COesterase domain-containing protein

Overview
NameCOesterase domain-containing protein
Smed IDSMED30022815
Length (bp)2060
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of COesterase domain-containing protein (SMED30022815) t-SNE clustered cells

Violin plots show distribution of expression levels for COesterase domain-containing protein (SMED30022815) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of COesterase domain-containing protein (SMED30022815) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for COesterase domain-containing protein (SMED30022815) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022815

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30022815h1SMcG0005419 SmedASXL_015591SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30022815h1SMcG0005419 dd_Smed_v4_14790_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022815h1SMcG0005419 dd_Smed_v4_14790_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30022815h1SMcG0005419 dd_Smed_v4_14790_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30022815h1SMcG0005419 dd_Smed_v6_14790_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30022815h1SMcG0005419 OX_Smed_1.0.02926ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of COesterase domain-containing protein vs. Ensembl Human
Match: BCHE (butyrylcholinesterase [Source:HGNC Symbol;Acc:HGNC:983])

HSP 1 Score: 320.857 bits (821), Expect = 1.228e-100
Identity = 197/606 (32.51%), Postives = 304/606 (50.17%), Query Frame = 3
Query:   39 LIVLCFCLSYDAIVVHIKIDNQTFPLKGKSIFKMGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIG-KMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYL-DDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKE----ILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILPDLL 1838
             ++LC  +        I I  +   ++G ++   G  +  F  IPYA+PP+G  RF+ P+ L    W+ ++++T    +C Q   +I+       G +MW   T +SEDCLYL +W P     N    V+IWIYGG + +G+S+L VYDG  LA +  V++VS  +R G LGFL L  + E+PGN  + DQ + L+WV  +I +FGG+PK VTLFGES+GA S+S+HL S  S   F RAILQSG+   PWA+ S   +  +   LA+   C+  N  EI+KCLR+  P+                  E L+ E +   Y        + F P  D   ++ +    +  GQ    + +L+G N +E   FL+YG +  F    +S I          + + +  KI           +P ++     E+G +S  F    W   +      + L  + GD  FICP ++F    ++  ++  F Y F  R++    P+W+GVMHGYEIE+VFG+P          ++   E+ +SRS++K W NFAKYGNP  T       WP + +  ++YL +   N+   ++    + + CRFW    P +L
Sbjct:   16 FLLLCMLIGKSHTEDDIIIATKNGKVRGMNLTVFGGTVTAFLGIPYAQPPLGRLRFKKPQSLTK--WSDIWNATKYANSCCQ---NIDQSFPGFHGSEMWNPNTDLSEDCLYLNVWIPAPKPKNAT--VLIWIYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPGSHSLFTRAILQSGSFNAPWAVTSLYEARNRTLNLAKLTGCSRENETEIIKCLRNKDPQ------------------EILLNEAFVVPYGTP---LSVNFGPTVDGDFLTDMPDILLELGQFKKTQ-ILVGVNKDEGTAFLVYG-APGFSKDNNSIIT--------RKEFQEGLKI----------FFPGVS-----EFGKESILFHYTDWVDDQRPENYREALGDVVGDYNFICPALEFTKKFSEWGNNAFFYY-FEHRSSKLPWPEWMGVMHGYEIEFVFGLPLERR-----DNYTKAEEILSRSIVKRWANFAKYGNPNETQNNSTS-WPVFKSTEQKYLTL---NTESTRIMTKLRAQQCRFWTSFFPKVL 558          
BLAST of COesterase domain-containing protein vs. Ensembl Human
Match: BCHE (butyrylcholinesterase [Source:HGNC Symbol;Acc:HGNC:983])

HSP 1 Score: 320.087 bits (819), Expect = 6.256e-100
Identity = 197/607 (32.45%), Postives = 305/607 (50.25%), Query Frame = 3
Query:   39 LIVLCFCLSYDAIVVHIKIDNQTFPLKGKSIFKMGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIG-KMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYL-DDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKP-EVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKE----ILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILPDLL 1838
             ++LC  +        I I  +   ++G ++   G  +  F  IPYA+PP+G  RF+ P+ L    W+ ++++T    +C Q   +I+       G +MW   T +SEDCLYL +W P     N    V+IWIYGG + +G+S+L VYDG  LA +  V++VS  +R G LGFL L  + E+PGN  + DQ + L+WV  +I +FGG+PK VTLFGES+GA S+S+HL S  S   F RAILQSG+   PWA+ S   +  +   LA+   C+  N  EI+KCLR+  P E+L+N  F++                             + F P  D   ++ +    +  GQ    + +L+G N +E   FL+YG +  F    +S I          + + +  KI           +P ++     E+G +S  F    W   +      + L  + GD  FICP ++F    ++  ++  F Y F  R++    P+W+GVMHGYEIE+VFG+P          ++   E+ +SRS++K W NFAKYGNP  T       WP + +  ++YL +   N+   ++    + + CRFW    P +L
Sbjct:   16 FLLLCMLIGKSHTEDDIIIATKNGKVRGMNLTVFGGTVTAFLGIPYAQPPLGRLRFKKPQSLTK--WSDIWNATKYANSCCQ---NIDQSFPGFHGSEMWNPNTDLSEDCLYLNVWIPAPKPKNAT--VLIWIYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPGSHSLFTRAILQSGSFNAPWAVTSLYEARNRTLNLAKLTGCSRENETEIIKCLRNKDPQEILLNEAFVV----------------------PYGTPLSVNFGPTVDGDFLTDMPDILLELGQFKKTQ-ILVGVNKDEGTAFLVYG-APGFSKDNNSIIT--------RKEFQEGLKI----------FFPGVS-----EFGKESILFHYTDWVDDQRPENYREALGDVVGDYNFICPALEFTKKFSEWGNNAFFYY-FEHRSSKLPWPEWMGVMHGYEIEFVFGLPLERR-----DNYTKAEEILSRSIVKRWANFAKYGNPNETQNNSTS-WPVFKSTEQKYLTL---NTESTRIMTKLRAQQCRFWTSFFPKVL 558          
BLAST of COesterase domain-containing protein vs. Ensembl Human
Match: ACHE (acetylcholinesterase (Cartwright blood group) [Source:HGNC Symbol;Acc:HGNC:108])

