEAH-box helicase 8 [Source:NCBI gene;Acc:101162325])

HSP 1 Score: 464.537 bits (1194), Expect = 3.520e-140
Identity = 241/574 (41.99%), Postives = 348/574 (60.63%), Query Frame = -2
Query: 1102 QAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASL--------ADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKP 2793
            QAV +N I++++GETGSGKTTQI QY+ EAG      IG TQPRR+AA+++AKRV+EE  C LG EVGY IRF+  +S  T I ++TDG+LL  C+ID +L  Y +I++DEAHER++ TDV  G+LK  V+KR D+++I+TSAT+D  +FS YF   P+  I G+ +P+  +Y      D L   L  V+ +IHL +  GDILVFLTG+E+I+  C  L         D+  L++ P+Y A+  E Q ++F P     RKVV+ATNIAETS+TIDGI +V+D G+VK+  +N +  +  L    ISQ+QA QR GR GRT  G CYRLYT+  +             + +L    L L AM I D  +F ++DAP M  L+   E+L  LG LD    +T LG+ +  FP+EP + K+L  S   GCS  + T+ +M+  + +F   K+ +      K++F    GD+ T L +YNSWK N  S  WC EN I   ++     IR Q++G++ R+ L V        +  +QKAI SGFF+N ++ +  E Y  +  +++V++H SS L+  +P
Sbjct:  572 QAVHDNQILIVIGETGSGKTTQITQYLAEAGYTARGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDSELGQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRTDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEVLYTKEPETDYLDASLITVM-QIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVR--VQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQP 1142          
BLAST of SMED30022829 vs. Ensembl Medaka
Match: dhx16 (DEAH-box helicase 16 [Source:NCBI gene;Acc:101168894])

HSP 1 Score: 414.461 bits (1064), Expect = 1.376e-123
Identity = 228/579 (39.38%), Postives = 347/579 (59.93%), Query Frame = -2
Query: 1099 AVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKM-IGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASLAD--------IKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDI-DPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMV-LEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQD---PIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKPN 2790
            A+  + ++VI GETGSGKTTQIPQY++E G  +G M IG TQPRR+AA+++A RVAEE+  +LG EVGY IRF+  +SE T + ++TDG+LL   + +P L++Y VI++DEAHER++ TD+  G++K +   RPDL+V++ SAT+D ERFS++F+  PV  I G+ FP+   Y      D L   +  V+ +IH+ +  GDILVFLTG+E+IE CC  L +        I  L+V P+Y  +  + Q K+F P     RKVVVATNIAETS+TIDGI +VID G+ K+  +N    +  L     S++ ANQR GR GR ++G C+RLYT   F+   +E       + +L ++ L L ++ I D  +F ++D P    L+   E+L  LG L+   ++T LG+ +   PV+P + K++ AS +Y CS  + T+ AM+ +   +F   K+      + +  F    GD+   LN+Y  W  +G S  WC EN I   ++     +R QL G+++R ++ V       CQ    PI+KA+ +G+F + +R  S   Y  V  ++ V+ H +S L++ +P 
Sbjct:  422 AINEHQVLVIEGETGSGKTTQIPQYLMEEGYTNGGMKIGCTQPRRVAAMSVAARVAEEIGVKLGNEVGYSIRFEDCTSERTVLKYMTDGMLLREFLTEPDLASYSVILIDEAHERTLHTDILFGLIKDIARFRPDLKVLVASATLDTERFSSFFDDAPVFRIPGRRFPVDIFYTKAPEADYLDACVVSVL-QIHVTQPPGDILVFLTGQEEIEACCELLQERCRRLGSKIAELLVLPIYANLPSDMQAKIFTPTPPGARKVVVATNIAETSLTIDGIIYVIDPGFCKQKSYNARTGMESLIVTPCSRASANQRAGRAGRVAAGKCFRLYTAWAFKHEMEETTVPEIQRTNLGNVVLLLKSLGINDLIHFDFMDPPPHETLVLALEQLYALGALNHLGELTKLGRRMAELPVDPMLSKMILASEQYKCSEEVLTIAAMLSVNNSIFYRPKDKVVHADNARMNFVVPGGDHLVLLNVYTQWVESGFSTQWCYENFIQFRSMRRARDVRDQLEGLMERIEVEVVS-----CQGENVPIRKAVTAGYFYHTARL-SKGGYKTVKHQQTVYTHPNSSLFEEQPR 993          
BLAST of SMED30022829 vs. Ensembl Medaka
Match: zgc:158828 (DEAH-box helicase 35 [Source:NCBI gene;Acc:101161239])

HSP 1 Score: 399.823 bits (1026), Expect = 3.487e-122
Identity = 223/580 (38.45%), Postives = 339/580 (58.45%), Query Frame = -2
Query: 1102 IVIVGETGSGKTTQIPQYILEAG-INDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQS-SEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNI----------VPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASLADI----------KNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLKDLCHIFLKLTAMDIDP-FNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITD-LGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKP 2769
