Dual specificity phosphatase-like protein

Overview
NameDual specificity phosphatase-like protein
Smed IDSMED30022824
Length (bp)1313
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dual specificity phosphatase-like protein (SMED30022824) t-SNE clustered cells

Violin plots show distribution of expression levels for Dual specificity phosphatase-like protein (SMED30022824) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dual specificity phosphatase-like protein (SMED30022824) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dual specificity phosphatase-like protein (SMED30022824) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022824

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30022824SMESG000047740.1 SmedASXL_006454SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30022824SMESG000047740.1 dd_Smed_v4_12651_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30022824SMESG000047740.1 dd_Smed_v6_12651_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30022824SMESG000047740.1 OX_Smed_1.0.09194ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Human
Match: DUSP14 (dual specificity phosphatase 14 [Source:HGNC Symbol;Acc:HGNC:17007])

HSP 1 Score: 108.997 bits (271), Expect = 3.395e-27
Identity = 59/155 (38.06%), Postives = 90/155 (58.06%), Query Frame = 3
Query:  489 QNMISFKSICQLDINDASKIIDNLYLS-GLKAVTLDKLRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            + +++ + I + DI   ++I  +L+L  G  A     L+   IT IV+   E         E V++ + D   + IG +F ++ +KIH      G  LVHC AG+SRSAT+ IAYLM++H   L +AY +VK+RR  I+PN GFW+QLI +E Q+
Sbjct:   11 RTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQL 165          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Human
Match: DUSP14 (dual specificity phosphatase 14 [Source:HGNC Symbol;Acc:HGNC:17007])

HSP 1 Score: 108.997 bits (271), Expect = 3.395e-27
Identity = 59/155 (38.06%), Postives = 90/155 (58.06%), Query Frame = 3
Query:  489 QNMISFKSICQLDINDASKIIDNLYLS-GLKAVTLDKLRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            + +++ + I + DI   ++I  +L+L  G  A     L+   IT IV+   E         E V++ + D   + IG +F ++ +KIH      G  LVHC AG+SRSAT+ IAYLM++H   L +AY +VK+RR  I+PN GFW+QLI +E Q+
Sbjct:   11 RTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQL 165          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Human
Match: DUSP14 (dual specificity phosphatase 14 [Source:HGNC Symbol;Acc:HGNC:17007])

HSP 1 Score: 108.997 bits (271), Expect = 3.395e-27
Identity = 59/155 (38.06%), Postives = 90/155 (58.06%), Query Frame = 3
Query:  489 QNMISFKSICQLDINDASKIIDNLYLS-GLKAVTLDKLRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            + +++ + I + DI   ++I  +L+L  G  A     L+   IT IV+   E         E V++ + D   + IG +F ++ +KIH      G  LVHC AG+SRSAT+ IAYLM++H   L +AY +VK+RR  I+PN GFW+QLI +E Q+
Sbjct:   11 RTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQL 165          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Human
Match: DUSP14 (dual specificity phosphatase 14 [Source:HGNC Symbol;Acc:HGNC:17007])

HSP 1 Score: 108.997 bits (271), Expect = 3.395e-27
Identity = 59/155 (38.06%), Postives = 90/155 (58.06%), Query Frame = 3
Query:  489 QNMISFKSICQLDINDASKIIDNLYLS-GLKAVTLDKLRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            + +++ + I + DI   ++I  +L+L  G  A     L+   IT IV+   E         E V++ + D   + IG +F ++ +KIH      G  LVHC AG+SRSAT+ IAYLM++H   L +AY +VK+RR  I+PN GFW+QLI +E Q+
Sbjct:   11 RTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQL 165          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Human
Match: DUSP14 (dual specificity phosphatase 14 [Source:HGNC Symbol;Acc:HGNC:17007])

HSP 1 Score: 108.997 bits (271), Expect = 3.395e-27
Identity = 59/155 (38.06%), Postives = 90/155 (58.06%), Query Frame = 3
Query:  489 QNMISFKSICQLDINDASKIIDNLYLS-GLKAVTLDKLRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            + +++ + I + DI   ++I  +L+L  G  A     L+   IT IV+   E         E V++ + D   + IG +F ++ +KIH      G  LVHC AG+SRSAT+ IAYLM++H   L +AY +VK+RR  I+PN GFW+QLI +E Q+
Sbjct:   11 RTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQL 165          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Celegans
Match: C04F12.8 (pep chromosome:WBcel235:I:9697237:9699561:-1 gene:WBGene00007302.1 transcript:C04F12.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C04F12.8)

HSP 1 Score: 111.309 bits (277), Expect = 1.104e-27
Identity = 50/141 (35.46%), Postives = 86/141 (60.99%), Query Frame = 3
Query:  528 INDASKIIDNLYLSGLKAVTLDKLRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            +   S+I D+LYLSG   +  DK++   I MIV+   E       G++ +++ I+D   + +  HF  + +KI       G+ LVHC+AG+SRSA++V+ YL+++   +L  AY +VK+ R  I+PN GFW+Q++ +E ++
Sbjct:    8 LGQMSEINDHLYLSGAGVLKPDKIKQRKINMIVNATTEEPSTYMQGVDTMKIRIEDHPYARLSEHFDVVADKIRNVKERGGKTLVHCMAGVSRSASLVMIYLVKHEHMTLRQAYHYVKAARPIIRPNVGFWKQMVDYEKRL 148          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Celegans
Match: F26A3.4 (pep chromosome:WBcel235:I:7656978:7658291:-1 gene:WBGene00009142.1 transcript:F26A3.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F26A3.4)

HSP 1 Score: 105.145 bits (261), Expect = 6.020e-26
Identity = 51/140 (36.43%), Postives = 91/140 (65.00%), Query Frame = 3
Query:  540 SKIIDNLYLSGLKAVTLDKLRHLSITMIVSVLREGSPVRASG-IECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQINE 956
            S+I+  L++ G+ A++ D+++   IT I++   E   +R+ G I+  +L ++D   + I  H     ++I   I++ G+ LVHC+AG+SRSA+I +A+L++Y   +L +AY  +KS+RS ++PN GFW+QLI +E  + E
Sbjct:   15 SEIVPGLFICGVSALSKDEMKKHKITHIINATTEVPNLRSLGDIQRTKLWLEDTPQTYIYPHLELQSDQIQALIADGGKVLVHCVAGVSRSASICLAFLLKYRCRNLREAYHLMKSKRSMVRPNLGFWRQLIAYEQNVKE 154          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Celegans
Match: ZK757.2 (pep chromosome:WBcel235:III:9874142:9877476:-1 gene:WBGene00014074.1 transcript:ZK757.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK757.2)

HSP 1 Score: 89.7373 bits (221), Expect = 7.590e-20
Identity = 51/139 (36.69%), Postives = 81/139 (58.27%), Query Frame = 3
Query:  537 ASKIIDNLYLSGLKAVTLDKLRHLSITM-IVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
             S+I   LY+SGL A++   L    + + ++   R  +P     ++ V L + D ET+D+  H+ ++ ++I +     GRAL+ C  GISRSAT  IAY+M+Y   +L D+Y  V+  R+ I PN GF+QQLI  E ++
Sbjct:   14 CSQIRPYLYVSGLAALSPRVLSRFCVCINLIPGFRLSAP---PHMKVVHLPLQDNETTDLSPHWANVYKEIEEARKGAGRALLLCAMGISRSATFGIAYVMQYEKKTLHDSYKAVQLARNIICPNVGFFQQLIDLEQKL 149          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Celegans
Match: F13D11.3 (pep chromosome:WBcel235:X:5804379:5805922:-1 gene:WBGene00017428.1 transcript:F13D11.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F13D11.3)

HSP 1 Score: 83.1889 bits (204), Expect = 1.583e-18
Identity = 46/139 (33.09%), Postives = 76/139 (54.68%), Query Frame = 3
Query:  540 SKIIDNLYLSGLKAVTLDKLRHLSITMIVSVLR-EGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQIN 953
            +++  +L+L+G   +T   L+  +IT  V     +  P++  G++ +E+ +DD   + I  +F  +++ I          +++C AG+SRSAT+ I YLM     SL +AY  V   R  I PN GFW+Q+I FE Q N
Sbjct:   12 TQVRPHLFLAGYGCITPSLLKQYNITHGVDCTNLKTKPIK--GLDRIEVPVDDNTLAKITQYFEPVVKYIEDAKQQGHNTVIYCAAGVSRSATLTIVYLMVTENLSLEEAYLQVNQVRPIISPNIGFWRQMIDFEKQRN 148          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Celegans
Match: lip-1 (Dual specificity protein phosphatase lip-1 [Source:UniProtKB/Swiss-Prot;Acc:V6CIV8])

HSP 1 Score: 76.2554 bits (186), Expect = 6.820e-15
Identity = 51/151 (33.77%), Postives = 76/151 (50.33%), Query Frame = 3
Query:  543 KIIDNLYLSGLK-AVTLDKLRHLSITMIVSVLR------EGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQINEPLNKNK 974
            K+ + LYL   + A   D L+  SI+ +++V        E  P     +  + +S DD  + ++   FP  +  I     ND   LVHC+AGISRS TI +AYLM+    +L  AY +V+ R + I PN  F  QL  +E  +   LN N+
Sbjct:  187 KLTNFLYLGNAETAKNRDVLKKYSISHVINVTSNLPNTFEEDP----NMRYLRISADDNASHNLTKFFPEAISFIDDARRNDSACLVHCLAGISRSVTICLAYLMKTEMCTLDSAYEWVQKRNASIAPNFHFMGQLTDYEKMLG--LNSNR 331          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Fly
Match: Mkp (gene:FBgn0083992 transcript:FBtr0110976)

HSP 1 Score: 87.8113 bits (216), Expect = 7.234e-20
Identity = 54/137 (39.42%), Postives = 73/137 (53.28%), Query Frame = 3
Query:  537 ASKIIDNLYLSGLKAVTLDKLRHLSITMIVSV------LREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQL 929
            A  + D LYL    AV+ D +    IT I+SV      +    PV  + + C++L     ET+ + +  P+ +E I     + G  LVHC AG+SRS ++VI YLM+       DAY  VKS R CIQPN GF QQL
Sbjct:   67 ACILSDFLYLGSQDAVSADNIIKYKITHILSVGIQTPEVEWPLPVNCTFLPCLDLP----ETNLMNYILPASMEFIEDAHRSQGCVLVHCNAGVSRSPSVVIGYLMQRRDMCYEDAYNLVKSWRPCIQPNAGFIQQL 199          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Fly
Match: Mkp (gene:FBgn0083992 transcript:FBtr0344094)