HSP 1 Score: 310.842 bits (795), Expect = 3.559e-96
Identity = 185/585 (31.62%), Postives = 288/585 (49.23%), Query Frame = 3
Query:  114 LKGKSIFKMGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDT-ESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANC----TSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSS----NFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILPDLLN 1841
            L+G  +   G  +  F  IP+A+PP+G RRF  PE     PW+GV D+T     C+Q   ++    +    +MW     +SEDCLYL +WTP     +   PV++WIYGG + SG+S+L+VYDG  L      V+VS  +R G  GFL L  + E+PGN  ++DQ + L+WV  ++ +FGGDP  VTLFGES+GA S+ +HL S  S   F RA+LQSG    PWA      +  +A  LA    C    T  N+ E+V CLR+   +VLVN  + +  Q +                      F   F P+ D   +S      I+ G       +L+G   +E  +FL+YG       N  L   ++ +   ++  P  +      +VL      D+L+P                 +D +     + + L  + GD   +CP  Q A  +  ++ ++++ Y+F  R +    P W+GV HGYEIE++FG+P   D + N   +  +EK  ++ +M++W NFA+ G+P      +   WP YT   ++Y+ +   +    +V    + + C FWN+ LP LL+
Sbjct:   48 LRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQ--PWSGVVDATTFQSVCYQYVDTLYPGFEG--TEMWNPNRELSEDCLYLNVWTPYPRPTSPT-PVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQES---------------------VFRFSFVPVVDGDFLSDTPEALINAGDF-HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYT---DWLHP-----------------EDPA----RLREALSDVVGDHNVVCPVAQLAGRLA-AQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPL--DPSRN---YTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQYVSL---DLRPLEVRRGLRAQACAFWNRFLPKLLS 572          
BLAST of COesterase domain-containing protein vs. Ensembl Human
Match: ACHE (acetylcholinesterase (Cartwright blood group) [Source:HGNC Symbol;Acc:HGNC:108])

HSP 1 Score: 310.842 bits (795), Expect = 3.559e-96
Identity = 185/585 (31.62%), Postives = 288/585 (49.23%), Query Frame = 3
Query:  114 LKGKSIFKMGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDT-ESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANC----TSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSS----NFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILPDLLN 1841
            L+G  +   G  +  F  IP+A+PP+G RRF  PE     PW+GV D+T     C+Q   ++    +    +MW     +SEDCLYL +WTP     +   PV++WIYGG + SG+S+L+VYDG  L      V+VS  +R G  GFL L  + E+PGN  ++DQ + L+WV  ++ +FGGDP  VTLFGES+GA S+ +HL S  S   F RA+LQSG    PWA      +  +A  LA    C    T  N+ E+V CLR+   +VLVN  + +  Q +                      F   F P+ D   +S      I+ G       +L+G   +E  +FL+YG       N  L   ++ +   ++  P  +      +VL      D+L+P                 +D +     + + L  + GD   +CP  Q A  +  ++ ++++ Y+F  R +    P W+GV HGYEIE++FG+P   D + N   +  +EK  ++ +M++W NFA+ G+P      +   WP YT   ++Y+ +   +    +V    + + C FWN+ LP LL+
Sbjct:   48 LRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQ--PWSGVVDATTFQSVCYQYVDTLYPGFEG--TEMWNPNRELSEDCLYLNVWTPYPRPTSPT-PVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQES---------------------VFRFSFVPVVDGDFLSDTPEALINAGDF-HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYT---DWLHP-----------------EDPA----RLREALSDVVGDHNVVCPVAQLAGRLA-AQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPL--DPSRN---YTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQYVSL---DLRPLEVRRGLRAQACAFWNRFLPKLLS 572          
BLAST of COesterase domain-containing protein vs. Ensembl Human
Match: ACHE (acetylcholinesterase (Cartwright blood group) [Source:HGNC Symbol;Acc:HGNC:108])

HSP 1 Score: 309.686 bits (792), Expect = 8.513e-96
Identity = 185/585 (31.62%), Postives = 288/585 (49.23%), Query Frame = 3
Query:  114 LKGKSIFKMGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDT-ESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANC----TSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSS----NFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILPDLLN 1841
            L+G  +   G  +  F  IP+A+PP+G RRF  PE     PW+GV D+T     C+Q   ++    +    +MW     +SEDCLYL +WTP     +   PV++WIYGG + SG+S+L+VYDG  L      V+VS  +R G  GFL L  + E+PGN  ++DQ + L+WV  ++ +FGGDP  VTLFGES+GA S+ +HL S  S   F RA+LQSG    PWA      +  +A  LA    C    T  N+ E+V CLR+   +VLVN  + +  Q +                      F   F P+ D   +S      I+ G       +L+G   +E  +FL+YG       N  L   ++ +   ++  P  +      +VL      D+L+P                 +D +     + + L  + GD   +CP  Q A  +  ++ ++++ Y+F  R +    P W+GV HGYEIE++FG+P   D + N   +  +EK  ++ +M++W NFA+ G+P      +   WP YT   ++Y+ +   +    +V    + + C FWN+ LP LL+
Sbjct:   48 LRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQ--PWSGVVDATTFQSVCYQYVDTLYPGFEG--TEMWNPNRELSEDCLYLNVWTPYPRPTSPT-PVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQES---------------------VFRFSFVPVVDGDFLSDTPEALINAGDF-HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYT---DWLHP-----------------EDPA----RLREALSDVVGDHNVVCPVAQLAGRLA-AQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPL--DPSRN---YTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQYVSL---DLRPLEVRRGLRAQACAFWNRFLPKLLS 572          
BLAST of COesterase domain-containing protein vs. Ensembl Celegans
Match: ace-1 (Acetylcholinesterase 1 [Source:UniProtKB/Swiss-Prot;Acc:P38433])

HSP 1 Score: 296.204 bits (757), Expect = 5.364e-91
Identity = 188/617 (30.47%), Postives = 309/617 (50.08%), Query Frame = 3
Query:   33 SSLIVLCFCLSYDAIVVHIKIDNQTFPLKGKSIF-KMGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSR-----NNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDL---DYLYPSLT-KLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTD---FTEKGFWPAYTNKNKRYLKISGTNS--GGFKVENHFKQKHCRFWNKILPDLL 1838
            +SL+   F  S    V  I + + + PL G+ +  + GK +  F  IP+A+PP+GN RF+ P+     PW    ++T  P +C Q   +   +       MW + T +SEDCLYL ++ P     N+ L VM+W+YGG + SG++TL+VYDG IL    NV++V+  +R    GFLY++  E+PGN  + DQ + +KWV+ +I  FGGD  ++TLFGES+GA S+S+H+ S  S  YF RAI+QSG+   PWAIE    +  +A  L     C +      +   I+ C +    + L        ++ A  R+                 F D  + P+ D   + +     + +G     + LL G+N +E+++FL Y L            + P    +   ++    ++ ++ + DL     L   LT   +LHEY  Q     D   T ++ +  +D + GD  F C   + A + TK      + Y F  R +    P+W+GV+HGYEI ++FG P +       +++ D+E+ +S   M++W NFAK G+P   +   FT+   WP Y + +  Y+ ++  +S     ++ +  ++K C FW   LP+L+
Sbjct:    3 NSLLFFIFLPSTILAVDLIHLHDGS-PLFGEEVLSQTGKPLTRFQGIPFAEPPVGNLRFKKPKP--KQPWRIPLNATTPPNSCIQSEDTYFGDFYG--STMWNANTKLSEDCLYLNVYVPGKVDPNKKLAVMVWVYGGGFWSGTATLDVYDGRILTVEENVILVAMNYRVSIFGFLYMNRPEAPGNMGMWDQLLAMKWVHKNIDLFGGDLSRITLFGESAGAASVSIHMLSPKSAPYFHRAIIQSGSATSPWAIEPRDVALARAVILYNAMKCGNMSLINPDYDRILDCFQRADADALR------ENEWAPVRE-----------------FGDFPWVPVVDGDFLLENAQTSLKQGNFKKTQ-LLAGSNRDESIYFLTYQLPD----------IFPVADFFTKTDFIKDRQLWIKGVKDLLPRQILKCQLTLAAVLHEYEPQ-----DLPVTPRDWINAMDKMLGDYHFTCSVNEMALAHTK-HGGDTYYYYFTHRASQQTWPEWMGVLHGYEINFIFGEPLN----QKRFNYTDEERELSNRFMRYWANFAKTGDPNKNEDGSFTQD-VWPKYNSVSMEYMNMTVESSYPSMKRIGHGPRRKECAFWKAYLPNLM 569          
BLAST of COesterase domain-containing protein vs. Ensembl Celegans
Match: ace-1 (Acetylcholinesterase 1 [Source:UniProtKB/Swiss-Prot;Acc:P38433])