            +++VGETG GKTTQIPQY++EAG   +GK++G+TQPRR+AAI++A RVAEE    LG EVGY IRFD  S    T+I FLTDG+L+   + DP L+ Y V+++DEAHER++ TD+ +G+LK + +KR DLRVI+ SAT+D ++F  +FN+            +L +EG+ FP+ +I+  +  +        E V +IH  ++ GD+L FLTG+E++E   + L D           K+L + P+Y  + Y  Q +VF+ V    RKVVVATNIAETSITI+GI FVID  +VK   +N    +  L    IS++ A+QR GR GR   G C+RLYT+++++       PE+   +L  + L+L A+ ID    F +L  P    +++  E L  LG LD Y ++TD +G  +  FP+ P   K+L  S  +GCS  + T+ AM+  + +F+     +K       +F+   GD+ T LN+Y ++  + KS+ WC E+ ++ + +     +R QL  ++  N   V         D I + I++GFF N +R   S  Y  +   + +H+H +S LY  KP
Sbjct:   71 VIVVGETGCGKTTQIPQYLVEAGWATEGKVVGVTQPRRVAAISVANRVAEERGALLGHEVGYTIRFDDCSDPHATRIKFLTDGMLVREMMADPLLTKYSVLMLDEAHERTLYTDIAIGLLKKIQKKRRDLRVIVASATLDAKKFHEFFNLNESGDPNKDTCGILTVEGRCFPV-DIFYTVSPVPDYVKATVETVMKIHETEDDGDVLAFLTGQEEVEKVVSLLQDQARSLSRYGMKKHLRILPMYSGLPYAEQMRVFERVPPTVRKVVVATNIAETSITINGIVFVIDCAFVKLRAYNPRTAIESLVVTPISKASASQRAGRAGRNRPGKCFRLYTEEDYDKLPASTVPEMQRTNLAPVILQLKALGIDNVLRFSFLSPPPAQTMVQALELLYALGGLDHYGRLTDPMGVRMAEFPLSPMFAKMLLESGNFGCSKEIVTIAAMMQIQNIFVVPPNQKKVAAREHRKFAVAEGDHLTMLNVYEAFMKHQKSSQWCQEHFLNYKGLLRAVTVREQLRRLM--NKFKVPRTSSEGDPDVILRCIVAGFFANAARIHHSGSYRTLRDDRELHIHPNSVLYVEKP 647          
BLAST of SMED30022829 vs. Ensembl Medaka
Match: dhx15 (pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 [Source:NCBI gene;Acc:101166992])

HSP 1 Score: 397.127 bits (1019), Expect = 5.446e-121
Identity = 216/585 (36.92%), Postives = 348/585 (59.49%), Query Frame = -2
Query: 1117 FTEFQAVRNNPIIVIVGETGSGKTTQIPQY---ILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASL--------ADIKNLVVFPLYGAIDYESQQKVFKPVEKNE------RKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDIDPF-NFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDL---SVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCL 2805
            FTE   +  N   V+VGETGSGKTTQIPQ+   ++ +     + +  TQPRR+AA+++A+RVA+EM   LG EVGY IRF+  SS  T + ++TDG+LL   + DP L  YGVII+DEAHER+++TD+ +G+LK +V +R DL+VI+ SAT+D  +F  YF+  P+L I G+  P+   Y P    D L   ++ V+      +E GD+L+FLTG+E+I+  C  +         ++ ++ + PLY  +  + QQ++F+P   N+      RKVVV+TNIAETS+TIDG+ FVID G+ K+  +N    V  L    +S++ A QR GR GRT  G C+RLYT+  +++  ++      L+ +L  + L+L  + ID   +F ++D P+   L++  E L  L  L+    +T+LG ++  FP++P + K++ AS +Y CS  + T+ AM+   + F+   E +K     K  F+   GD+ T LN+Y+++K N +S  WC +N ++  ++     +R QL  +++R +L   S  +   +   + I++A+++GFF  V+  E +  Y  V   ++V LH S+ L
Sbjct:   58 FTEI--LMRNQSFVLVGETGSGKTTQIPQWCVDMVRSLQGPKRAVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTVLKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEIVRQRTDLKVIVMSATLDAGKFQVYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQLHMCEEEEGDVLLFLTGQEEIDEACKRIKREVEDLGPEVGDMKIIPLYSTLPPQQQQRIFEPSPPNKPNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAVSKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNFLAALNDDGDLTELGAMMAEFPLDPQLAKMVIASCEYNCSNEILTITAMLSVPQCFVRPTEAKKVADESKLRFAHIDGDHLTLLNVYHAFKQNHESTQWCYDNFVNYRSLMSADNVRQQLSRIMERFNLPRRSTEFSSRDYYIN-IRRALVTGFFMQVAHLERTGHYLTVKDNQVVQLHPSTVL 639          
BLAST of SMED30022829 vs. Ensembl Medaka
Match: dhx15 (pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 [Source:NCBI gene;Acc:101166992])

HSP 1 Score: 397.127 bits (1019), Expect = 1.043e-120
Identity = 216/585 (36.92%), Postives = 348/585 (59.49%), Query Frame = -2
Query: 1117 FTEFQAVRNNPIIVIVGETGSGKTTQIPQY---ILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASL--------ADIKNLVVFPLYGAIDYESQQKVFKPVEKNE------RKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLK-DLCHIFLKLTAMDIDPF-NFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDL---SVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCL 2805