HSP 1 Score: 87.8113 bits (216), Expect = 7.234e-20
Identity = 54/137 (39.42%), Postives = 73/137 (53.28%), Query Frame = 3
Query:  537 ASKIIDNLYLSGLKAVTLDKLRHLSITMIVSV------LREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQL 929
            A  + D LYL    AV+ D +    IT I+SV      +    PV  + + C++L     ET+ + +  P+ +E I     + G  LVHC AG+SRS ++VI YLM+       DAY  VKS R CIQPN GF QQL
Sbjct:   67 ACILSDFLYLGSQDAVSADNIIKYKITHILSVGIQTPEVEWPLPVNCTFLPCLDLP----ETNLMNYILPASMEFIEDAHRSQGCVLVHCNAGVSRSPSVVIGYLMQRRDMCYEDAYNLVKSWRPCIQPNAGFIQQL 199          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Fly
Match: Mkp (gene:FBgn0083992 transcript:FBtr0110977)

HSP 1 Score: 87.8113 bits (216), Expect = 7.234e-20
Identity = 54/137 (39.42%), Postives = 73/137 (53.28%), Query Frame = 3
Query:  537 ASKIIDNLYLSGLKAVTLDKLRHLSITMIVSV------LREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQL 929
            A  + D LYL    AV+ D +    IT I+SV      +    PV  + + C++L     ET+ + +  P+ +E I     + G  LVHC AG+SRS ++VI YLM+       DAY  VKS R CIQPN GF QQL
Sbjct:   67 ACILSDFLYLGSQDAVSADNIIKYKITHILSVGIQTPEVEWPLPVNCTFLPCLDLP----ETNLMNYILPASMEFIEDAHRSQGCVLVHCNAGVSRSPSVVIGYLMQRRDMCYEDAYNLVKSWRPCIQPNAGFIQQL 199          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Fly
Match: Mkp (gene:FBgn0083992 transcript:FBtr0344024)

HSP 1 Score: 87.8113 bits (216), Expect = 7.234e-20
Identity = 54/137 (39.42%), Postives = 73/137 (53.28%), Query Frame = 3
Query:  537 ASKIIDNLYLSGLKAVTLDKLRHLSITMIVSV------LREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQL 929
            A  + D LYL    AV+ D +    IT I+SV      +    PV  + + C++L     ET+ + +  P+ +E I     + G  LVHC AG+SRS ++VI YLM+       DAY  VKS R CIQPN GF QQL
Sbjct:   67 ACILSDFLYLGSQDAVSADNIIKYKITHILSVGIQTPEVEWPLPVNCTFLPCLDLP----ETNLMNYILPASMEFIEDAHRSQGCVLVHCNAGVSRSPSVVIGYLMQRRDMCYEDAYNLVKSWRPCIQPNAGFIQQL 199          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Fly
Match: Mkp3 (gene:FBgn0036844 transcript:FBtr0075036)

HSP 1 Score: 88.9669 bits (219), Expect = 8.118e-20
Identity = 42/106 (39.62%), Postives = 64/106 (60.38%), Query Frame = 3
Query:  666 IECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQINEPLNKNKKFS 983
            I+ +++ I D  + D+  HFP  ++ I +  S     LVHC+AG+SRS T+ +AYLM   G SL+DA+  V+ R+  + PN  F QQL+ FE+Q+   L    +FS
Sbjct:   92 IKYLQIPITDHYSQDLAIHFPDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKPDVSPNFHFMQQLLSFESQLR--LRPGSRFS 195          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Zebrafish
Match: dusp14 (dual specificity phosphatase 14 [Source:ZFIN;Acc:ZDB-GENE-041010-162])

HSP 1 Score: 101.293 bits (251), Expect = 2.611e-24
Identity = 44/95 (46.32%), Postives = 67/95 (70.53%), Query Frame = 3
Query:  666 IECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            +E V++ + D   S I  +F S+ +KIH      G  LVHC AG+SRSA++ +AYLM+YH  SL++A+ +VK+RR  I+PN GFW+QLI++E ++
Sbjct:   94 MEYVKVPLADMPHSPISLYFDSVADKIHSVGRKRGAVLVHCAAGVSRSASLCLAYLMKYHRVSLAEAHAWVKARRPVIRPNGGFWRQLIEYERKL 188          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Zebrafish
Match: dusp14 (dual specificity phosphatase 14 [Source:ZFIN;Acc:ZDB-GENE-041010-162])

HSP 1 Score: 101.293 bits (251), Expect = 2.611e-24
Identity = 44/95 (46.32%), Postives = 67/95 (70.53%), Query Frame = 3
Query:  666 IECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            +E V++ + D   S I  +F S+ +KIH      G  LVHC AG+SRSA++ +AYLM+YH  SL++A+ +VK+RR  I+PN GFW+QLI++E ++
Sbjct:   94 MEYVKVPLADMPHSPISLYFDSVADKIHSVGRKRGAVLVHCAAGVSRSASLCLAYLMKYHRVSLAEAHAWVKARRPVIRPNGGFWRQLIEYERKL 188          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Zebrafish
Match: si:ch1073-184j22.2 (si:ch1073-184j22.2 [Source:ZFIN;Acc:ZDB-GENE-081104-32])

HSP 1 Score: 97.0561 bits (240), Expect = 4.050e-23
Identity = 54/139 (38.85%), Postives = 81/139 (58.27%), Query Frame = 3
Query:  540 SKIIDNLYLSGLKAVTLDKLR-HLSITMIVSV-LREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            S+I   L+LSG  A     L     IT+IV+V L    PV   G+EC+ +++ D   + +G HF  +  +IH   +  G  LVHC AG+SRS  +++AYLM+Y G +L  A+ +VK  R  I+ N GFW QL+ +E ++
Sbjct:    4 SQITPTLFLSGADASMNQALMTRKGITLIVNVTLSHTCPV-YPGVECIRVAVSDLPNARLGDHFDHVSARIHN--NRPGGTLVHCAAGMSRSPAVIMAYLMKYKGVTLRQAHKWVKDSRPYIRLNVGFWTQLLDYERKL 139          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Zebrafish
Match: si:ch1073-184j22.2 (si:ch1073-184j22.2 [Source:ZFIN;Acc:ZDB-GENE-081104-32])

HSP 1 Score: 95.5153 bits (236), Expect = 1.444e-22
Identity = 53/138 (38.41%), Postives = 80/138 (57.97%), Query Frame = 3
Query:  543 KIIDNLYLSGLKAVTLDKLR-HLSITMIVSV-LREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            +I   L+LSG  A     L     IT+IV+V L    PV   G+EC+ +++ D   + +G HF  +  +IH   +  G  LVHC AG+SRS  +++AYLM+Y G +L  A+ +VK  R  I+ N GFW QL+ +E ++
Sbjct:   11 QITPTLFLSGADASMNQALMTRKGITLIVNVTLSHTCPV-YPGVECIRVAVSDLPNARLGDHFDHVSARIHN--NRPGGTLVHCAAGMSRSPAVIMAYLMKYKGVTLRQAHKWVKDSRPYIRLNVGFWTQLLDYERKL 145          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Zebrafish
Match: dusp28 (dual specificity phosphatase 28 [Source:ZFIN;Acc:ZDB-GENE-131127-257])

HSP 1 Score: 90.1225 bits (222), Expect = 4.792e-21
Identity = 44/138 (31.88%), Postives = 80/138 (57.97%), Query Frame = 3
Query:  540 SKIIDNLYLSGLK-AVTLDKLRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            S + D L +S  + A   D ++  ++T+ ++V ++  P  ++ +  + + + D    D+  +F    + I       GR +V+C  G SRSAT+ +AYLM++   +L+DA+  VKS RS ++PNPGFW QL ++E ++
Sbjct:    5 SAVTDCLLISNARSACNNDLIQKEAVTLCINVSKQ-QPFPSARVSTLRVPVYDDPNEDLYRYFDRCADAIASEAGRGGRTVVYCKNGRSRSATVCVAYLMKHQSLTLTDAFQVVKSARSVVEPNPGFWSQLERYEQEL 141          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Xenopus
Match: dusp14 (dual specificity phosphatase 14 [Source:NCBI gene;Acc:779639])

HSP 1 Score: 111.309 bits (277), Expect = 6.006e-28
Identity = 50/121 (41.32%), Postives = 81/121 (66.94%), Query Frame = 3
Query:  600 RHL----SITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            RHL    ++T IV+   E        ++ +++ + D   + +  +F ++ ++IHQ+   +GR LVHC+AG+SRSAT+ IAYLM+YH  +L DAY +VK+RR  ++PN GFWQQLI++E ++
Sbjct:   58 RHLVYSRNVTCIVNATLEIPNSNWPDVDYIKVPVPDLPHAPLALYFDTVADRIHQNGKRNGRTLVHCVAGVSRSATLCIAYLMKYHRLALLDAYQWVKTRRPVVRPNMGFWQQLIQYEKKL 178          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Xenopus
Match: ENSXETT00000005765.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:1:157865320:157866044:-1 gene:ENSXETG00000003110.1 transcript:ENSXETT00000005765.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.9669 bits (219), Expect = 5.033e-20
Identity = 53/138 (38.41%), Postives = 78/138 (56.52%), Query Frame = 3
Query:  546 IIDNLYLSGLKAV---TLDKLRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            I + LYL+  KA    TL  L    IT +++V  E     +  +E V + + D   + +  +F  I +KIH    + G  L+HC+AGISRS T+ +AYLM+YH  SL  A+  VK  R  I+PN GFW+QL+ +E  +
Sbjct:   28 ISEGLYLASAKAARNRTL--LATHCITCVINVSLEIDKNESPELEYVHIPVPDTPDTCLLQYFDDIADKIHNIKVSGGSTLLHCVAGISRSPTLCLAYLMKYHSLSLLAAHARVKMCRPIIRPNLGFWKQLMSYEMTL 163          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Xenopus
Match: SSH1 (slingshot protein phosphatase 1 [Source:NCBI gene;Acc:100495893])