HSP 1 Score: 296.204 bits (757), Expect = 5.364e-91
Identity = 188/617 (30.47%), Postives = 309/617 (50.08%), Query Frame = 3
Query:   33 SSLIVLCFCLSYDAIVVHIKIDNQTFPLKGKSIF-KMGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSR-----NNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDL---DYLYPSLT-KLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTD---FTEKGFWPAYTNKNKRYLKISGTNS--GGFKVENHFKQKHCRFWNKILPDLL 1838
            +SL+   F  S    V  I + + + PL G+ +  + GK +  F  IP+A+PP+GN RF+ P+     PW    ++T  P +C Q   +   +       MW + T +SEDCLYL ++ P     N+ L VM+W+YGG + SG++TL+VYDG IL    NV++V+  +R    GFLY++  E+PGN  + DQ + +KWV+ +I  FGGD  ++TLFGES+GA S+S+H+ S  S  YF RAI+QSG+   PWAIE    +  +A  L     C +      +   I+ C +    + L        ++ A  R+                 F D  + P+ D   + +     + +G     + LL G+N +E+++FL Y L            + P    +   ++    ++ ++ + DL     L   LT   +LHEY  Q     D   T ++ +  +D + GD  F C   + A + TK      + Y F  R +    P+W+GV+HGYEI ++FG P +       +++ D+E+ +S   M++W NFAK G+P   +   FT+   WP Y + +  Y+ ++  +S     ++ +  ++K C FW   LP+L+
Sbjct:    3 NSLLFFIFLPSTILAVDLIHLHDGS-PLFGEEVLSQTGKPLTRFQGIPFAEPPVGNLRFKKPKP--KQPWRIPLNATTPPNSCIQSEDTYFGDFYG--STMWNANTKLSEDCLYLNVYVPGKVDPNKKLAVMVWVYGGGFWSGTATLDVYDGRILTVEENVILVAMNYRVSIFGFLYMNRPEAPGNMGMWDQLLAMKWVHKNIDLFGGDLSRITLFGESAGAASVSIHMLSPKSAPYFHRAIIQSGSATSPWAIEPRDVALARAVILYNAMKCGNMSLINPDYDRILDCFQRADADALR------ENEWAPVRE-----------------FGDFPWVPVVDGDFLLENAQTSLKQGNFKKTQ-LLAGSNRDESIYFLTYQLPD----------IFPVADFFTKTDFIKDRQLWIKGVKDLLPRQILKCQLTLAAVLHEYEPQ-----DLPVTPRDWINAMDKMLGDYHFTCSVNEMALAHTK-HGGDTYYYYFTHRASQQTWPEWMGVLHGYEINFIFGEPLN----QKRFNYTDEERELSNRFMRYWANFAKTGDPNKNEDGSFTQD-VWPKYNSVSMEYMNMTVESSYPSMKRIGHGPRRKECAFWKAYLPNLM 569          
BLAST of COesterase domain-containing protein vs. Ensembl Celegans
Match: ace-4 (Carboxylic ester hydrolase [Source:UniProtKB/TrEMBL;Acc:G5EDN1])

HSP 1 Score: 281.952 bits (720), Expect = 9.606e-86
Identity = 188/589 (31.92%), Postives = 287/589 (48.73%), Query Frame = 3
Query:  114 LKGKSIFKMGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVL------VNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEK-ISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFAD---SVTKSKSS-------KLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKGFWPAYTNKNK-RYLKI-SGTNSGGFKVENHFKQKHCRFWNKI 1823
            +KG   F + KKI  F  +P+A+P + + RFR P +     W G+YD+T     C+Q   +          +MW + T +SEDCLYL IW P  +  N  L VM+W +GG + SGS +L +YDG  L S  NV++V+  +R GP GFLYL   ++PGN  ++DQ + L WV  +IVSFGG+P KV +FG+S+GA SI  HL +  S   F+ AILQSG++   WAI S   +  K++ L E   C        + CLR   PE L      ++L +L    +  +R                            D+     LD    + EG    + +L+IG N +E  ++ +Y L   F            K   P  N T+ +  +++    +    P + +    +Y     +  D    ++    +++ I GD  F C ++  AD   S+ + KSS       K+F+Y F   ++    P W G MHGYEIEYVFG+P S  ++ N   +   E+  SR +M+FW +FAK G P          WP +  +N  R++++ SG+N    K +   KQ  C+FW ++
Sbjct:   36 IKGTEFFFLSKKIRTFFGVPFAEPAVEDFRFRKPREKKQ--WRGLYDATKPANACFQTRDNYNTSFWG--SEMWNANTQISEDCLYLNIWAPA-DAYN--LTVMVWFFGGGFYSGSPSLSIYDGKALTSTQNVIVVNINYRLGPFGFLYLGHPDAPGNMGLLDQQLALHWVRQNIVSFGGNPDKVAVFGQSAGAASIVAHLIAPGSRGLFKNAILQSGSLENTWAINSPFRAKQKSEKLLELVGCNKTTVDTSMACLRLVSPEQLSLSTWNISLTYLEFPFVIVSR----------------------------DKHFFGHLDAHAALREGDFNRDVNLMIGMNKDEGNYWNIYQLPQFF-----------DKADPPELNRTE-FDFLIDRTFSIQ---PDIIRSAA-KYIYSDPNCTDHGRKTRFYAGQMNQIVGDYFFSCDSLWLADQFRSIPRVKSSSPQRKPGKVFVYHFTQSSSANPWPKWTGAMHGYEIEYVFGIPLS--YSKN---YKRREQIFSRKIMQFWASFAKNGTPKLRVLKNSEHWPEFNEQNHYRWMQLRSGSNIRPIKPK---KQVECQFWRRV 565          
BLAST of COesterase domain-containing protein vs. Ensembl Celegans
Match: ace-2 (Carboxylic ester hydrolase [Source:UniProtKB/TrEMBL;Acc:G5EDV9])