            FTE   +  N   V+VGETGSGKTTQIPQ+   ++ +     + +  TQPRR+AA+++A+RVA+EM   LG EVGY IRF+  SS  T + ++TDG+LL   + DP L  YGVII+DEAHER+++TD+ +G+LK +V +R DL+VI+ SAT+D  +F  YF+  P+L I G+  P+   Y P    D L   ++ V+      +E GD+L+FLTG+E+I+  C  +         ++ ++ + PLY  +  + QQ++F+P   N+      RKVVV+TNIAETS+TIDG+ FVID G+ K+  +N    V  L    +S++ A QR GR GRT  G C+RLYT+  +++  ++      L+ +L  + L+L  + ID   +F ++D P+   L++  E L  L  L+    +T+LG ++  FP++P + K++ AS +Y CS  + T+ AM+   + F+   E +K     K  F+   GD+ T LN+Y+++K N +S  WC +N ++  ++     +R QL  +++R +L   S  +   +   + I++A+++GFF  V+  E +  Y  V   ++V LH S+ L
Sbjct:   85 FTEI--LMRNQSFVLVGETGSGKTTQIPQWCVDMVRSLQGPKRAVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTVLKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEIVRQRTDLKVIVMSATLDAGKFQVYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQLHMCEEEEGDVLLFLTGQEEIDEACKRIKREVEDLGPEVGDMKIIPLYSTLPPQQQQRIFEPSPPNKPNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAVSKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNFLAALNDDGDLTELGAMMAEFPLDPQLAKMVIASCEYNCSNEILTITAMLSVPQCFVRPTEAKKVADESKLRFAHIDGDHLTLLNVYHAFKQNHESTQWCYDNFVNYRSLMSADNVRQQLSRIMERFNLPRRSTEFSSRDYYIN-IRRALVTGFFMQVAHLERTGHYLTVKDNQVVQLHPSTVL 666          
BLAST of SMED30022829 vs. Planmine SMEST
Match: SMESG000038834.1 (SMESG000038834.1)

HSP 1 Score: 1129.01 bits (2919), Expect = 0.000e+0
Identity = 565/567 (99.65%), Postives = 566/567 (99.82%), Query Frame = -2
Query: 1096 FQAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASLADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLKDLCHIFLKLTAMDIDPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKPNL 2796
             +AVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASLADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDEFESFEKEIEPEIFLKDLCHIFLKLTAMDIDPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKPNL
Sbjct:   24 LEAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASLADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDEFESFEKEIEPEIFLKDLCHIFLKLTAMDIDPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKPNL 590          
BLAST of SMED30022829 vs. Planmine SMEST
Match: SMESG000038834.1 (SMESG000038834.1)

HSP 1 Score: 1087.79 bits (2812), Expect = 0.000e+0
Identity = 549/567 (96.83%), Postives = 550/567 (97.00%), Query Frame = -2
Query: 1096 FQAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASLADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLKDLCHIFLKLTAMDIDPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKPNL 2796
             +AVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIE                DCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASLADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDEFESFEKEIEPEIFLKDLCHIFLKLTAMDIDPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKPNL
Sbjct:   24 LEAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIE----------------DCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASLADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDEFESFEKEIEPEIFLKDLCHIFLKLTAMDIDPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKPNL 574          
BLAST of SMED30022829 vs. Planmine SMEST
Match: SMESG000038860.1 (SMESG000038860.1)

HSP 1 Score: 580.482 bits (1495), Expect = 0.000e+0
Identity = 286/560 (51.07%), Postives = 398/560 (71.07%), Query Frame = -2
Query: 1117 QAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASLADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLKDLCHIFLKLTAMDIDPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNL-CQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCL 2793