HSP 1 Score: 93.5893 bits (231), Expect = 7.114e-20
Identity = 52/145 (35.86%), Postives = 83/145 (57.24%), Query Frame = 3
Query:  528 INDASKIIDNLYL-SGLKAVTLDKLRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQINEP 959
            ++ AS I D++YL S   A  L++L    +  I++V RE             + + D+ET+D+  H+      I +   N  + LVHC  G+SRSA+ VIAY M+ +G+S+  AY FVK +RS  +PN GF +QL+++E  ++ P
Sbjct:  294 MDKASLIFDHVYLGSEWNASNLEELHSTGVGYILNVTREIDNFFPGMFAYHNIRVYDEETTDLLSHWNDAYHFITKAKKNKSKCLVHCKMGVSRSASTVIAYAMKENGWSMEKAYNFVKQKRSVTRPNAGFMRQLLEYEGILDSP 438          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Xenopus
Match: SSH1 (slingshot protein phosphatase 1 [Source:NCBI gene;Acc:100495893])

HSP 1 Score: 93.2041 bits (230), Expect = 1.471e-19
Identity = 52/152 (34.21%), Postives = 85/152 (55.92%), Query Frame = 3
Query:  528 INDASKIIDNLYL-SGLKAVTLDKLRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQINEPLNKNKKF 980
            ++ AS I D++YL S   A  L++L    +  I++V RE             + + D+ET+D+  H+      I +   N  + LVHC  G+SRSA+ VIAY M+ +G+S+  AY FVK +RS  +PN GF +QL+++E  ++    ++ K 
Sbjct:  294 MDKASLIFDHVYLGSEWNASNLEELHSTGVGYILNVTREIDNFFPGMFAYHNIRVYDEETTDLLSHWNDAYHFITKAKKNKSKCLVHCKMGVSRSASTVIAYAMKENGWSMEKAYNFVKQKRSVTRPNAGFMRQLLEYEGILDASKQRHNKL 445          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Xenopus
Match: SSH1 (slingshot protein phosphatase 1 [Source:NCBI gene;Acc:100495893])

HSP 1 Score: 93.2041 bits (230), Expect = 1.522e-19
Identity = 52/152 (34.21%), Postives = 85/152 (55.92%), Query Frame = 3
Query:  528 INDASKIIDNLYL-SGLKAVTLDKLRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQINEPLNKNKKF 980
            ++ AS I D++YL S   A  L++L    +  I++V RE             + + D+ET+D+  H+      I +   N  + LVHC  G+SRSA+ VIAY M+ +G+S+  AY FVK +RS  +PN GF +QL+++E  ++    ++ K 
Sbjct:  304 MDKASLIFDHVYLGSEWNASNLEELHSTGVGYILNVTREIDNFFPGMFAYHNIRVYDEETTDLLSHWNDAYHFITKAKKNKSKCLVHCKMGVSRSASTVIAYAMKENGWSMEKAYNFVKQKRSVTRPNAGFMRQLLEYEGILDASKQRHNKL 455          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Mouse
Match: Dusp18 (dual specificity phosphatase 18 [Source:MGI Symbol;Acc:MGI:1922469])

HSP 1 Score: 103.219 bits (256), Expect = 2.285e-25
Identity = 57/147 (38.78%), Postives = 86/147 (58.50%), Query Frame = 3
Query:  513 ICQLDINDASKIIDNLYLS-GLKAVTLDKLRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            I Q  I   S+I  +L++S G+ A     L    IT +++V  E +      I+ V++ + D   + +   F S+ ++IH      GR L+HC AG+SRSA + +AYLM+YH  SL DA+T+ KS R  I+PN GFW+QLI +E Q+
Sbjct:   12 IPQPSIRGLSQITKSLFISNGVAANNKLLLSSNQITTVINVSVEVANTFYEDIQYVQVPVVDAPVARLSNFFDSVADRIHSVEMQKGRTLLHCAAGVSRSAALCLAYLMKYHAMSLVDAHTWTKSCRPIIRPNSGFWEQLIHYELQL 158          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Mouse
Match: Dusp18 (dual specificity phosphatase 18 [Source:MGI Symbol;Acc:MGI:1922469])

HSP 1 Score: 103.219 bits (256), Expect = 2.285e-25
Identity = 57/147 (38.78%), Postives = 86/147 (58.50%), Query Frame = 3
Query:  513 ICQLDINDASKIIDNLYLS-GLKAVTLDKLRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            I Q  I   S+I  +L++S G+ A     L    IT +++V  E +      I+ V++ + D   + +   F S+ ++IH      GR L+HC AG+SRSA + +AYLM+YH  SL DA+T+ KS R  I+PN GFW+QLI +E Q+
Sbjct:   12 IPQPSIRGLSQITKSLFISNGVAANNKLLLSSNQITTVINVSVEVANTFYEDIQYVQVPVVDAPVARLSNFFDSVADRIHSVEMQKGRTLLHCAAGVSRSAALCLAYLMKYHAMSLVDAHTWTKSCRPIIRPNSGFWEQLIHYELQL 158          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Mouse
Match: Dusp14 (dual specificity phosphatase 14 [Source:MGI Symbol;Acc:MGI:1927168])

HSP 1 Score: 102.834 bits (255), Expect = 4.803e-25
Identity = 55/155 (35.48%), Postives = 89/155 (57.42%), Query Frame = 3
Query:  489 QNMISFKSICQLDINDASKIIDNLYLSGLK-AVTLDKLRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            + +++ + I + DI   ++I  +L+L     A     L+   IT +++   E         E V++ + D   + I  +F ++ +KIH      G  LVHC AG+SRSAT+ IAYLM++H   L +AY +VK+RR  I+PN GFW+QLI +E+Q+
Sbjct:   11 RTLMAPRMISEGDIGGIAQITSSLFLGRASVASNWHLLQARGITCVINATIEIPNFNWPQFEYVKVPLADIPHAPIRLYFDTVADKIHSVSKKHGATLVHCAAGVSRSATLCIAYLMKFHNLCLLEAYNWVKARRPVIRPNLGFWRQLIDYESQL 165          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Mouse
Match: Dusp14 (dual specificity phosphatase 14 [Source:MGI Symbol;Acc:MGI:1927168])

HSP 1 Score: 102.834 bits (255), Expect = 4.803e-25
Identity = 55/155 (35.48%), Postives = 89/155 (57.42%), Query Frame = 3
Query:  489 QNMISFKSICQLDINDASKIIDNLYLSGLK-AVTLDKLRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            + +++ + I + DI   ++I  +L+L     A     L+   IT +++   E         E V++ + D   + I  +F ++ +KIH      G  LVHC AG+SRSAT+ IAYLM++H   L +AY +VK+RR  I+PN GFW+QLI +E+Q+
Sbjct:   11 RTLMAPRMISEGDIGGIAQITSSLFLGRASVASNWHLLQARGITCVINATIEIPNFNWPQFEYVKVPLADIPHAPIRLYFDTVADKIHSVSKKHGATLVHCAAGVSRSATLCIAYLMKFHNLCLLEAYNWVKARRPVIRPNLGFWRQLIDYESQL 165          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Mouse
Match: Dusp14 (dual specificity phosphatase 14 [Source:MGI Symbol;Acc:MGI:1927168])