HSP 1 Score: 278.1 bits (710), Expect = 5.298e-84
Identity = 179/560 (31.96%), Postives = 282/560 (50.36%), Query Frame = 3
Query:  141 GKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYL-DDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLY--SFNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKGFWPAYTNKNKRYLKISGTN-SGGFKVENHFKQKHCR 1808
            G K+  F  +PYAKPPIG+RRF+  E ++   W+G  ++     TC+    S   +   P  +MW     +SEDCL + IW P+ +  +    VM+WIYGG + SG+ +L++Y GS+ A+  + ++V+  +R GP GFLY  DD+   GN  +MDQ + L+WV+ +I +FGGD  +VTLFGES+G+ S + HLF+  S KYF+  I +SG+I   WA  +       +  LA+K NC+S +   IVKCLRS  P  LV       D I+       M   Y    SDA  F    F              +K++  Q   + +++ G+  +E  ++L Y +S     F  +  +        +    D Y+  +   +     Y + +KL+L+ +    +H    +   +     +    GD+ F C  I FAD ++ +    ++MY F  R++    P W+GVMHGYEIEY FG P+   +  +LY  +  +DEK +S  +M+ W NFA  G    TD     FWP Y    ++ +++  T   G  ++ +      CR
Sbjct:   57 GAKVSAFLGVPYAKPPIGSRRFKMAEMIDR--WSGELEARTLAKTCYLTIDSAFPQF--PGAEMWNPPGAISEDCLNMNIWVPEDHDGS----VMVWIYGGGFFSGTPSLDLYSGSVFAAKEHTIVVNVNYRLGPFGFLYFGDDSPIQGNMGLMDQQLALRWVHENIGAFGGDRSRVTLFGESAGSASTTAHLFAPNSHKYFRNIIAKSGSIINSWASATPPTMLDLSFRLAKKVNCSSPDMNAIVKCLRSV-PAHLVQAE---ADNISGDIGPP-MTFAYVPVSSDANFFQGDVF--------------QKLANKQFKKDVNIIFGSVKDEGTYWLPYYMSLPKYGFAFNHTISAEDPHNRALITRDHYEESMRAFMP----YFAGSKLVLNAFMNSYEHVSTSNVPEERYRDGVARFLGDLFFTCSLIDFADLISDNIFGNVYMYYFTYRSSANPWPKWMGVMHGYEIEYAFGQPY---WRPHLYDQTHLEDEKRLSSIIMQIWANFANTGR---TD----SFWPQYNKIERKAIELGETTLQGKHRIISDVHGGFCR 575          
BLAST of COesterase domain-containing protein vs. Ensembl Celegans
Match: ace-3 (Carboxylic ester hydrolase [Source:UniProtKB/TrEMBL;Acc:Q9U295])

HSP 1 Score: 261.536 bits (667), Expect = 5.249e-78
Identity = 170/584 (29.11%), Postives = 278/584 (47.60%), Query Frame = 3
Query:   87 IKIDNQTFPLKGKSIFKMGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIF-DQKIISKLD-VEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTK--SKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPT----PTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFW 1814
            +++  +   ++G       K++  F  +P+A+PPI   RF+ P      PW G   +      C+QG  S +        +MW + T +SEDCLY+ IW P  +  N  L V++W++GG +  GS +L +YDG  LA+  NV++V+  +R GP G+L+LD  + PGN  ++DQ + L W+ +HI SFGG+P +++L GES+GA SI  HL +  S+  FQ  ILQSG++   W+++S   +  K+  LA+   C      +   CLR+T  ++L++                       + ++    F +  F  +  DQ     LD    + EG   T+ +L+ G N +E  F+ +Y L+   K F+        K S       D +   ++    +    P L +    +Y        D    +    ++++ + GD  F C +I FA +  K     S +F+Y F+  ++    P W GVMHGYEIEYVFG+P      +    +  +E +VS  V+ FWT FA  G P+        T+K  W  Y   +  +       +G F++    K+  C  W
Sbjct:   32 VEVQTKLGTVRGTESDHGNKRVRSFLGVPFAEPPINEHRFKKPTPAR--PWNGTISANTLSPACFQGRDSYDPTFWG--SEMWNANTPVSEDCLYVNIWAPA-DAYN--LTVLVWLFGGGFWYGSPSLLLYDGKELATRGNVIVVNINYRVGPFGYLFLDHEDVPGNMGMLDQQLALYWIRDHIFSFGGNPARISLVGESAGAASIVAHLIAPASKGLFQNGILQSGSLDNKWSMDSPKRAKQKSTALADLVGCNQTKITDQTACLRNTPAQLLID-----------------------NIWNVGLNFLEFPFAIVSKDQNFFKHLDGFIALREGTYSTDVNLMFGINHDEGNFWNIYNLA---KFFD--------KQSVKPGLDRDEFHECVDTAFAVQ---PELVRTAA-KYVYSDPKCTDPKKKTDFYTEQVNQMVGDYFFTCDSIWFAHNYPKMAGNQSNVFVYYFDQPSSANPWPKWTGVMHGYEIEYVFGVPLH----NTTAGYTKEEMDVSEKVIDFWTTFANTGVPSLRKRAVGTTQKIKWDRYDGTD--HTTWMNIKTGSFRMIQEIKKVECDLW 564          
BLAST of COesterase domain-containing protein vs. Ensembl Fly
Match: Ace (gene:FBgn0000024 transcript:FBtr0082780)

HSP 1 Score: 251.136 bits (640), Expect = 1.200e-73
Identity = 176/637 (27.63%), Postives = 294/637 (46.15%), Query Frame = 3
Query:   72 AIVVHIKIDNQTFPLKGKSIFKMGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGA----PSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQ--------------------------INVANEL-----LPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLD-------DTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSR----NNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIG---GDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILPDL 1835
             ++  + +   + P++G+S+   G+++  ++ IPYAKPP+ + RFR P  +   PW GV D+T    TC Q      P    E      ++W   T +SEDCLY+ +W P                           I+  N       LP++IWIYGG +M+GS+TL++Y+  I+A++ NV++ SFQ+R G  GFL+L          E+PGN  + DQ + ++W+ ++  +FGG+P+ +TLFGES+G++S++  L S ++    +R ++QSGT+  PW+  +S  +    K L    NC +     N   ++ C+RS   + +             + ++     G   F S  A   D  F P     ++   D++         + D+L+G   +E  +FL+Y     F   +     LP           D Y  ++ NI        +  + I+ +Y          SW      Q    IG   GD  F CPT ++A ++ + + + +  Y F  RT+ +   +W+GV+HG EIEY FG P      +N   +   E+ + + ++     FAK GNP   D  E   WP ++ ++  Y   S T+    K+        C FWN  LP +
Sbjct:   38 GVIDRLVVQTSSGPVRGRSVTVQGREVHVYTGIPYAKPPVEDLRFRKP--VPAEPWHGVLDATRLSATCVQERYEYFPGFSGE------EIWNPNTNVSEDCLYINVWAPAKARLRHGRGANGGEHPNGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLDIYNADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQALAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLVKRGMMQSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVDAKTI-------------SVQQWNSYSGILSFPS--APTIDGAFLPADPMTLMKTADLK---------DYDILMGNVRDEGTYFLLYDFIDYFD--KDDATALPR----------DKYLEIMNNIFG--KATQAEREAIIFQY---------TSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAE-RGASVHYYYFTHRTSTSLWGEWMGVLHGDEIEYFFGQPL-----NNSLQYRPVERELGKRMLSAVIEFAKTGNPA-QDGEE---WPNFSKEDPVYYIFS-TDDKIEKLARGPLAARCSFWNDYLPKV 608          
BLAST of COesterase domain-containing protein vs. Ensembl Fly
Match: Ace (gene:FBgn0000024 transcript:FBtr0300486)