            + VRNN I++I G TGSGKTTQIPQY+ EAGIN+ K IG+TQPRRIAAINMA RVA+EM   LG EVGYE+RF+K+SS  TKI ++TDGILLN C+ DPKL  YGV+++DEAHER+V TDV LG++K+L  +R DL+V+ITSATI CE+FSNYF+  PV+  +GK++ +  IY+P+ S       +  +V  IH   E GDIL+FLTG+EDIE CC +L  I++L V PLYGA+D+++QQ +FKP E  +RKV+V+TNIAETSITIDGI+FVID GYVK++ F+    +  L  VRISQ QA QRKGR GRT++GWCYRLYT++ + + ++E  PEI+ ++L   +LK+  + IDP +F ++D+P    L KC  EL+DL  +D++ KIT+LGK +  FPVEP IGK L+ASSKY C   + T+ AM+ E+ +F+  K+   +    K +F    GD F +LN Y +W  N KS  WC +N ++ +T+E+I  +R QL+G++KR     NY   +L   D I+K+++  F+KN+   +S   Y N   ++++++H SSCL
Sbjct:   33 KTVRNNQIVIIFGSTGSGKTTQIPQYLFEAGINNDKTIGVTQPRRIAAINMASRVAQEMRSCLGMEVGYEVRFNKKSSNSTKIKYMTDGILLNQCLEDPKLPEYGVLMIDEAHERTVDTDVLLGLIKILASRRTDLKVLITSATIICEKFSNYFSGAPVISFDGKMYDVQIIYEPMWSWSLY--FITNIVQTIHNGIEKGDILLFLTGQEDIEECCQNLESIQSLTVLPLYGALDFDAQQDIFKPAEPGKRKVIVSTNIAETSITIDGIRFVIDCGYVKQNLFDSRSGIDSLTNVRISQDQAIQRKGRAGRTNTGWCYRLYTEETYRAMKQETTPEIYRRNLYGTYLKIAGIGIDPMSFKFIDSPEHETLRKCLSELQDLDLIDEFKKITELGKSIQDFPVEPKIGKALFASSKYFCITEVITIMAMMSERNVFIRPKKSAVKSDYSKQKFFSSEGDQFMYLNAYKAWSENRKSKQWCYDNFVNFKTMEQIDLVRTQLMGLVKRK--FPNYQDSDLNLVDSIKKSLIPSFYKNICFRKSKGIYINYLNQQVLYMHPSSCL 588          
BLAST of SMED30022829 vs. Planmine SMEST
Match: SMESG000038861.1 (SMESG000038861.1)

HSP 1 Score: 532.717 bits (1371), Expect = 1.939e-172
Identity = 265/566 (46.82%), Postives = 392/566 (69.26%), Query Frame = -2
Query: 1102 VRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASLADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLKDLCHIFLKLTAMDIDPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFS--IKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPN--LCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKP 2787
            + +N +++I GETGSGKTTQIP+YI E G++   MIGITQPRRI AINMAKRVAEE +C +G EVGYEIRFD  S   T++ ++TDGILLN C  DP L +YG+I++DEAHER++ +DV LG+LK +V +  +++VI+ SAT+D ++FS YF   P+++I GK+FP+  IY+P+   + +   +++ VNEIH   E GDILVFLT +E+IE C   L  IK+L+V PL+ A++Y+ QQKVF+ V+  ERK +++TNIAETS+TIDG++F+ID GYVK+S+FN    + + E V+IS++QANQRKGR GRTS+GWCYRLY ++E+  F  + +PEI  K+L  I+LK+ +  ++P  F ++D PS   LLK  +EL++L  LDK+ +IT+ GK++ +FPVEP IGK++ +S    C  ++  + +M+ E+ +F+S++  R   FS   +SEF D+ GD FT L +Y  W  N KS  WC    ID   +E++  ++ QLI +LKR      Y  PN  + ++ I+K+I +G++KNV + +    Y     ++I+ +H SS L+   P
Sbjct:   42 IMDNQVVIIHGETGSGKTTQIPKYIYELGLHGNAMIGITQPRRIGAINMAKRVAEETNCAIGKEVGYEIRFDNSSGASTRVKYMTDGILLNQCTTDPNLKDYGIIMIDEAHERALRSDVLLGLLKSIVSRSSNIKVIVASATMDTKKFSRYFYNAPIIYITGKLFPVEIIYEPLQGENYIDASVRK-VNEIHRKPEKGDILVFLTSQEEIEKCTDLLRGIKDLLVLPLFSALEYDEQQKVFEEVKDYERKAIISTNIAETSLTIDGVRFIIDCGYVKQSNFNARLGIDIWEDVKISKAQANQRKGRAGRTSNGWCYRLYGENEYNRFSDQEKPEIQRKNLSEIYLKVVSFGLNPKTFEFIDPPSSDALLKSEKELKELKFLDKFGEITEEGKLMENFPVEPTIGKIILSSISNKCVGDMIIILSMLTERNIFLSTRRDR---FSKDTRSEFFDDDGDPFTMLKVYKEWLKNEKSEKWCKSYLIDYRKMEKVCLVQEQLILILKRQR---QYSEPNPEINKEAIKKSIFAGYYKNVCQRKRGFSYSRCLDEEILFIHPSSSLFDKNP 600          
BLAST of SMED30022829 vs. Planmine SMEST
Match: SMESG000038864.1 (SMESG000038864.1)

HSP 1 Score: 498.819 bits (1283), Expect = 1.177e-159
Identity = 256/568 (45.07%), Postives = 380/568 (66.90%), Query Frame = -2
Query: 1102 QAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASL--ADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDXXXXXXXXXXXXXFLKDLCHIFLKLTAMDIDPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLC--QDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKP 2793
            Q++  N II++ GETG GKTTQ+P++I E  +N  K+IG+TQPRRI AINMAKRVA E  C LG E+GYEIRFD +S   TKI ++TD ILLN C+ D  LS +  IIVDEAHERS+ +DV LG+LK +V    DL++IITSATID  +FS YF   P++ IEG+ + +  IY P D  D +   + +V+ +I  N E GDIL+FLT +E+IENC   L    I+NL++ PL+GA++Y  QQK+F PV+ NERKV+++TNIAETS+TID ++FVID GYVK+ +FN +  +  LE VRIS+S+A+QRKGR GRT++GWCYRLY + ++  F  +++PEI  ++L  +++K+    ++P  F+++D+P+   LL+   EL++L  LD+   +T  GK +  FPVEP IGK+L +S    C  ++  + A++ EK +F   K   ++   IK+ F DE GD F+ L +Y SW +  KS +WC  N ++ + +E+I  +  QLI +LKR+D+   Y  P+    ++ I+++I +G+FKN+ +  +  +Y        +++H  S L+K  P