HSP 1 Score: 102.834 bits (255), Expect = 4.803e-25
Identity = 55/155 (35.48%), Postives = 89/155 (57.42%), Query Frame = 3
Query:  489 QNMISFKSICQLDINDASKIIDNLYLSGLK-AVTLDKLRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            + +++ + I + DI   ++I  +L+L     A     L+   IT +++   E         E V++ + D   + I  +F ++ +KIH      G  LVHC AG+SRSAT+ IAYLM++H   L +AY +VK+RR  I+PN GFW+QLI +E+Q+
Sbjct:   11 RTLMAPRMISEGDIGGIAQITSSLFLGRASVASNWHLLQARGITCVINATIEIPNFNWPQFEYVKVPLADIPHAPIRLYFDTVADKIHSVSKKHGATLVHCAAGVSRSATLCIAYLMKFHNLCLLEAYNWVKARRPVIRPNLGFWRQLIDYESQL 165          
BLAST of Dual specificity phosphatase-like protein vs. UniProt/SwissProt
Match: sp|O55737|123R_IIV6 (Putative tyrosine phosphatase 123R OS=Invertebrate iridescent virus 6 OX=176652 GN=IIV6-123R PE=3 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.447e-28
Identity = 62/142 (43.66%), Postives = 87/142 (61.27%), Query Frame = 3
Query:  534 DASKIIDNLYLSGLKAVTLDKLRH--LSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQIN 953
            + +KI++NLYL  ++    + +RH       I+++ R  +     GI  V ++IDD E+SD+  H   +   IH  I N  + LVHC AGISRSAT+VIAY+MR   YSL DA+ FVK +RS I PN GF +QL +FE  +N
Sbjct:    2 EPTKIVENLYLGNIQ----NGIRHSNYGFDKIINLTRFNNQY---GIPTVWINIDDSESSDLYSHLQKVTTLIHDSIENGNKVLVHCQAGISRSATVVIAYIMRSKRYSLQDAFNFVKKKRSIIFPNAGFIKQLAQFERWLN 136          
BLAST of Dual specificity phosphatase-like protein vs. UniProt/SwissProt
Match: sp|O95147|DUS14_HUMAN (Dual specificity protein phosphatase 14 OS=Homo sapiens OX=9606 GN=DUSP14 PE=1 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 1.630e-26
Identity = 59/155 (38.06%), Postives = 90/155 (58.06%), Query Frame = 3
Query:  489 QNMISFKSICQLDINDASKIIDNLYLS-GLKAVTLDKLRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            + +++ + I + DI   ++I  +L+L  G  A     L+   IT IV+   E         E V++ + D   + IG +F ++ +KIH      G  LVHC AG+SRSAT+ IAYLM++H   L +AY +VK+RR  I+PN GFW+QLI +E Q+
Sbjct:   11 RTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQL 165          
BLAST of Dual specificity phosphatase-like protein vs. UniProt/SwissProt
Match: sp|Q17QM8|DUS14_BOVIN (Dual specificity protein phosphatase 14 OS=Bos taurus OX=9913 GN=DUSP14 PE=2 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 3.895e-26
Identity = 58/155 (37.42%), Postives = 90/155 (58.06%), Query Frame = 3
Query:  489 QNMISFKSICQLDINDASKIIDNLYLS-GLKAVTLDKLRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            + +++ + I + D+   ++I  +L+L  G  A     L+   IT IV+   E         E V++ + D   + IG +F ++ +KIH      G  LVHC AG+SRSAT+ IAYLM++H   L +AY +VK+RR  I+PN GFW+QLI +E Q+
Sbjct:   11 RTLMAPRMISEGDLGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQL 165          
BLAST of Dual specificity phosphatase-like protein vs. UniProt/SwissProt
Match: sp|Q9H596|DUS21_HUMAN (Dual specificity protein phosphatase 21 OS=Homo sapiens OX=9606 GN=DUSP21 PE=1 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 1.146e-24
Identity = 62/150 (41.33%), Postives = 89/150 (59.33%), Query Frame = 3
Query:  507 KSICQLDINDASKIIDNLYLSGLKAVTLDKLRHLS--ITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            + + Q  I   S+I  +L+LS   A   DKL   S  IT IV+   E   V   GI+ +++ + D   S +   F  I + IH      GR L+HC+AG+SRSA++ +AYLM+YH  SL DA+T+ KSRR  I+PN GFW+QLI +E ++
Sbjct:   12 QGVQQPSIYSFSQITRSLFLSNGVAAN-DKLLLSSNRITAIVNASVEVVNVFFEGIQYIKVPVTDARDSRLYDFFDPIADLIHTIDMRQGRTLLHCMAGVSRSASLCLAYLMKYHSMSLLDAHTWTKSRRPIIRPNNGFWEQLINYEFKL 160          
BLAST of Dual specificity phosphatase-like protein vs. UniProt/SwissProt
Match: sp|Q8VE01|DUS18_MOUSE (Dual specificity protein phosphatase 18 OS=Mus musculus OX=10090 GN=Dusp18 PE=1 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.598e-24
Identity = 57/147 (38.78%), Postives = 86/147 (58.50%), Query Frame = 3
Query:  513 ICQLDINDASKIIDNLYLS-GLKAVTLDKLRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            I Q  I   S+I  +L++S G+ A     L    IT +++V  E +      I+ V++ + D   + +   F S+ ++IH      GR L+HC AG+SRSA + +AYLM+YH  SL DA+T+ KS R  I+PN GFW+QLI +E Q+
Sbjct:   12 IPQPSIRGLSQITKSLFISNGVAANNKLLLSSNQITTVINVSVEVANTFYEDIQYVQVPVVDAPVARLSNFFDSVADRIHSVEMQKGRTLLHCAAGVSRSAALCLAYLMKYHAMSLVDAHTWTKSCRPIIRPNSGFWEQLIHYELQL 158          
BLAST of Dual specificity phosphatase-like protein vs. TrEMBL
Match: T1JV60 (Uncharacterized protein OS=Tetranychus urticae OX=32264 GN=107370884 PE=4 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 2.755e-36
Identity = 69/155 (44.52%), Postives = 100/155 (64.52%), Query Frame = 3
Query:  486 QQNMISFKSICQLDINDASKIIDNLYLSGLKAVTLDKLRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            Q+N+  F  +        S+IID L+L+G+  +T D  R   IT I++  RE    R  G+EC  +++DD  T D+  H  S  +KI+  +SN GRA+VHC+AG+SRSA++VIAYL++Y   +L DAY  V+SRR  I+PN GF++QLI FE +I
Sbjct:   30 QENLQQFSILLTPAYAAFSQIIDGLFLTGVGGMTFDNFRKNKITNIINCTREAPNWRLPGVECFRIAVDDSPTEDLLSHLDSATDKIYSILSNGGRAVVHCVAGVSRSASLVIAYLIKYKKMTLHDAYNHVQSRRRVIRPNNGFFKQLITFEKKI 184          
BLAST of Dual specificity phosphatase-like protein vs. TrEMBL
Match: A0A183PCS9 (Uncharacterized protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS12165 PE=4 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 4.128e-34
Identity = 62/158 (39.24%), Postives = 108/158 (68.35%), Query Frame = 3
Query:  495 MISFKSICQLDI----NDASKIIDNLYLSGLKAVTLDKLRHLSITMIVSVLREGSPV--RASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            +I + ++CQ+D     +  ++I ++L+LS L A+T D+LR   IT++VS + +  PV  R + +  + + ++D E++++  HF  + ++I       G+ L+HC+AG+SRS+T+V+AYLMR+   SL+DAY  V+S R CIQPNPGFW+QL+++E ++
Sbjct:  254 LIPYNTVCQIDFMQMFSQIARINNHLFLSSLNAITPDRLRQHGITLLVSAMIDSPPVHIRNAVMNTIHVPVEDIESANLRVHFDRVCDRIAAENRRGGKTLIHCMAGVSRSSTLVLAYLMRHTNMSLADAYQHVRSIRPCIQPNPGFWRQLLEYEEKL 411          
BLAST of Dual specificity phosphatase-like protein vs. TrEMBL
Match: A0A183JP98 (Uncharacterized protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS4535 PE=4 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 6.946e-34
Identity = 62/158 (39.24%), Postives = 108/158 (68.35%), Query Frame = 3
Query:  495 MISFKSICQLDI----NDASKIIDNLYLSGLKAVTLDKLRHLSITMIVSVLREGSPV--RASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            +I + ++CQ+D     +  ++I ++L+LS L A+T D+LR   IT++VS + +  PV  R + +  + + ++D E++++  HF  + ++I       G+ L+HC+AG+SRS+T+V+AYLMR+   SL+DAY  V+S R CIQPNPGFW+QL+++E ++
Sbjct:  254 LIPYNTVCQIDFMQMFSQIARINNHLFLSSLNAITPDRLRQHGITLLVSAMIDSPPVHIRNAVMNTIHVPVEDIESANLRVHFDRVSDRIAAENRRGGKTLIHCMAGVSRSSTLVLAYLMRHTNMSLADAYQHVRSIRPCIQPNPGFWRQLLEYEEKL 411          
BLAST of Dual specificity phosphatase-like protein vs. TrEMBL
Match: A0A094ZWF4 (Dual specificity protein phosphatase 14 OS=Schistosoma haematobium OX=6185 GN=MS3_07617 PE=4 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 7.832e-34
Identity = 62/158 (39.24%), Postives = 108/158 (68.35%), Query Frame = 3
Query:  495 MISFKSICQLDI----NDASKIIDNLYLSGLKAVTLDKLRHLSITMIVSVLREGSPV--RASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            +I + ++CQ+D     +  ++I ++L+LS L A+T D+LR   IT++VS + +  PV  R + +  + + ++D E++++  HF  + ++I       G+ L+HC+AG+SRS+T+V+AYLMR+   SL+DAY  V+S R CIQPNPGFW+QL+++E ++
Sbjct:  254 LIPYNTVCQIDFMQMFSQIARINNHLFLSSLNAITPDRLRQHGITLLVSAMIDSPPVHIRNAVMNTIHVPVEDIESANLRVHFDRVSDRIAAENRRGGKTLIHCMAGVSRSSTLVLAYLMRHTNMSLADAYQHVRSIRPCIQPNPGFWRQLLEYEEKL 411          
BLAST of Dual specificity phosphatase-like protein vs. TrEMBL
Match: A0A183LZ12 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS9037 PE=4 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 7.832e-34
Identity = 62/158 (39.24%), Postives = 108/158 (68.35%), Query Frame = 3
Query:  495 MISFKSICQLDI----NDASKIIDNLYLSGLKAVTLDKLRHLSITMIVSVLREGSPV--RASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            +I + ++CQ+D     +  ++I ++L+LS L A+T D+LR   IT++VS + +  PV  R + +  + + ++D E++++  HF  + ++I       G+ L+HC+AG+SRS+T+V+AYLMR+   SL+DAY  V+S R CIQPNPGFW+QL+++E ++
Sbjct:  254 LIPYNTVCQIDFMQMFSQIARINNHLFLSSLNAITPDRLRQHGITLLVSAMIDSPPVHIRNAVMNTIHVPVEDIESANLRVHFDRVSDRIAAENRRGGKTLIHCMAGVSRSSTLVLAYLMRHTNMSLADAYQHVRSIRPCIQPNPGFWRQLLEYEEKL 411          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Cavefish
Match: dusp14 (dual specificity phosphatase 14 [Source:ZFIN;Acc:ZDB-GENE-041010-162])

HSP 1 Score: 102.064 bits (253), Expect = 5.082e-25
Identity = 55/142 (38.73%), Postives = 84/142 (59.15%), Query Frame = 3
Query:  528 INDASKIIDNLYLS-GLKAVTLDKLRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            +   ++I   L+LS G  A     L    IT +V+   E        +E V++ + D   S I  +F S+ +KIH      G  LVHC AG+SRSA++ +AYLM+YH  SL++A+ +VK+RR  I+PN GFW+QLI++E ++
Sbjct:   19 LGGIAQITPTLFLSRGNVASNRSLLLSKGITCVVNATIELPNFNWPHVEYVKVPLADMPHSPISLYFDSVADKIHSVGRKRGAVLVHCAAGVSRSASLCLAYLMKYHRVSLAEAHAWVKARRPVIRPNGGFWRQLIEYERKL 160          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Cavefish
Match: zgc:153044 (dual specificity protein phosphatase 18-like [Source:NCBI gene;Acc:103034919])