HSP 1 Score: 251.136 bits (640), Expect = 1.200e-73
Identity = 176/637 (27.63%), Postives = 294/637 (46.15%), Query Frame = 3
Query:   72 AIVVHIKIDNQTFPLKGKSIFKMGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGA----PSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQ--------------------------INVANEL-----LPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLD-------DTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSR----NNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIG---GDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILPDL 1835
             ++  + +   + P++G+S+   G+++  ++ IPYAKPP+ + RFR P  +   PW GV D+T    TC Q      P    E      ++W   T +SEDCLY+ +W P                           I+  N       LP++IWIYGG +M+GS+TL++Y+  I+A++ NV++ SFQ+R G  GFL+L          E+PGN  + DQ + ++W+ ++  +FGG+P+ +TLFGES+G++S++  L S ++    +R ++QSGT+  PW+  +S  +    K L    NC +     N   ++ C+RS   + +             + ++     G   F S  A   D  F P     ++   D++         + D+L+G   +E  +FL+Y     F   +     LP           D Y  ++ NI        +  + I+ +Y          SW      Q    IG   GD  F CPT ++A ++ + + + +  Y F  RT+ +   +W+GV+HG EIEY FG P      +N   +   E+ + + ++     FAK GNP   D  E   WP ++ ++  Y   S T+    K+        C FWN  LP +
Sbjct:   38 GVIDRLVVQTSSGPVRGRSVTVQGREVHVYTGIPYAKPPVEDLRFRKP--VPAEPWHGVLDATRLSATCVQERYEYFPGFSGE------EIWNPNTNVSEDCLYINVWAPAKARLRHGRGANGGEHPNGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLDIYNADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQALAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLVKRGMMQSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVDAKTI-------------SVQQWNSYSGILSFPS--APTIDGAFLPADPMTLMKTADLK---------DYDILMGNVRDEGTYFLLYDFIDYFD--KDDATALPR----------DKYLEIMNNIFG--KATQAEREAIIFQY---------TSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAE-RGASVHYYYFTHRTSTSLWGEWMGVLHGDEIEYFFGQPL-----NNSLQYRPVERELGKRMLSAVIEFAKTGNPA-QDGEE---WPNFSKEDPVYYIFS-TDDKIEKLARGPLAARCSFWNDYLPKV 608          
BLAST of COesterase domain-containing protein vs. Ensembl Fly
Match: Ace (gene:FBgn0000024 transcript:FBtr0335223)

HSP 1 Score: 249.98 bits (637), Expect = 2.194e-73
Identity = 176/637 (27.63%), Postives = 294/637 (46.15%), Query Frame = 3
Query:   72 AIVVHIKIDNQTFPLKGKSIFKMGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGA----PSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQ--------------------------INVANEL-----LPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLD-------DTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSR----NNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIG---GDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILPDL 1835
             ++  + +   + P++G+S+   G+++  ++ IPYAKPP+ + RFR P  +   PW GV D+T    TC Q      P    E      ++W   T +SEDCLY+ +W P                           I+  N       LP++IWIYGG +M+GS+TL++Y+  I+A++ NV++ SFQ+R G  GFL+L          E+PGN  + DQ + ++W+ ++  +FGG+P+ +TLFGES+G++S++  L S ++    +R ++QSGT+  PW+  +S  +    K L    NC +     N   ++ C+RS   + +             + ++     G   F S  A   D  F P     ++   D++         + D+L+G   +E  +FL+Y     F   +     LP           D Y  ++ NI        +  + I+ +Y          SW      Q    IG   GD  F CPT ++A ++ + + + +  Y F  RT+ +   +W+GV+HG EIEY FG P      +N   +   E+ + + ++     FAK GNP   D  E   WP ++ ++  Y   S T+    K+        C FWN  LP +
Sbjct:   38 GVIDRLVVQTSSGPVRGRSVTVQGREVHVYTGIPYAKPPVEDLRFRKP--VPAEPWHGVLDATRLSATCVQERYEYFPGFSGE------EIWNPNTNVSEDCLYINVWAPAKARLRHGRGANGGEHPNGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLDIYNADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQALAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLVKRGMMQSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVDAKTI-------------SVQQWNSYSGILSFPS--APTIDGAFLPADPMTLMKTADLK---------DYDILMGNVRDEGTYFLLYDFIDYFD--KDDATALPR----------DKYLEIMNNIFG--KATQAEREAIIFQY---------TSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAE-RGASVHYYYFTHRTSTSLWGEWMGVLHGDEIEYFFGQPL-----NNSLQYRPVERELGKRMLSAVIEFAKTGNPA-QDGEE---WPNFSKEDPVYYIFS-TDDKIEKLARGPLAARCSFWNDYLPKV 608          
BLAST of COesterase domain-containing protein vs. Ensembl Fly
Match: CG6414 (gene:FBgn0029690 transcript:FBtr0070624)

HSP 1 Score: 180.644 bits (457), Expect = 1.547e-48
Identity = 102/300 (34.00%), Postives = 154/300 (51.33%), Query Frame = 3
Query:   39 LIVLCFCLSY----DAIVVHIKIDNQTFPLKGKSIFKMGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTVM---SEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSA-SYIKAKYLAEKANCTSRNN-QEIVKCLRSTKPEVLV 911
            +I+LC C+ +    ++  +H+++ +  + +        G+ +  F  +PYA+PP+ + RFR P  +   PW G   +      C Q  P              F + ++   SEDCLYL ++TP+    N  LPVM+W +GG +  GS     Y    L   H++V+VS  FR GPLGFL  +  + PGN  + DQ  +L WV  +I SFGGDP  VT+FGES+G  S++ H+ S+ S     R I QSGT F PWA  +    +  +A  LA+   C +     E ++CLR    E +V
Sbjct:   12 VILLCICIQWSDGRNSQCLHVRLSHGGWLIGRHLTTHNGRHMRAFMGVPYAEPPLDDLRFRPP--VPKAPWEGERLAIKDAPICLQRDP--------------FRRDMILEGSEDCLYLNVYTPERPRTNGSLPVMVWFHGGGWQCGSGISSFYGPDFLLD-HDIVLVSANFRLGPLGFLSTETLDCPGNNGLKDQLEVLHWVRANIASFGGDPNSVTVFGESAGGASVTYHMLSEKSRGLLHRGIAQSGTYFNPWAQPAHKGVAAGRATKLAQIVGCGNAGEWPEKLECLRKKPAEDIV 294          
BLAST of COesterase domain-containing protein vs. Ensembl Fly
Match: CG6414 (gene:FBgn0029690 transcript:FBtr0445312)