Sbjct:   38 QSILENQIIIVHGETGCGKTTQMPKFIYELELNGDKVIGVTQPRRIGAINMAKRVAFETRCALGKEIGYEIRFDNKSGASTKIKYMTDAILLNKCITDRNLSEFSYIIVDEAHERSLQSDVLLGLLKDIVSHNEDLKIIITSATIDSIKFSKYFFDAPIINIEGRSYNVDIIYNPFDFTDYVESSVIQVL-QISKNPEKGDILIFLTSQEEIENCVEQLKKPGIENLILLPLFGAMEYREQQKIFDPVKDNERKVIISTNIAETSLTIDSVRFVIDCGYVKQKNFNPKSGIDNLEDVRISKSEADQRKGRVGRTNNGWCYRLYGEIDYHQFSDQVKPEILRRNLSEVYMKVLNFGLNPKQFNFIDSPTTEALLQTENELKELKFLDESGNLTADGKWMCDFPVEPRIGKILLSSIANDCVGDMVIILALLTEKNIFRRPKPQAEKADKIKANFFDEDGDPFSLLVVYKSWILCEKSPEWCRSNFLNQKALEQIYLVHQQLISILKRHDV---YKEPSSTTNKEAIKRSIFAGYFKNICKKRNRGEYSRCVDSLPLYIHPGSSLFKDSP 601          
The following BLAST results are available for this feature:
BLAST of SMED30022829 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DHX83.333e-14242.16DEAH-box helicase 8 [Source:NCBI gene;Acc:1659][more]
DHX81.423e-14142.16DEAH-box helicase 8 [Source:NCBI gene;Acc:1659][more]
DHX81.423e-14142.16DEAH-box helicase 8 [Source:NCBI gene;Acc:1659][more]
DHX358.588e-12338.31DEAH-box helicase 35 [Source:HGNC Symbol;Acc:HGNC:... [more]
DHX162.563e-12138.17DEAH-box helicase 16 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of SMED30022829 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mog-52.580e-13841.57Probable pre-mRNA-splicing factor ATP-dependent RN... [more]
mog-42.242e-12839.45Probable pre-mRNA-splicing factor ATP-dependent RN... [more]
mog-11.913e-12138.56Probable pre-mRNA-splicing factor ATP-dependent RN... [more]
mog-11.913e-12138.56Probable pre-mRNA-splicing factor ATP-dependent RN... [more]
ddx-154.682e-11736.90Pre-mRNA-splicing factor ATP-dependent RNA helicas... [more]
back to top
BLAST of SMED30022829 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pea4.141e-13541.11gene:FBgn0086895 transcript:FBtr0087518[more]
l(2)37Cb2.051e-12738.89gene:FBgn0086444 transcript:FBtr0081163[more]
Dhx152.180e-12237.76gene:FBgn0033160 transcript:FBtr0336909[more]
Dhx152.180e-12237.76gene:FBgn0033160 transcript:FBtr0088966[more]
l(1)G00072.664e-11938.49gene:FBgn0026713 transcript:FBtr0073900[more]
back to top
BLAST of SMED30022829 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AL833789.37.224e-14242.16DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:N... [more]
dhx81.678e-14142.16DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:Z... [more]
dhx86.688e-13640.20DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:Z... [more]
dhx163.845e-12539.76DEAH (Asp-Glu-Ala-His) box polypeptide 16 [Source:... [more]
dhx163.845e-12539.76DEAH (Asp-Glu-Ala-His) box polypeptide 16 [Source:... [more]
back to top
BLAST of SMED30022829 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rps15a5.686e-14942.26ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE... [more]
rps15a1.623e-14642.29ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE... [more]
rps15a2.780e-14642.33ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE... [more]
rps15a2.129e-14441.84ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE... [more]
rps15a5.636e-14441.84ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of SMED30022829 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dhx82.048e-14242.16DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:M... [more]
Dhx89.585e-14242.16DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:M... [more]
Dhx352.772e-12438.81DEAH (Asp-Glu-Ala-His) box polypeptide 35 [Source:... [more]
Dhx161.198e-12038.02DEAH (Asp-Glu-Ala-His) box polypeptide 16 [Source:... [more]
Dhx353.827e-12038.89DEAH (Asp-Glu-Ala-His) box polypeptide 35 [Source:... [more]
back to top
BLAST of SMED30022829 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A2A4P0|DHX8_MOUSE6.705e-14142.16ATP-dependent RNA helicase DHX8 OS=Mus musculus OX... [more]
sp|Q14562|DHX8_HUMAN6.833e-14142.16ATP-dependent RNA helicase DHX8 OS=Homo sapiens OX... [more]