HSP 1 Score: 98.9821 bits (245), Expect = 5.704e-24
Identity = 52/139 (37.41%), Postives = 89/139 (64.03%), Query Frame = 3
Query:  540 SKIIDNLYLS-GLKAVTLDKLRHLSITMIVSVLRE-GSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            +++ D LY+S G  A     +  L+IT I++  ++ G+P   S +E V + + D   + +  HF ++ ++I +  +  GR LVHC AG+SRSAT+ +A+L+++ G SL +A+  VKSRR  ++PN GFW+QLI +E ++
Sbjct:   12 AQVTDYLYISNGRAAKDSTVITRLNITCIINATQDNGNPCLPS-VEYVWVPVTDSPETQLEEHFDTVADRIDEVRAQCGRVLVHCCAGVSRSATLCLAFLVKHCGMSLIEAHGLVKSRRPIVRPNSGFWKQLIDYEVKL 149          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Cavefish
Match: si:ch1073-184j22.2 (si:ch1073-184j22.2 [Source:ZFIN;Acc:ZDB-GENE-081104-32])

HSP 1 Score: 98.9821 bits (245), Expect = 6.690e-24
Identity = 52/136 (38.24%), Postives = 83/136 (61.03%), Query Frame = 3
Query:  540 SKIIDNLYLSGLKAVTLDK--LRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFE 941
            S+I   L+LSG  A +L++  L    IT+IV+     S  R  G+EC+ +++ D  ++ +  HF  +  +IH +    G  LVHC AG+SRS  +++AYLM+Y G +L  A+++V+  R  I+ N GFWQQL+ +E
Sbjct:   50 SQITPTLFLSGADA-SLNQALLSRKGITLIVNATLSHSCPRYPGVECIRVAVSDLPSARLSEHFDRVASRIHSN--QAGGTLVHCAAGMSRSPALIMAYLMKYKGVTLQQAHSWVQRSRPYIRLNAGFWQQLLDYE 182          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Cavefish
Match: dusp28 (dual specificity phosphatase 28 [Source:NCBI gene;Acc:103024305])

HSP 1 Score: 93.9745 bits (232), Expect = 2.977e-22
Identity = 45/138 (32.61%), Postives = 81/138 (58.70%), Query Frame = 3
Query:  543 KIIDNLYLSGLKAVTLDKL-RHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQIN 953
            K+ + L +S  ++   D+L +   +T+ ++V ++  P  ++ +    + + D    D+  +F    + IH   +  GR +V+C  G SRSAT+ +AYLM++ G SL++A+  VKS RS ++PNPGFW QL  +E ++ 
Sbjct:    6 KVTEGLLISNARSACSDELIQQEEVTLCINVSKQ-QPFPSTRVATFRVPVFDDPHEDLSRYFDRCTDAIHSEKARGGRTVVYCKNGRSRSATVCVAYLMKHQGLSLTEAFEMVKSARSVVEPNPGFWAQLELYEQELK 142          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000026376.2 (pep primary_assembly:Astyanax_mexicanus-2.0:17:26775472:26778719:-1 gene:ENSAMXG00000025650.2 transcript:ENSAMXT00000026376.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.0409 bits (214), Expect = 2.747e-19
Identity = 51/138 (36.96%), Postives = 80/138 (57.97%), Query Frame = 3
Query:  540 SKIIDNLYLSGLKAVTLDKLRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQIN 953
            S+I  +L+LSG+ AV    L    +T++V    E     ++GI+ + L I D+  + +  HF S+ E+I Q+    G  LV C AG SRS  +V+A+L++  G SL  AY  V   R  I+PN GFW+QL+++E + +
Sbjct:    4 SQITPSLFLSGV-AVNPAALARRKVTLLVLAADELPFPESAGIDLLRLPIRDEPHAPLAQHFDSVAERIQQN--RSGSTLVCCAAGRSRSPALVMAFLIKNEGLSLLQAYQRVLEVRPFIRPNAGFWRQLLEYERRFH 138          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Sea Lamprey
Match: dusp14 (dual specificity phosphatase 14 [Source:ZFIN;Acc:ZDB-GENE-041010-162])

HSP 1 Score: 102.834 bits (255), Expect = 5.553e-26
Identity = 51/129 (39.53%), Postives = 75/129 (58.14%), Query Frame = 3
Query:  564 LSGLKAVTLDKLRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            +SG  A     LR   IT +V+   E +  R  G+  V + + D   + I  +F  + E+I       GR LVHC AG+SRSA++ IAYLMR  G  L DA+ +V++RR  + PN GFW+QLI++E ++
Sbjct:   27 ISGRCASNASLLRARGITCVVNASLEVADARLPGVRYVRVPVPDCPHAPISRYFDPVAERIAGEARRGGRTLVHCAAGVSRSASLCIAYLMRGEGLVLRDAFRWVRARRPAVCPNSGFWRQLIRYEREL 155          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Sea Lamprey
Match: dusp28 (dual specificity phosphatase 28 [Source:ZFIN;Acc:ZDB-GENE-131127-257])

HSP 1 Score: 83.9593 bits (206), Expect = 1.973e-19
Identity = 51/159 (32.08%), Postives = 82/159 (51.57%), Query Frame = 3
Query:  498 ISFKSICQLDINDASKIIDNLYLSGLK-AVTLDKLRHLSITMIVSVLR------EGSPVRASGIE-CVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            +S  + C   +N    + + L++S  + A   D L    IT++++V R      E +P +  G   C+ + + D+ +  +G H     + I +     GR LV+C  G SRS  +V AYLMR+   SL  A+  VKS R    PN GFW+QL+++E Q+
Sbjct:    5 VSPTAACSSCLN---AVTEWLFISNARSACCPDLLDAAGITLLINVSRLQPFPPEPAPGQGQGQRVCIRVPVFDEPSESLGPHLTPCADAIEEERVRGGRTLVYCKHGRSRSVAVVTAYLMRHGELSLRSAFQKVKSVRPSASPNEGFWRQLLQYEAQL 160          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Sea Lamprey
Match: dusp22b (dual specificity phosphatase 22b [Source:NCBI gene;Acc:100002272])

HSP 1 Score: 79.7221 bits (195), Expect = 3.577e-18
Identity = 50/143 (34.97%), Postives = 78/143 (54.55%), Query Frame = 3
Query:  531 NDASKIIDNLYLSGLK-AVTLDKLRHLSITMIVSV---LREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQ 947
            N  S +++ LYL  +K +  L +LR  +IT I+SV    RE   +      C+++S  D  + ++  HF   ++ IH+        LVHC+AG+SRS T+V+AY+M        +A   VK+ R+C  PN GF QQL  F+ +
Sbjct:    3 NIISDVLEGLYLGNIKDSADLKQLRDHNITHILSVHDAAREA--LEEMTYLCIQVS--DTPSQNLTQHFKDCIQFIHKCRMEKKGCLVHCLAGVSRSVTMVVAYIMTVTSLGWEEAMVAVKTARTCANPNLGFQQQLQMFQNE 141          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006071.1 (pep scaffold:Pmarinus_7.0:GL479824:161791:175185:-1 gene:ENSPMAG00000005490.1 transcript:ENSPMAT00000006071.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.337 bits (194), Expect = 4.505e-18
Identity = 47/129 (36.43%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  579 AVTLDKLRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGR----ALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQIN 953
            A  L KL+ L I ++++V    +     G+    L  +D +      +     E+  + I +  R     LVHC AG+SRSATIVIAYLM++   +++DAY FVK +R  I PN  F  QL++FE  +N
Sbjct:    2 AQDLSKLQRLGIGLVLNVT---AHYERGGLHYKRLPANDSDNDSDKQNLRQYFEEAFEFIEDAHRRGQGLLVHCQAGVSRSATIVIAYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLN 127          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Sea Lamprey
Match: dusp10 (dual specificity phosphatase 10 [Source:ZFIN;Acc:ZDB-GENE-041014-271])

HSP 1 Score: 79.337 bits (194), Expect = 7.200e-18
Identity = 46/143 (32.17%), Postives = 74/143 (51.75%), Query Frame = 3
Query:  531 NDASKIIDNLYLSGLKAVT-LDKLRHLSITMIVSVLREGSPVRASG--IECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            +D S+++  L++ G +A   L  LR L++ ++++V        A    I    L   D    D+  +F      I +        L+HC AG+SRS T+ IAY+MR  G   SDAY FV++RR+ + PN  F  QL+ +E ++
Sbjct:   16 SDVSRLLPYLFVGGERAARDLPTLRRLNVGLVLNVTAHVPHYHAGAGSIAYRRLPASDTHGQDLRQYFRPAFLLIEEARRCGCSVLLHCQAGVSRSPTVAIAYVMRIRGLGASDAYAFVRARRAAVAPNLSFMGQLLLYEREL 158          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Yeast
Match: SDP1 (Stress-inducible dual-specificity MAP kinase phosphatase; negatively regulates Slt2p MAP kinase by direct dephosphorylation, diffuse localization under normal conditions shifts to punctate localization after heat shock; SDP1 has a paralog, MSG5, that arose from the whole genome duplication [Source:SGD;Acc:S000001375])

HSP 1 Score: 74.7146 bits (182), Expect = 5.817e-16
Identity = 35/90 (38.89%), Postives = 52/90 (57.78%), Query Frame = 3
Query:  696 QETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQINEPLN 965
            +  S I    PS+   IH   +   + L+HC  G+SRSAT++IAY+M+YH  SL  +Y  +KSR   I P+ G   QL+++E  +N   N
Sbjct:  110 EHDSQIALDLPSLTSIIHAATTKREKILIHCQCGLSRSATLIIAYIMKYHNLSLRHSYDLLKSRADKINPSIGLIFQLMEWEVALNAKTN 199          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Yeast
Match: MSG5 (Dual-specificity protein phosphatase; exists in 2 isoforms; required for maintenance of a low level of signaling through the cell integrity pathway, adaptive response to pheromone; regulates and is regulated by Slt2p; dephosphorylates Fus3p; MSG5 has a paralog, SDP1, that arose from the whole genome duplication [Source:SGD;Acc:S000004998])

HSP 1 Score: 67.781 bits (164), Expect = 9.806e-13
Identity = 31/71 (43.66%), Postives = 47/71 (66.20%), Query Frame = 3
Query:  744 IHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQINE 956
            IH   S   + LVHC  G+SRSA++++AY+MRY+G SL+DAY  +K     I PN G   QL+++ T +++
Sbjct:  305 IHTAHSQGKKILVHCQCGVSRSASLIVAYIMRYYGLSLNDAYNKLKGVAKDISPNMGLIFQLMEWGTMLSK 375          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Yeast
Match: PPS1 (Protein phosphatase; has specificity for serine, threonine, and tyrosine residues; has a role in the DNA synthesis phase of the cell cycle [Source:SGD;Acc:S000000480])