HSP 1 Score: 180.644 bits (457), Expect = 1.547e-48
Identity = 102/300 (34.00%), Postives = 154/300 (51.33%), Query Frame = 3
Query:   39 LIVLCFCLSY----DAIVVHIKIDNQTFPLKGKSIFKMGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTVM---SEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSA-SYIKAKYLAEKANCTSRNN-QEIVKCLRSTKPEVLV 911
            +I+LC C+ +    ++  +H+++ +  + +        G+ +  F  +PYA+PP+ + RFR P  +   PW G   +      C Q  P              F + ++   SEDCLYL ++TP+    N  LPVM+W +GG +  GS     Y    L   H++V+VS  FR GPLGFL  +  + PGN  + DQ  +L WV  +I SFGGDP  VT+FGES+G  S++ H+ S+ S     R I QSGT F PWA  +    +  +A  LA+   C +     E ++CLR    E +V
Sbjct:   12 VILLCICIQWSDGRNSQCLHVRLSHGGWLIGRHLTTHNGRHMRAFMGVPYAEPPLDDLRFRPP--VPKAPWEGERLAIKDAPICLQRDP--------------FRRDMILEGSEDCLYLNVYTPERPRTNGSLPVMVWFHGGGWQCGSGISSFYGPDFLLD-HDIVLVSANFRLGPLGFLSTETLDCPGNNGLKDQLEVLHWVRANIASFGGDPNSVTVFGESAGGASVTYHMLSEKSRGLLHRGIAQSGTYFNPWAQPAHKGVAAGRATKLAQIVGCGNAGEWPEKLECLRKKPAEDIV 294          
BLAST of COesterase domain-containing protein vs. Ensembl Zebrafish
Match: ache (acetylcholinesterase [Source:NCBI gene;Acc:114549])

HSP 1 Score: 285.419 bits (729), Expect = 1.284e-86
Identity = 199/644 (30.90%), Postives = 298/644 (46.27%), Query Frame = 3
Query:   51 CFCLSYDAIVVHIK---IDNQTFPLKGKSIFKMGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQ-------GAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLD-DTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSS----NFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTK-----SKSS------------------------KLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNP---TPTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILPDLLN 1841
            CF  +   +VV  +   +     P+  +S       +  F  IPYA+PPIG RRF+  E     PW  V+++      C+Q       G P IE         MW    VMSEDCLYL +W P       L  VM+WIYGG + SGSS+L+VYDG  LA    VV+VS  +R G  GFL L+  +++PGN  + DQ + L+WV  +I  FGG+PK+VT+FGES+GA S+ +H+ S  S   F RAILQSG    PWA  +   +  +   L +   CT  N+ E++ CLR+  P+ L++  + +    +                      F   F P+ D           IS G     + +L+G N +E  +FL+YG       N  L      +   KM  P  N      I LE ++                  +Q   + D++   ++    +D I GD   ICP   FA S  +     ++SS                         +++YLF+ R +    P+W+GV+HGYEIE+VFG+P          ++  +E+ +SR +M++W NFA+ GNP   T      +  WP ++   ++++   G N+   KV    + + C  WN+ LP LLN
Sbjct:   21 CFAQAEPDLVVATRLGRVQGTRLPVPDRS------HVIAFLGIPYAEPPIGKRRFKRAEP--KKPWNNVFEAKEFSNACYQFVDTSYPGFPGIE---------MWNPNRVMSEDCLYLNVWVPPTPRPQNLT-VMVWIYGGGFYSGSSSLDVYDGRYLAYTEKVVVVSMNYRVGAFGFLALNGSSDAPGNVGLYDQRLALQWVQENIHFFGGNPKQVTIFGESAGAASVGMHVLSPDSRPLFTRAILQSGVPNTPWATVTFDEARRRTTKLGKLVGCTWGNDTELIDCLRNKHPQELIDQEWQVLPWSS---------------------LFRFSFVPVVDGVFFPDTPDAMISSGNFKYTQ-ILLGVNQDEGSYFLLYGAPGFSKDNESLISREDFLESVKMGVPHAN-----DIGLEAVI------------------LQYTDWMDEN-NGQKNRDAMDDIVGDQNVICPLQHFAKSYAQYAALHAQSSAAAPGTLGWGNSGPTGYNSGNSHGAVYLYLFDHRASNLAWPEWMGVIHGYEIEFVFGLPLEKRL-----NYTAEEEKLSRRIMRYWANFARTGNPNVNTDGTMDSRRRWPQFSANEQKHV---GLNTEPMKVHKGLRTQFCALWNRFLPRLLN 592          
BLAST of COesterase domain-containing protein vs. Ensembl Zebrafish
Match: nlgn2a (neuroligin 2a [Source:ZFIN;Acc:ZDB-GENE-090918-2])

HSP 1 Score: 240.35 bits (612), Expect = 2.324e-68
Identity = 178/584 (30.48%), Postives = 274/584 (46.92%), Query Frame = 3
Query:  168 IPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTV---------MSEDCLYLTIWTPQINVANELL--PVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQK-LDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGN---PTPTDFT---------EKGFWPAYTNKNKRYLKISGTNSGGFK--VENHFKQKHCRFWNKILPDLLN 1841
            +PYA  PIG+RRF+ PE   +  W  V ++T     C Q    +  E+  P+   WF+ ++          SEDCLYL ++ P  +   +    PVM++I+GGSYM G+  +  +D S+LA+  NV++V+  +R G LGFL   D  + GN  ++DQ   L+W+N +I  FGGDP+++T+FG  +GA+ +++ + S  SE  FQRAI QSG+    W+I      Y   K LA K  CT     ++V CLR        N   L+   I   R                   + I F P+ D  ++   D E + +     N DLLIG N  E + F+  G +      ES + +  +   Y            + N +D  Y YP   K IL E  I+  + D     + E+ +K L  +  D Q++ P I  A  +     S ++ Y F         P+W    HG EI YVFG+P          +F+ ++  +S  VM +WTNFAK G+   P P D           E+  W  + +K+K+YL I      G K  + ++++     FW +++P L N
Sbjct:   77 VPYATAPIGDRRFQPPEAPGS--WQEVRNATQFAPVCPQNVHGVLPEIMLPV---WFTDSLDVAATYIQNQSEDCLYLNVYVPTEDDIRDRRKKPVMLFIHGGSYMEGTGNM--FDASVLAAYGNVIVVTMNYRLGVLGFLSTGDQSAKGNYGLLDQIQALRWLNENIGHFGGDPERITIFGSGAGASCVNLLILSHHSEGLFQRAIAQSGSAISSWSISYQPLKY--TKILARKVGCTYGETADLVDCLRRK------NFRELVDQDIQPAR-------------------YHIAFGPVMDGDVVPD-DPEILMQQGEFLNYDLLIGVNQGEGLKFVDDGGT------ESEEGISAAAFDY-----------TISNFVDNLYGYPK-GKDILRE-TIKFMYTDWADRDNGEMRRKTLLALFTDHQWVAPAIATA-KLHADYQSPVYFYTFYHHCQTETRPEWADAAHGDEIPYVFGVPMIGATDLFPCNFSKNDIMLSAVVMTYWTNFAKTGDPNLPVPQDTKFIHTKPNRFEEVIWTKFNSKDKQYLHI------GLKPRIRDNYRANKVAFWLELVPHLHN 599          
BLAST of COesterase domain-containing protein vs. Ensembl Zebrafish
Match: nlgn4xa (neuroligin 4 X-linked a [Source:ZFIN;Acc:ZDB-GENE-100309-2])