sp|Q54F05|DHX8_DICDI5.983e-13942.53ATP-dependent RNA helicase dhx8 OS=Dictyostelium d... [more]
sp|Q09530|MOG5_CAEEL3.282e-13741.57Probable pre-mRNA-splicing factor ATP-dependent RN... [more]
sp|O42643|PRP22_SCHPO4.872e-13642.46Pre-mRNA-splicing factor ATP-dependent RNA helicas... [more]
back to top
BLAST of SMED30022829 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D5JG690.000e+066.23DEAH box polypeptide 8-like protein B (Fragment) O... [more]
A0A4W4FHJ15.573e-14642.51Uncharacterized protein OS=Electrophorus electricu... [more]
A0A4W4FHZ85.899e-14642.43Uncharacterized protein OS=Electrophorus electricu... [more]
F6XRY48.928e-14642.26Ribosomal protein S15a OS=Xenopus tropicalis OX=83... [more]
A0A091E8493.344e-14542.09ATP-dependent RNA helicase DHX8 (Fragment) OS=Corv... [more]
back to top
BLAST of SMED30022829 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhx82.070e-14142.16DEAH-box helicase 8 [Source:NCBI gene;Acc:10303579... [more]
dhx88.836e-14142.16DEAH-box helicase 8 [Source:NCBI gene;Acc:10303579... [more]
dhx168.771e-12639.58DEAH-box helicase 16 [Source:NCBI gene;Acc:1030400... [more]
dhx161.115e-12539.58DEAH-box helicase 16 [Source:NCBI gene;Acc:1030400... [more]
dhx163.126e-12539.58DEAH-box helicase 16 [Source:NCBI gene;Acc:1030400... [more]
back to top
BLAST of SMED30022829 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhx85.102e-14541.11DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:Z... [more]
dhx342.380e-8134.23DEAH (Asp-Glu-Ala-His) box polypeptide 34 [Source:... [more]
zgc:1588284.047e-7433.96DEAH-box helicase 35 [Source:HGNC Symbol;Acc:HGNC:... [more]
dhx332.643e-6337.70DEAH (Asp-Glu-Ala-His) box polypeptide 33 [Source:... [more]
dqx11.278e-5630.54DEAQ box RNA-dependent ATPase 1 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of SMED30022829 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PRP224.822e-13141.58DEAH-box RNA-dependent ATPase/ATP-dependent RNA he... [more]
PRP433.236e-12538.77RNA helicase in the DEAH-box family; functions in ... [more]
PRP162.715e-11037.56DEAH-box RNA helicase involved in second catalytic... [more]
PRP25.230e-10638.76RNA-dependent DExD/H-box ATPase; required for acti... [more]
DHR25.803e-10235.80Predominantly nucleolar DEAH-box ATP-dependent RNA... [more]
back to top
BLAST of SMED30022829 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO325312.488e-11637.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458615.111e-10439.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495609.353e-9637.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO326293.517e-9035.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356221.390e-8547.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30022829 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhx83.520e-14041.99DEAH-box helicase 8 [Source:NCBI gene;Acc:10116232... [more]
dhx161.376e-12339.38DEAH-box helicase 16 [Source:NCBI gene;Acc:1011688... [more]
zgc:1588283.487e-12238.45DEAH-box helicase 35 [Source:NCBI gene;Acc:1011612... [more]
dhx155.446e-12136.92pre-mRNA-splicing factor ATP-dependent RNA helicas... [more]
dhx151.043e-12036.92pre-mRNA-splicing factor ATP-dependent RNA helicas... [more]
back to top
BLAST of SMED30022829 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038834.10.000e+099.65SMESG000038834.1[more]
SMESG000038834.10.000e+096.83SMESG000038834.1[more]
SMESG000038860.10.000e+051.07SMESG000038860.1[more]
SMESG000038861.11.939e-17246.82SMESG000038861.1[more]
SMESG000038864.11.177e-15945.07SMESG000038864.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022829 ID=SMED30022829|Name=SMED30022829|organism=Schmidtea mediterranea sexual|type=transcript|length=4654bp
ATTCCAGACATGGATCAACTATTTGAGCAGTTTGGAAATAGAATTTCAAT