HSP 1 Score: 66.6254 bits (161), Expect = 3.599e-12
Identity = 45/124 (36.29%), Postives = 64/124 (51.61%), Query Frame = 3
Query:  585 TLDKLRHLSITMIVSVLREGSPV---RASGIECVELSIDDQETSDIGFH-FPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRR--SCIQPNPGFWQQLIKF 938
            T +K R+ + T++      GS V     SG +  ++   D    D  FH    +L+ I    +  G+ LVHC+ G+SRSAT+ IA  MRY    L+ AY FV+ RR    IQPN  F  +L K+
Sbjct:  654 TCNKSRNRADTVVSDKQENGSNVVISENSGFQICQIENLDDNGKDPLFHQIDKVLDFISNSEATGGKVLVHCMVGVSRSATVCIAECMRYLQCDLASAYLFVRVRRLNVIIQPNLFFVYELFKW 777          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Yeast
Match: YVH1 (Dual specificity protein phosphatase; regulates growth, sporulation, and glycogen accumulation in a cAMP-dependent protein kinase cascade dependent manner; mutants are defective in 60S ribosome assembly; positively regulates pre-autophagosomal structure (PAS) formation upon nitrogen starvation or rapamycin treatment [Source:SGD;Acc:S000001465])

HSP 1 Score: 62.7734 bits (151), Expect = 2.659e-11
Identity = 45/158 (28.48%), Postives = 75/158 (47.47%), Query Frame = 3
Query:  534 DASKIIDNLYLSGLKAVTLDKL--RHLSITMIVSVLR-EGSP--VRASGIECVELSIDDQETSDIGFHFPSILEKIHQHI-----------------SNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFE 941
            + ++I+  +YL G++ +   +      +IT I+SV++ +  P  +   G     + IDD + +D+  +F      I Q +                    G    HC AG+SRS T ++AYLM  +G SLS A   VK ++  ++PN  F +QL  FE
Sbjct:   11 EVTRILGGIYLGGIRPIIDHRPLGAEFNITHILSVIKFQVIPEYLIRKGYTLKNIPIDDDDVTDVLQYFDETNRFIDQCLFPNEVEYSPRLVDFKKKPQRGAVFAHCQAGLSRSVTFIVAYLMYRYGLSLSMAMHAVKRKKPSVEPNENFMEQLHLFE 168          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Nematostella
Match: EDO47156 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMT6])

HSP 1 Score: 96.6709 bits (239), Expect = 1.578e-23
Identity = 48/138 (34.78%), Postives = 82/138 (59.42%), Query Frame = 3
Query:  540 SKIIDNLYLSGLKAVTLDKLR-HLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            ++I + L+LS  +    +KL     IT++++   E        ++ + + ++D   + IG  F  + +KI       G+ LVHCIAG+SRSA++VIAYLM+Y   +L DA+  V+ +R  I+PN GFW++LI +E ++
Sbjct:   20 ARITEWLFLSSCQVARDEKLLLEKGITLVINATIEAPEQDYKKVKHIRIKVNDNPGNKIGIFFDMVSDKIESVRRVGGKVLVHCIAGVSRSASLVIAYLMKYQRLNLRDAHKLVQDKRPLIRPNTGFWKELIDYEKKL 157          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Nematostella
Match: EDO37675 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF21])

HSP 1 Score: 96.6709 bits (239), Expect = 3.794e-22
Identity = 53/143 (37.06%), Postives = 83/143 (58.04%), Query Frame = 3
Query:  528 INDASKIIDNLYL-SGLKAVTLDKLRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQIN 953
            ++ ASKI D++YL S   A  L++L+   +  ++++ +E     A       + + D E S++  ++    + I+Q      + LVHC  GISRSA+ VIAY M+ +G SL+D    VKSRR C+ PN GFW+QLI +E  +N
Sbjct:  220 MDSASKIYDHVYLGSEWNASNLEELKENGVEYVLNITKEIDNFFAGTFTYFNIRLWDLEDSNLLPYWDETFKFINQARDKGSKVLVHCKRGISRSASTVIAYGMKEYGTSLNDTMKHVKSRRQCVNPNQGFWKQLITYEGILN 362          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Nematostella
Match: EDO49250 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGX7])

HSP 1 Score: 94.7449 bits (234), Expect = 9.301e-22
Identity = 57/141 (40.43%), Postives = 78/141 (55.32%), Query Frame = 3
Query:  528 INDASKIIDNLYL-SGLKAVTLDKLRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQ 947
            +N+  +++ +LYL S L A   D L+ L I+ IV+V R              + +DD   +DIG  F      I    ++ GR LVHC AGISRSATI +AYL+    + L +AY +VK RRS I PN  F  QL+ +ETQ
Sbjct:  169 VNEPVELLPHLYLGSELHASRRDVLKRLGISAIVNVSRNIPNTFEDSFTYKTIPVDDTYNADIGVWFEEAAGFIDSVKASGGRVLVHCQAGISRSATICLAYLISRLNFRLDEAYEYVKKRRSVISPNFNFMGQLLHYETQ 309          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Nematostella
Match: EDO33587 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRS7])

HSP 1 Score: 87.4261 bits (215), Expect = 5.708e-20
Identity = 50/144 (34.72%), Postives = 77/144 (53.47%), Query Frame = 3
Query:  534 DASKIIDNLYLSGLKAVTLDKLRHL---SITMIVSVLRE-----GSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFE 941
            +  +I+  ++L    A    KL HL    IT IV + +        P   +    + L + D  T +I  +FP +   +   +S  G+ LVH  AGISRSA ++IAY+M  +G +  +A+ FV+ RR CI PN GF QQL+++E
Sbjct:   33 EMQEIVPGIFLGPYSAAMKSKLEHLKSQGITHIVCIRQNIEANFVKPNFPNDFLYLVLDVADTTTENIIRYFPQVKAFVDDCVSKGGKVLVHGNAGISRSAALMIAYIMETYGLAYREAFLFVQQRRFCINPNEGFTQQLMEYE 176          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Nematostella
Match: EDO42672 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S104])

HSP 1 Score: 86.2705 bits (212), Expect = 5.178e-19
Identity = 46/132 (34.85%), Postives = 74/132 (56.06%), Query Frame = 3
Query:  558 LYLS-GLKAVTLDKLRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            LYL  G +A     +  L IT IV++ +E        IE + L +DD   + +   F    + +   I   G  +VHC  G+SRS+++ +AYL++   ++L +AY+F+K RRSC++PN GF +QL  +E  I
Sbjct:  149 LYLGKGDQATNKKIMEDLKITHIVNITQEHKSAFPESIEYLTLQLDDVPQTQLINFFEKTTKFLSDAIDGGGCVMVHCNMGVSRSSSVTLAYLIKSKRWTLGEAYSFIKERRSCVRPNRGFLKQLATWEEMI 280          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Medaka
Match: dusp14 (dual specificity phosphatase 14 [Source:ZFIN;Acc:ZDB-GENE-041010-162])

HSP 1 Score: 104.375 bits (259), Expect = 9.070e-26
Identity = 56/142 (39.44%), Postives = 85/142 (59.86%), Query Frame = 3
Query:  528 INDASKIIDNLYLS-GLKAVTLDKLRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            +   ++I  NL+LS G  A     L    IT +V+   E        +E V++ + D   S I  +F S+ +KIH      G  LVHC AG+SRSA++ +AYLM+YH  SL++A+ +VK+RR  I+PN GFW+QLI++E ++
Sbjct:   26 LGGIAQITPNLFLSRGNVASNRSLLLSKGITCVVNATIELPNFNWPHMEYVKVPLADMPHSPISLYFDSVADKIHSVGRKRGAVLVHCAAGVSRSASLCLAYLMKYHRVSLAEAHAWVKARRPVIRPNGGFWRQLIEYERKL 167          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Medaka
Match: ENSORLT00000014836.2 (pep primary_assembly:ASM223467v1:9:17523780:17526387:-1 gene:ENSORLG00000011840.2 transcript:ENSORLT00000014836.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.908 bits (250), Expect = 1.539e-24
Identity = 54/138 (39.13%), Postives = 82/138 (59.42%), Query Frame = 3
Query:  540 SKIIDNLYLSGLKAVT-LDKLRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
             ++ D LYLS  K+     +L+   IT I++V    S       E V + + D   S++  HF  + +K+     N GR LVHC AG+SRSA + +A+LMR+ G +L DA+ ++KS R  I+PN GFW+QLI +ET++
Sbjct:   25 CRVTDQLYLSSRKSANDSSQLKVNKITCIINVSEARSSCPPGVDEYVHIPVSDSPLSNLRDHFDWVADKVRVTAENGGRTLVHCNAGVSRSAALCMAFLMRHRGATLLDAHAWLKSCRPIIRPNHGFWRQLIVYETEL 162          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Medaka
Match: si:ch1073-184j22.2 (si:ch1073-184j22.2 [Source:ZFIN;Acc:ZDB-GENE-081104-32])

HSP 1 Score: 92.8189 bits (229), Expect = 6.931e-22
Identity = 49/139 (35.25%), Postives = 83/139 (59.71%), Query Frame = 3
Query:  540 SKIIDNLYLSGLKA-VTLDKLRHLSITMIV-SVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            S++   L+LSG  A +    +    IT+IV + L    P    G+EC+ + + D  ++ +  HF  + ++IH   + DG  LVHC AG+SRS  +V+AYLMR+ G +L  A+ +V+  R  ++ N GFW+QL+++E ++
Sbjct:    4 SQVTSTLFLSGADAPLNAALVSQKGITLIVNATLNHACPA-YPGVECLRVPVCDLPSARLSDHFDRVADRIHG--NRDGGTLVHCAAGMSRSPALVMAYLMRHRGVTLRQAHHWVQESRPFVRLNSGFWEQLLQYERRL 139          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Medaka
Match: ssh1b (protein phosphatase Slingshot homolog 1 [Source:NCBI gene;Acc:101161425])