HSP 1 Score: 238.039 bits (606), Expect = 1.957e-67
Identity = 182/591 (30.80%), Postives = 269/591 (45.52%), Query Frame = 3
Query:  168 IPYAKPPIGNRRFRYPEKLNNPP--WTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTV---------MSEDCLYLTIWTP---QINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKE----ILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPT-------------PTDFTEKGFWPAYTNKNKRYLKISGTNSGGFK--VENHFKQKHCRFWNKILPDLLN 1841
            IPYA PP G RRF+ PE    PP  W G+ ++T     C Q     +  L N +  +WF+  +          SEDCLYL I+ P    I+  N L PVM++I+GGSYM G+  +   DGSILAS  NV++V+  +R G LGFL   D  + GN  ++DQ   L+W+  +I +F GDPK+VT+FG  +GA+ +S+   S  SE  FQ+AI+QSGT    WA+    A Y   + LAEK  C   ++ ++V+CL++       N   LI   I + +                   + I F P+ D  +I   D + + E     N D+++G N  E   F+   + S   +  +                   +   + + +D  Y YP   K  L E    +  F    W  KE      + L  +  D Q++ P +  AD +     S  + Y F         P W    HG E+ YVFG+P          +F+ ++  +S  VM +WTNFAK G+P              P  F E   W  Y  K++ YL I      G K  V +H++     FW +++P L N
Sbjct:   73 IPYALPPTGERRFQPPE----PPMSWPGIRNATQFAPVCPQFLE--DRFLLNDMLPVWFTANLDTVVTYVQDQSEDCLYLNIYVPTEDDIHDENGLRPVMVYIHGGSYMEGTGNM--IDGSILASYGNVIVVTLNYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWIKENIQAFKGDPKRVTIFGSGAGASCVSLLTLSHYSEDLFQKAIIQSGTALSSWAVNYQPAKY--TRILAEKVGCNMLDSIDLVECLQNK------NYKELIEQYITQAK-------------------YHIAFGPVIDGDVIPD-DPQILMEQGEFLNYDIMLGVNQGEGFKFVDGIVDSEDGVSAND------------------FDFAVSDFVDHLYGYPE-GKDTLRE----TIKFMYTDWADKENPETRRKTLVALFTDHQWVAPAVATAD-LHAQYGSPTYFYAFYHHCQSEMKPSWSDSAHGDEVPYVFGIPMLGPTDLFNCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVA-WSKYNPKDQLYLHI------GLKPRVRDHYRATKVAFWLELVPHLHN 596          
BLAST of COesterase domain-containing protein vs. Ensembl Zebrafish
Match: nlgn4xb (neuroligin 4 X-linked b [Source:ZFIN;Acc:ZDB-GENE-100309-1])

HSP 1 Score: 233.802 bits (595), Expect = 4.344e-66
Identity = 179/594 (30.13%), Postives = 269/594 (45.29%), Query Frame = 3
Query:  150 IFHFSKIPYAKPPIGNRRFRYPEKLNNPP--WTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTV---------MSEDCLYLTIWTPQINVANE---LLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQK-LDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPT-------------PTDFTEKGFWPAYTNKNKRYLKISGTNSGGFK--VENHFKQKHCRFWNKILPDLLN 1841
            +  F  +PYA  P G RRF+ PE    PP  W G+ ++T     C Q     +  L   +  +WF+  +          SEDCLYL I+ P      +   L PVM++I+GGSY+ G+  +   DGS+LAS  NV++V+  +R G LGFL   D  + GN  ++DQ   L+WV  +I SF GDP++VT+FG  +GA+ +S+   S  SE  FQ+AI+QSGT    WA+    A Y   + LAEK  C   +  E+++CL+S       N   LI   I   +                   + I F P+ D  +I   D + + E     N D+++G N  E   F+   L S  ++  +                   ++  +   +D  Y YP   K  L E  I+  + D     + E+ +K L  +  D Q++ P +  AD +     S  + Y F         P W    HG E+ YVFG+P          +F+ ++  +S  VM +WTNFAK G+P              P  F E   W  Y  K++ YL I      G K  V +H++     FW +++P L N
Sbjct:   47 VEQFLGVPYAMAPTGERRFQAPE----PPLSWPGIRNATQFAPVCPQFLE--DRLLLTDMLPVWFTANLDTVATYVHDQSEDCLYLNIYVPTEEETQDDAGLKPVMVYIHGGSYVEGTGNM--IDGSVLASYGNVIVVTVNYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWVKENIQSFSGDPERVTIFGSGAGASCVSLLTLSHYSEDLFQKAIIQSGTALSSWAVNYQPAKY--TRLLAEKVGCNEDDTLELIECLQSK------NYKELIEQNITPAK-------------------YHIAFGPVIDGDVIPD-DPQILMEQGEFLNYDIMLGVNQGEGYKFVDGILDSEDRVTSND------------------FEFAISEFVDHLYGYPE-GKDTLRE-TIKFMYTDWADRENPEMRRKTLVALFTDHQWVAPAVATAD-LHAQYGSPTYFYAFYHHCQSDMKPAWADSSHGDELPYVFGIPMIGPTDLFNCNFSKNDIMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVA-WSKYNPKDQLYLHI------GLKPRVRDHYRATKIAFWLELVPHLHN 576          
BLAST of COesterase domain-containing protein vs. Ensembl Zebrafish
Match: nlgn4xb (neuroligin 4 X-linked b [Source:ZFIN;Acc:ZDB-GENE-100309-1])