TTAGGAAATGAACAGAACATTGTAATGCAGATGCATTGTCGAGAAGTGAA
TATATGACGTGTGTTCAATGCCAAACCATTCACGCTAATCCAAAAATAGA
AAGCTAAAAACGAAACTTTTGGCAATAATGACAGAAAATCCTGAACAAGA
ATGGCAAATGGATTCAGAAGAAATTAAAGAAATAATAAAAAACGCTAAAT
AAAAGAAAGACAGTAAATTCAGAATAAATGAGGGAATAGTGATGACAGAA
AACAATAGAATATGGATTCCGGATGGAAAAAGAATTGAATTCATTCATAA
ATATCATAAAAAACCGTGTCATGCTGGATCAATGAAAACGTGTGAAAATT
GTCAAAAGAGGAAAGTTACAACGACAAGAACTAAAGAAAAGGCGCTGGAA
ATGCCCGAAGCAGATTTATTCGAATCAATATTTGTAGGTTTTTGTGGCCC
ATTAAAGCAAACTCAGTATGGAATGAAATATATAATTGGTATCATTGATA
GTTATAGCAAATAGTAAAGTTTATTTTATCACTAAACCTAGCGGCACCTG
TGAAAAGTAGATTCAGTTATATTTATTATGATGCTTGATTAAGTCAATAA
CAATTTTTCCAGGCAAATTATTTAGTGAAACATTTGGTTATGTAATATTT
TGAGAAGCACCTCCCGCCCCCACTATAACAAATTGAAACTAATTTTCAAT
CCCCCTCCGTAGGACCGTGACGTAATTTGTGAACAGCTCCCTACCAAATA
AACCCGTATGTTCAGTTAAATAGTCGTCCAAGAAAAGTCAATGTGTTTAG
ATGTTTAAAACAAAGCGAACTCACCCATTTTGACGGTAAATTAAAATAGA
AGAATTGTATATTAAATTTATTTCAAAGAATCACGAAATTGGATTATATG
AAAAGATCGAGGTTTATGTTATTGAATCCCAGTTTAGTAAGCCCCCCCCA
ACACTGTATGTATTAAAAAAATATATTAATTGGTAATGCAATGTGTCCAA
TACTGATATAGTAAAACCTCATAAAAATCAAATAAATCATTCTTACAAAT
TTGGCTTTGATTTATATAAACAACTGCTCGTATGCAGATGCACAATTTTC
TTTCTATAAACATTGAAATATTTTTCTGAAGATTCATGCCTGGAAACATT
TTTAAAAAACCCGCTTAATATTGCTTTCTGAATTGGATCTTGACAAAGAT
TGGGCGGCAAATAATTGACAGACAGATCATTCCGTTTCAATACACCGATC
AGTTGATGTCGAATTCTAGAAATTTCCTCAATGGTCTCTACGTCAATACA
GTTTTCCAAACACCAATCAGCCGACTTGCCATTAATTTTCCAACTATTGT
AAATATTCAAAAAAGTAAAATAATCACCGGCTTCGTCAGAAAACTCCGAC
TTTATCGAAAATACTCTTTTTCTAAATTCTTTCGAACTCATGAATAATTT
CTTTTCCAATACCATTGCAAACATTGTGGCCAGATTTAATGAGCATCCAT
ACTTGGAAGATGCATACAAAACCTTGCCGATCGCGGGTTCAACAGGAAAA
CTATTTACAATTTTACCTAAATCTGTTATTTTGTTGTATTTATCCAAACA
ACCGAGATCTCTCAGTTCTTCGGCGCATTTCAATAAAACAGGCATGGAAG
GAGCGTCAAGATAATGGAAGTTAAATGGATCGATATCCATCGCGGTCAAC
TTTAAAAAGATGTGACATAAATCTTTTAGAAAAATTTCCGGTTCAATTTC
CTTTTCAAAAGACTCAAACTCGTCTTTCGTGTATAACCGATAACACCAAC
CACTGCTCGTTCGGCCCGTTCGGCCTTTTCTCTGATTGGCTTGTGATTGA
GATATTCGAACTGTTTCTAAAACGTGAACGTTATCCTCCAAATTAAAATG
ACTTTTTTTAACGTAGCCACTATCAATTACAAATTTTATCCCGTCAATGG
TTATGCTTGTCTCAGCAATGTTTGTAGCGACAACGACTTTTCTTTCATTT
TTCTCAACTGGTTTAAACACTTTTTGTTGAGATTCATAATCAATGGCTCC
ATATAATGGAAATACAACTAGATTTTTAATATCGGCAAGCGAAGCGCAAC
AGTTTTCAATGTCTTCTTCGCCGGTTAAAAATACAAGGATATCTCCAGAT
TCTTTATTTAAATGAATTTCGTTTACAACTTCTTTGAGTACTCCAGTAAG
ACAATCTATCGAATCAATTGGCTTATAAATTTCAAGAATTGGAAAAACTT
TGCCTTCAATCCACAATACGGGTACGATGTTGAAATAATTGGAAAACCTT
TCACAATCAATTGTAGCTGACGTTATAATGACTCTCAAATCGGGTCTTTT
TTCAACTAATAGTTTCAAGATACCAAGAGTAACATCTGTGGAAACCGATC
TCTCATGAGCCTCGTCAACAATGATTACTCCATAATTGCTCAATTTCGGA
TCAATTACGCAGTAATTCAATAGAATTCCATCAGTTAAAAAGTTGATTTT
GGTGATCTCACTGGATTGCTTATCAAATCTAATTTCATATCCGACTTCGG
CACCTAATTCACAGTGCATTTCTTCAGCAACTCGCTTAGCCATGTTGATG
GCAGCTATTCGTCTGGGCTGAGTTATACCGATCATCTTGCCATCATTTAT
TCCAGCCTCTAGAATGTATTGAGGAATTTGTGTGGTCTTACCAGACCCGG
TCTCTCCGACAATAACAATGATCGGATTATTTCTCACTGCCTGAAATTCA
GTAAAATTTATTCAATGAGCAAATAATTTAACTTACTAAATAGTATTAGG
TTGGTAAATAAGGAATGTCGTTTTCTGTATAGTTTTCTGTATAGCTTCAT
TATTATATGTCATATTGTATATCAATTTATATCTTGAATCAAGCTCAGTA
ATTTGATAACAATTTTTTATGTTTATATTGGTATTGCTGATATTATTTAA
GGTAATTAATCAATGATGAAAAGTAACGAAATCCGATCAATTTACATTTG
TGAATATAAAAGAGGTCTGAATGCATAAGATACAGCTTGCAATATGAACG
AGGCATTTTGCCCAATAGAACTAACGAACGTAGAGTTCAACGATGGTTCA
CACGGCTTAGAAATGGAAAGGAAAGCCTTGAAGATGAAGTGCATGATAAC
CGATGATCAGTCCTTAACAACTACAAATTATAGGTATTAGTTGAAGCCGA
TCTACGTACAACATTCAGAGAGCTTGCTAAAGAATAGGCTATAACATATC
CAACAGTTCTGGAAAATCTCAAAGCAATAGGAAAATCGAAAAAAACTAGA
AAAGTGGGTCCTGCACAAATTGCAAGAAAACAAACAAATTACCATTATAA
AATGCCGACGGCGCTGCTTATTCGTAACAGAAGCAAACCGTTTCTCAACC
CCATAACGTGTGATGAGAAATTGATCCTGTACGATAACCGTCAACGATCG
GTTCAGGGGTTGAATTCAAATGAAGCACCGAAACATTTTGCAAAACAGAA
ATTGCATCAAAAAAATAATGTTGACTGTTTGGTAGTCACAAGTCGGTCTG
ATTCATCACAGTTTCTTGAAATCGGGCAAGACAAATACGGCGGAGATATA
CGTGAAATCGATGAAATGCATAATAAACTGTTTTACCAAAAAAAATGCTG