HSP 1 Score: 93.2041 bits (230), Expect = 6.672e-20
Identity = 59/163 (36.20%), Postives = 95/163 (58.28%), Query Frame = 3
Query:  528 INDASKIIDNLYL-SGLKAVTLDKLRHLSITMIVSVLREGSPVRASGIECVE-LSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQINEPLNKNKKFSNGY*KKLWR 1010
            ++ A+ I D++YL S   A  L++LR   ++ I++V RE       G+ C + + + D++ +D+  H+      I +   ++ + LVHC  G+SRSA+ VIAY M+ +G+SL  AY FVK +RS  QPN GF +QL ++E      L+ +K+  N    KLWR
Sbjct:  298 MDKATLIFDHVYLGSEWNASNLEELRECGVSFILNVTREIDNF-FPGMFCYQNVRVYDEDATDMLAHWNDTYNFIAKAKKSNSKCLVHCRMGVSRSASTVIAYAMKEYGWSLEKAYNFVKQKRSIAQPNSGFMKQLAEYEG----ILDASKQRHN----KLWR 451          
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Medaka
Match: ssh1a (slingshot protein phosphatase 1 [Source:NCBI gene;Acc:101156093])

HSP 1 Score: 90.8929 bits (224), Expect = 4.085e-19
Identity = 55/162 (33.95%), Postives = 92/162 (56.79%), Query Frame = 3
Query:  528 INDASKIIDNLYL-SGLKAVTLDKLRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQINEPLNKNKKFSNGY*KKLWR 1010
            ++ A+ I D++YL S   A  L++L+   ++ I++V RE             + + D++++D+  H+      I +   N  + LVHC  G+SRSA+ VIAY M+ +G+SL  AY FVK +R+  +PNPGF +QL ++E      L+ +K+  N    KLW+
Sbjct:  308 MDKATLIFDHVYLGSEWNASNLEELQETGVSYILNVTREIDNFFPGTFSYHNVRVYDEDSTDLLAHWNETYNFIVKAKKNHSKCLVHCKMGVSRSASTVIAYAMKEYGWSLEKAYNFVKEKRNITRPNPGFMRQLAEYEGI----LDASKQRHN----KLWQ 461          
BLAST of Dual specificity phosphatase-like protein vs. Planmine SMEST
Match: SMESG000047740.1 (SMESG000047740.1)

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 287/287 (100.00%), Postives = 287/287 (100.00%), Query Frame = 3
Query:  132 MSFRKTSNFNQAPESNNFGFTYSSIDSSTKRDSWRQRXXXXXXXNYDPVAVNIDNQNKSYFTYSPTPSNLTGISNGLNSKDQLITKKKPLLSTTRGTKSMEENSDEGFSTRYFSSYRPQQNMISFKSICQLDINDASKIIDNLYLSGLKAVTLDKLRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQINEPLNKNKKFSNGY 992
            MSFRKTSNFNQAPESNNFGFTYSSIDSSTKRDSWRQRSSFSFSSNYDPVAVNIDNQNKSYFTYSPTPSNLTGISNGLNSKDQLITKKKPLLSTTRGTKSMEENSDEGFSTRYFSSYRPQQNMISFKSICQLDINDASKIIDNLYLSGLKAVTLDKLRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQINEPLNKNKKFSNGY
Sbjct:    1 MSFRKTSNFNQAPESNNFGFTYSSIDSSTKRDSWRQRSSFSFSSNYDPVAVNIDNQNKSYFTYSPTPSNLTGISNGLNSKDQLITKKKPLLSTTRGTKSMEENSDEGFSTRYFSSYRPQQNMISFKSICQLDINDASKIIDNLYLSGLKAVTLDKLRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQINEPLNKNKKFSNGY 287          
BLAST of Dual specificity phosphatase-like protein vs. Planmine SMEST
Match: SMESG000032392.1 (SMESG000032392.1)

HSP 1 Score: 148.673 bits (374), Expect = 4.452e-41
Identity = 65/141 (46.10%), Postives = 102/141 (72.34%), Query Frame = 3
Query:  528 INDASKIIDNLYLSGLKAVTLDKLRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            +N  ++I D++YLS + A+TLD++R L ITM+VS++ +  P+RAS +E V + I+D E +++  +   +++KIH+     G+ LVHCIAG+SRS+++VI YLM+YH   L  AY  V++RR  IQPN GFW+QLI+FE ++
Sbjct:  129 LNQIAQITDSVYLSSISAITLDRIRELGITMLVSMITDPVPIRASNLENVLVPIEDTEYANLRSYLDRVIDKIHREELKGGKILVHCIAGVSRSSSLVIGYLMKYHAMRLRQAYNHVRARRPYIQPNIGFWKQLIEFEKRL 269          
BLAST of Dual specificity phosphatase-like protein vs. Planmine SMEST
Match: SMESG000037868.1 (SMESG000037868.1)

HSP 1 Score: 147.132 bits (370), Expect = 1.390e-40
Identity = 72/154 (46.75%), Postives = 103/154 (66.88%), Query Frame = 3
Query:  504 FKSICQLDIN----DASKIIDNLYLSGLKAVTLDKLRHLSITMIVSVLREGSPVR-ASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            F +  Q D N      ++I DNLYLSGL A+T ++L+ L I+++VS++ E S +R    IE ++++I+D E  +I  HF  +LE+++      GR LVHC+AGISRS+TI++AYLMRYH   L +AY  V S+R  IQPN GFW+QLI +E  I
Sbjct:  101 FDAFKQYDYNHMVSQIARITDNLYLSGLHAITSERLKSLGISLVVSLIAENSSMRLPPSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSI 254          
BLAST of Dual specificity phosphatase-like protein vs. Planmine SMEST
Match: SMESG000031662.1 (SMESG000031662.1)

HSP 1 Score: 93.2041 bits (230), Expect = 5.724e-22
Identity = 54/145 (37.24%), Postives = 80/145 (55.17%), Query Frame = 3
Query:  525 DINDASKIIDNLYLSGLKAVTLDKLRHLSITMIVSV-LREGSPVRA--SGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            DI   S+I   L+L+    +    +R L ITM V+V L    P  +  + I  V + + D   + +  +F  ++EK+   I N+G+ LV+C  G SRS+TIV+ YLM+     L  AY   K +R CI PN GFW+QLI +E +I
Sbjct:   21 DIPKISEITPFLFLTSAVGLRSPNIRSLGITMSVNVSLEVMFPNNSDFNSITKVRVPVSDLSWTKLDIYFDDVIEKMDHEIKNNGKVLVNCAMGSSRSSTIVLGYLMKKMKIPLRQAYHHTKRQRPCICPNVGFWKQLISYEKKI 165          
BLAST of Dual specificity phosphatase-like protein vs. Planmine SMEST
Match: SMESG000029551.1 (SMESG000029551.1)