CCTAATAAAAATACCAAAAATTTTATATATATATATATTAAATAAGTAGG
TCACAACTATATTGTTCAATAAATAAGTAGTTCAATTAGTTAATTCCCAT
GTTCAGGGTATTGTATAAAAATAAATGACATTGATAATTTAAGTAATAAT
AATTAAACCTAAGATATATAATTAAATAATTAAATCACTAATTCCAATTA
TACTTAATTTCAATATTTAAACAATGTATCATAATTAACTAAAACTTTCA
TTCATATATATATCACATTCCCCTTGTAAGAATCATCACTAAACAGGGTT
ATAGTTCATTGTGGATTGGATAAGATATATCGTGTTCTAGTCCGTACACT
TGTGTCATGTCTTCTAACCAGATGTGCAAACCAAAATAAAATTCAAGATG
GTTCGATTTTGGTTCGACGATAATTTTTTCTCGAAATGGTTTGGTTTTGG
TTTTACACTTGGTTCAAAATTTTGGTTTTGGTGTGGTTTAAAAAAGAGTC
TTGGAAAATTGTCTCGTTTTTGCAATCACTTTTAAAATATTGAAATATTT
TATCTTTTTCTCCAATGCTTCAACTTTCTTCCTCTGTCACTGTACATAAT
ACCTTCTTATGATTTGTTTCAGATCTTGAGCATGATTCATTGTACAATTT
TATATTACGCTTCTTTTTGGGTTCTTTGTACATTAACGGACATTGCTCAC
ATTTGGAAGTCTTGACAATGCATCAGCGTTTAAATGTTTTCTCCCATTCG
GTATTGAATTTCTATATCGTAAACTTTTATCAAACCTAAATTTTGATACC
AATCTTTTTTTACAATTGGTATATAGATCTTTTTAAACTAATTAAATTAA
TTGGTCTTCAATGAGATTCAAGCTTAATTTCTATAAGAAAAAAATGATTT
TAGTTCTCAACCCAATAATTATTAATATCTGTTTTAATAACAATTTAAAC
AAAA
back to top

protein sequence of SMED30022829-orf-1

>SMED30022829-orf-1 ID=SMED30022829-orf-1|Name=SMED30022829-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=531bp
MIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFL
TDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDL
RVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKPIDSIDCLTGVL
KEVVNEIHLNKESGDILVFLTGEEDIENCCASLADIKNLVVFPLYGAIDY
ESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLE
DNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDEFESFEKEIEPE
IFLKDLCHIFLKLTAMDIDPFNFHYLDAPSMPVLLKCAEELRDLGCLDKY
NKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMS
SKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVE
TIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRH
ESSEKYFNVYRKKIVHLHTSSCLYKSKPNL*
back to top

protein sequence of SMED30022829-orf-2

>SMED30022829-orf-2 ID=SMED30022829-orf-2|Name=SMED30022829-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=116bp
MPTALLIRNRSKPFLNPITCDEKLILYDNRQRSVQGLNSNEAPKHFAKQK
LHQKNNVDCLVVTSRSDSSQFLEIGQDKYGGDIREIDEMHNKLFYQKKCC
LIKIPKILYIYILNK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001650Helicase_C
IPR014001Helicase_ATP-bd
IPR007502Helicase-assoc_dom
IPR027417P-loop_NTPase
IPR011709DUF1605
IPR011545DEAD/DEAH_box_helicase_dom
IPR002464DNA/RNA_helicase_DEAH_CS
Vocabulary: molecular function
TermDefinition
GO:0004386helicase activity
GO:0003676nucleic acid binding
GO:0005524ATP binding
GO:0008026ATP-dependent helicase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 177..277
e-value: 1.9E-15
score: 67.3
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 152..276
e-value: 4.8E-16
score: 59.1
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 149..317
score: 16.136
IPR007502Helicase-associated domainSMARTSM00847ha2_5coord: 336..426
e-value: 5.8E-10
score: 49.1
IPR007502Helicase-associated domainPFAMPF04408HA2coord: 339..405
e-value: 2.8E-12
score: 46.9
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 130..296
e-value: 4.2E-56
score: 191.3
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1..129
e-value: 1.1E-54
score: 187.0
NoneNo IPR availableGENE3DG3DSA:1.20.120.1080coord: 319..417
e-value: 6.2E-14
score: 53.6
NoneNo IPR availablePANTHERPTHR18934ATP-DEPENDENT RNA HELICASEcoord: 1..529
NoneNo IPR availablePANTHERPTHR18934:SF85ATP-DEPENDENT RNA HELICASE DHX8coord: 1..529
NoneNo IPR availableCDDcd18791SF2_C_RHAcoord: 152..285
e-value: 7.1571E-64
score: 203.919
NoneNo IPR availableCDDcd17917DEXHc_RHA-likecoord: 1..124
e-value: 2.24285E-65
score: 207.316
IPR002464DNA/RNA helicase, ATP-dependent, DEAH-box type, conserved sitePROSITEPS00690DEAH_ATP_HELICASEcoord: 69..78
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 1..127
score: 14.797
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 5..446