HSP 1 Score: 93.2041 bits (230), Expect = 5.724e-22
Identity = 54/145 (37.24%), Postives = 80/145 (55.17%), Query Frame = 3
Query:  525 DINDASKIIDNLYLSGLKAVTLDKLRHLSITMIVSV-LREGSPVRA--SGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 950
            DI   S+I   L+L+    +    +R L ITM V+V L    P  +  + I  V + + D   + +  +F  ++EK+   I N+G+ LV+C  G SRS+TIV+ YLM+     L  AY   K +R CI PN GFW+QLI +E +I
Sbjct:   21 DIPKISEITPFLFLTSAVGLRSPNIRSLGITMSVNVSLEVMFPNNSDFNSITKVRVPVSDLSWTKLDIYFDDVIEKMDHEIKNNGKVLVNCAMGSSRSSTIVLGYLMKKMKIPLRQAYHHTKRQRPCICPNVGFWKQLISYEKKI 165          
The following BLAST results are available for this feature:
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DUSP143.395e-2738.06dual specificity phosphatase 14 [Source:HGNC Symbo... [more]
DUSP143.395e-2738.06dual specificity phosphatase 14 [Source:HGNC Symbo... [more]
DUSP143.395e-2738.06dual specificity phosphatase 14 [Source:HGNC Symbo... [more]
DUSP143.395e-2738.06dual specificity phosphatase 14 [Source:HGNC Symbo... [more]
DUSP143.395e-2738.06dual specificity phosphatase 14 [Source:HGNC Symbo... [more]
back to top
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C04F12.81.104e-2735.46pep chromosome:WBcel235:I:9697237:9699561:-1 gene:... [more]
F26A3.46.020e-2636.43pep chromosome:WBcel235:I:7656978:7658291:-1 gene:... [more]
ZK757.27.590e-2036.69pep chromosome:WBcel235:III:9874142:9877476:-1 gen... [more]
F13D11.31.583e-1833.09pep chromosome:WBcel235:X:5804379:5805922:-1 gene:... [more]
lip-16.820e-1533.77Dual specificity protein phosphatase lip-1 [Sourc... [more]
back to top
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mkp7.234e-2039.42gene:FBgn0083992 transcript:FBtr0110976[more]
Mkp7.234e-2039.42gene:FBgn0083992 transcript:FBtr0344094[more]
Mkp7.234e-2039.42gene:FBgn0083992 transcript:FBtr0110977[more]
Mkp7.234e-2039.42gene:FBgn0083992 transcript:FBtr0344024[more]
Mkp38.118e-2039.62gene:FBgn0036844 transcript:FBtr0075036[more]
back to top
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dusp142.611e-2446.32dual specificity phosphatase 14 [Source:ZFIN;Acc:Z... [more]
dusp142.611e-2446.32dual specificity phosphatase 14 [Source:ZFIN;Acc:Z... [more]
si:ch1073-184j22.24.050e-2338.85si:ch1073-184j22.2 [Source:ZFIN;Acc:ZDB-GENE-08110... [more]
si:ch1073-184j22.21.444e-2238.41si:ch1073-184j22.2 [Source:ZFIN;Acc:ZDB-GENE-08110... [more]
dusp284.792e-2131.88dual specificity phosphatase 28 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dusp146.006e-2841.32dual specificity phosphatase 14 [Source:NCBI gene;... [more]
ENSXETT00000005765.15.033e-2038.41pep primary_assembly:Xenopus_tropicalis_v9.1:1:157... [more]
SSH17.114e-2035.86slingshot protein phosphatase 1 [Source:NCBI gene;... [more]
SSH11.471e-1934.21slingshot protein phosphatase 1 [Source:NCBI gene;... [more]
SSH11.522e-1934.21slingshot protein phosphatase 1 [Source:NCBI gene;... [more]
back to top
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dusp182.285e-2538.78dual specificity phosphatase 18 [Source:MGI Symbol... [more]
Dusp182.285e-2538.78dual specificity phosphatase 18 [Source:MGI Symbol... [more]
Dusp144.803e-2535.48dual specificity phosphatase 14 [Source:MGI Symbol... [more]
Dusp144.803e-2535.48dual specificity phosphatase 14 [Source:MGI Symbol... [more]
Dusp144.803e-2535.48dual specificity phosphatase 14 [Source:MGI Symbol... [more]
back to top
BLAST of Dual specificity phosphatase-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O55737|123R_IIV61.447e-2843.66Putative tyrosine phosphatase 123R OS=Invertebrate... [more]
sp|O95147|DUS14_HUMAN1.630e-2638.06Dual specificity protein phosphatase 14 OS=Homo sa... [more]
sp|Q17QM8|DUS14_BOVIN3.895e-2637.42Dual specificity protein phosphatase 14 OS=Bos tau... [more]
sp|Q9H596|DUS21_HUMAN1.146e-2441.33Dual specificity protein phosphatase 21 OS=Homo sa... [more]
sp|Q8VE01|DUS18_MOUSE1.598e-2438.78Dual specificity protein phosphatase 18 OS=Mus mus... [more]
back to top
BLAST of Dual specificity phosphatase-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1JV602.755e-3644.52Uncharacterized protein OS=Tetranychus urticae OX=... [more]
A0A183PCS94.128e-3439.24Uncharacterized protein OS=Schistosoma mattheei OX... [more]
A0A183JP986.946e-3439.24Uncharacterized protein OS=Schistosoma curassoni O... [more]
A0A094ZWF47.832e-3439.24Dual specificity protein phosphatase 14 OS=Schisto... [more]
A0A183LZ127.832e-3439.24Uncharacterized protein OS=Schistosoma margrebowie... [more]
back to top
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dusp145.082e-2538.73dual specificity phosphatase 14 [Source:ZFIN;Acc:Z... [more]
zgc:1530445.704e-2437.41dual specificity protein phosphatase 18-like [Sour... [more]
si:ch1073-184j22.26.690e-2438.24si:ch1073-184j22.2 [Source:ZFIN;Acc:ZDB-GENE-08110... [more]
dusp282.977e-2232.61dual specificity phosphatase 28 [Source:NCBI gene;... [more]
ENSAMXT00000026376.22.747e-1936.96pep primary_assembly:Astyanax_mexicanus-2.0:17:267... [more]
back to top
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dusp145.553e-2639.53dual specificity phosphatase 14 [Source:ZFIN;Acc:Z... [more]
dusp281.973e-1932.08dual specificity phosphatase 28 [Source:ZFIN;Acc:Z... [more]
dusp22b3.577e-1834.97dual specificity phosphatase 22b [Source:NCBI gene... [more]
ENSPMAT00000006071.14.505e-1836.43pep scaffold:Pmarinus_7.0:GL479824:161791:175185:-... [more]
dusp107.200e-1832.17dual specificity phosphatase 10 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
SDP15.817e-1638.89Stress-inducible dual-specificity MAP kinase phosp... [more]
MSG59.806e-1343.66Dual-specificity protein phosphatase; exists in 2 ... [more]
PPS13.599e-1236.29Protein phosphatase; has specificity for serine, t... [more]
YVH12.659e-1128.48Dual specificity protein phosphatase; regulates gr... [more]
back to top
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO471561.578e-2334.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376753.794e-2237.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492509.301e-2240.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO335875.708e-2034.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426725.178e-1934.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dual specificity phosphatase-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dusp149.070e-2639.44dual specificity phosphatase 14 [Source:ZFIN;Acc:Z... [more]
ENSORLT00000014836.21.539e-2439.13pep primary_assembly:ASM223467v1:9:17523780:175263... [more]
si:ch1073-184j22.26.931e-2235.25si:ch1073-184j22.2 [Source:ZFIN;Acc:ZDB-GENE-08110... [more]
ssh1b6.672e-2036.20protein phosphatase Slingshot homolog 1 [Source:NC... [more]
ssh1a4.085e-1933.95slingshot protein phosphatase 1 [Source:NCBI gene;... [more]
back to top
BLAST of Dual specificity phosphatase-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000047740.10.000e+0100.00SMESG000047740.1[more]
SMESG000032392.14.452e-4146.10SMESG000032392.1[more]
SMESG000037868.11.390e-4046.75SMESG000037868.1[more]
SMESG000031662.15.724e-2237.24SMESG000031662.1[more]
SMESG000029551.15.724e-2237.24SMESG000029551.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022824 ID=SMED30022824|Name=Dual specificity phosphatase-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1313bp
AATAGTAAACAACTTATTTTCAATCAATATAATAAGTTAATTTATTAATT
TTCTTATTTTATTTTTAATTTAATTTTGATTTTTTAATCATTATTTGATT
TTAGTTTTAAATTTCCTATTTCCATAATCTGATGAGTTTTCGTAAAACGT
CTAATTTTAATCAGGCTCCTGAATCTAATAATTTTGGATTCACATATTCG
TCAATAGATTCTTCAACTAAACGAGATTCTTGGCGACAGCGGAGTTCATT
TTCTTTTAGTTCTAATTATGATCCTGTTGCTGTCAATATCGATAACCAAA
ACAAGTCATACTTCACATATTCTCCTACTCCATCCAATTTAACTGGTATC
TCTAATGGACTAAACTCTAAAGATCAATTAATAACTAAAAAGAAACCACT
TTTATCTACAACTAGAGGAACGAAAAGTATGGAAGAAAATAGTGATGAAG
GTTTTTCGACACGGTATTTTTCTTCATATCGTCCTCAACAGAACATGATA
TCGTTTAAATCGATTTGTCAATTAGATATTAATGATGCTTCCAAAATTAT
TGACAATCTATATTTATCAGGACTGAAAGCAGTTACGCTAGATAAACTAC
GACATTTAAGTATAACAATGATTGTTTCCGTTTTACGAGAAGGCTCCCCA
GTACGAGCCAGTGGAATTGAATGTGTTGAATTATCAATTGATGATCAGGA
AACCAGTGATATTGGTTTTCATTTCCCGTCGATTCTCGAAAAGATTCATC
AGCATATTTCCAATGACGGCCGGGCTTTAGTGCATTGTATTGCAGGGATT
TCCCGATCGGCAACTATAGTCATAGCGTATCTTATGCGATATCATGGCTA
TTCGTTGAGTGACGCTTATACTTTCGTCAAGTCTCGTCGGTCGTGTATTC
AACCAAATCCAGGATTTTGGCAACAGTTGATAAAGTTCGAAACTCAAATC
AACGAACCGTTAAATAAAAATAAAAAATTCAGCAATGGTTATTAAAAAAA
ACTTTGGCGCCTATTGTCTTTCGTGTATGAATTTGTATATTATATCACTG
TTATTTTATTTATGTTAGATTATATTTGTTCTATTTGTTTTAATTTTATA
TTATTGCACGAATATCTCGAACAATTTTTTTTAATTCAACACAGTGGAAA
TATTTGGGTTCTTTTCAATGCATTTCTATTAGTTAGCGATTTCCCAGTTG
ATCACGTGAGTAAGTTTGTGTGCATTTAATAGGAATTGTAATTGATTTTC
GGTTGTACTTATTATTTGATAATTGTAAATTATGTATTTATCATTTGTGT
AGTTCTTAATGAG
back to top

protein sequence of SMED30022824-orf-1

>SMED30022824-orf-1 ID=SMED30022824-orf-1|Name=SMED30022824-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=288bp
MSFRKTSNFNQAPESNNFGFTYSSIDSSTKRDSWRQRSSFSFSSNYDPVA
VNIDNQNKSYFTYSPTPSNLTGISNGLNSKDQLITKKKPLLSTTRGTKSM
EENSDEGFSTRYFSSYRPQQNMISFKSICQLDINDASKIIDNLYLSGLKA
VTLDKLRHLSITMIVSVLREGSPVRASGIECVELSIDDQETSDIGFHFPS
ILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVK
SRRSCIQPNPGFWQQLIKFETQINEPLNKNKKFSNGY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
GO:0008138protein tyrosine/serine/threonine phosphatase activity
GO:0004725protein tyrosine phosphatase activity
GO:0016791phosphatase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR020422TYR_PHOSPHATASE_DUAL_dom
IPR000340Dual-sp_phosphatase_cat-dom
IPR029021Prot-tyrosine_phosphatase-like
IPR016130Tyr_Pase_AS
IPR000387TYR_PHOSPHATASE_dom
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
GO:0016311dephosphorylation
GO:0035335peptidyl-tyrosine dephosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020422Dual specificity protein phosphatase domainSMARTSM00195dsp_5coord: 135..272
e-value: 1.3E-42
score: 157.5
IPR020422Dual specificity protein phosphatase domainPROSITEPS50054TYR_PHOSPHATASE_DUALcoord: 135..274
score: 37.232
IPR000340Dual specificity phosphatase, catalytic domainPFAMPF00782DSPccoord: 143..272
e-value: 8.0E-33
score: 113.1
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 135..285
e-value: 3.0E-47
score: 162.2
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 127..273
NoneNo IPR availablePANTHERPTHR45961FAMILY NOT NAMEDcoord: 124..275
NoneNo IPR availableCDDcd14498DSPcoord: 136..268
e-value: 4.15321E-53
score: 167.723
IPR016130Protein-tyrosine phosphatase, active sitePROSITEPS00383TYR_PHOSPHATASE_1coord: 217..227
IPR000387Tyrosine specific protein phosphatases domainPROSITEPS50056TYR_PHOSPHATASE_2coord: 196..253
score: 13.672