HSP 1 Score: 233.802 bits (595), Expect = 4.344e-66
Identity = 179/594 (30.13%), Postives = 269/594 (45.29%), Query Frame = 3
Query:  150 IFHFSKIPYAKPPIGNRRFRYPEKLNNPP--WTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTV---------MSEDCLYLTIWTPQINVANE---LLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQK-LDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPT-------------PTDFTEKGFWPAYTNKNKRYLKISGTNSGGFK--VENHFKQKHCRFWNKILPDLLN 1841
            +  F  +PYA  P G RRF+ PE    PP  W G+ ++T     C Q     +  L   +  +WF+  +          SEDCLYL I+ P      +   L PVM++I+GGSY+ G+  +   DGS+LAS  NV++V+  +R G LGFL   D  + GN  ++DQ   L+WV  +I SF GDP++VT+FG  +GA+ +S+   S  SE  FQ+AI+QSGT    WA+    A Y   + LAEK  C   +  E+++CL+S       N   LI   I   +                   + I F P+ D  +I   D + + E     N D+++G N  E   F+   L S  ++  +                   ++  +   +D  Y YP   K  L E  I+  + D     + E+ +K L  +  D Q++ P +  AD +     S  + Y F         P W    HG E+ YVFG+P          +F+ ++  +S  VM +WTNFAK G+P              P  F E   W  Y  K++ YL I      G K  V +H++     FW +++P L N
Sbjct:   47 VEQFLGVPYAMAPTGERRFQAPE----PPLSWPGIRNATQFAPVCPQFLE--DRLLLTDMLPVWFTANLDTVATYVHDQSEDCLYLNIYVPTEEETQDDAGLKPVMVYIHGGSYVEGTGNM--IDGSVLASYGNVIVVTVNYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWVKENIQSFSGDPERVTIFGSGAGASCVSLLTLSHYSEDLFQKAIIQSGTALSSWAVNYQPAKY--TRLLAEKVGCNEDDTLELIECLQSK------NYKELIEQNITPAK-------------------YHIAFGPVIDGDVIPD-DPQILMEQGEFLNYDIMLGVNQGEGYKFVDGILDSEDRVTSND------------------FEFAISEFVDHLYGYPE-GKDTLRE-TIKFMYTDWADRENPEMRRKTLVALFTDHQWVAPAVATAD-LHAQYGSPTYFYAFYHHCQSDMKPAWADSSHGDELPYVFGIPMIGPTDLFNCNFSKNDIMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVA-WSKYNPKDQLYLHI------GLKPRVRDHYRATKIAFWLELVPHLHN 576          
BLAST of COesterase domain-containing protein vs. Ensembl Xenopus
Match: nfasc (neurofascin [Source:Xenbase;Acc:XB-GENE-922969])

HSP 1 Score: 319.701 bits (818), Expect = 4.362e-100
Identity = 198/622 (31.83%), Postives = 318/622 (51.13%), Query Frame = 3
Query:   24 FEASSLIVLCFCLSYDAIVV--HIKIDNQTFPLKGKSIFKMGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPP--WTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYL-DDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFES----SKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILPDLLNRLLNKKN 1862
            F A  L+ +    S D +++  H K+       KG  I  +   +  F  IPYA+PP+G+ RF+ P    NPP  W+ V  ++    +C+Q  P   F   +   +MW   T +SEDCLYL +W P        + VM+WIYGG +++G+S+L+VYDG  LA++  V++VS  +R G LGFL +  + ++PGN  + DQ + L+W+  +I +FGG+P+ +T+FGES+GA S+S HL S  S  YF RAI+QSG+   PW   + + +  +A  LA +  C+   + +I+ CLR                   KT KE   K  Y     D A+  ++ F P  D   ++++  + +  GQL  N  +L G N +E  +FL+YG+    K  +S    ++     ++S+P        ++ +E+IL     +  +    L+                      +D + GD  FICP ++F    +      +++Y F  R++    P+W+GV+HGYEIE+VFG P          ++   E+ +SR+VM+ W NFAK GNP   D  +   WPA+T   +RYL I   +S         + K C+FWN+  P +L+  +N++N
Sbjct:   14 FAALCLLFVTCITSEDQVILTKHGKV-------KGVQIPVLSGTVTAFLGIPYAEPPVGDLRFKKP----NPPKSWSDVLYASKYGNSCFQ-IPDETFPGFSG-AEMWNPNTEVSEDCLYLNVWVPDPQPTG--VSVMVWIYGGGFVTGTSSLDVYDGKFLAAVEQVIVVSMNYRLGALGFLSIPGNADAPGNVGLFDQRLALEWIYENIATFGGNPQSITIFGESAGAASVSYHLLSPKSHPYFTRAIMQSGSANAPWGAINKTEARHRALILANQLGCSYETDNKIIACLR------------------GKTPKEISDKADYVIPPGDRAI-IEMTFPPSVDGDFLTEMPEQLLQLGQLKKNTQILTGVNKDEGSYFLVYGMPGFSKDHDSYINRTQFEESVRLSFPKAA-----ELAVESILFYYADWEGVRNPALYR-------------------DAMDDVVGDYNFICPLLEFTKRASH-LGDNVYLYFFQHRSSQLAWPEWMGVIHGYEIEFVFGKPLDEKL-----NYTKQEETLSRAVMRQWANFAKTGNPNGADPLQNQ-WPAFTLDEQRYLMIGAGDS---LTGRQMRNKQCQFWNEFYPKVLD--INQQN 565          
BLAST of COesterase domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000046462.1 (butyrylcholinesterase [Source:NCBI gene;Acc:100495889])

HSP 1 Score: 318.546 bits (815), Expect = 2.955e-99
Identity = 198/599 (33.06%), Postives = 298/599 (49.75%), Query Frame = 3
Query:   45 VLCFCLSYDAIVVHIKIDNQTFPLKGKSIFKMGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFL-YLDDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILPDLL 1838
            V+C C         I +D +   + G  I      I  F  IPYA+PPIG+ RF+ P  + + PW+ +++++    +C+Q    I         +MW   T +SEDCLYL IW P     N    VM+WIYGGS+ +G+S+L++YDG  LA    V++VS  +R G LGFL +  + E+PGN  + DQ + L+WV  +I +FGG+PK +T+FGES+G  S+S H+ S  S  +F RAI+QS T   PWA+ + + +  +A  LA   NC  RN  EI+ CLR+  PE        I ++       + + E              + F P  D   + ++    +  GQL     +L G N +E  +FL+YGL    K  ES              N T  +K V          +P  T+L +        +++D+   S      +D I GD  FICP ++F         +  ++Y F+ R++    P W+GVMHGYEIE+VFG+P          ++   E+ +SR++M++W NFAK GNP     +E   WP +T   + YL +   +S   K     + K CRFWN   P +L
Sbjct:   18 VVCICCVNCNGETDI-VDTKYGKVTGVQISVFSGIITAFLGIPYAEPPIGDLRFKKP--VPHKPWSEIWNASQYGNSCYQTVDQIFPGFSG--AEMWNPNTQLSEDCLYLNIWIPTPKPRNA--SVMVWIYGGSFETGTSSLDLYDGKFLARTERVIVVSMNYRLGALGFLAFPGNNEAPGNVGLFDQRLALQWVYENIAAFGGNPKSITIFGESAGGASVSYHMLSPKSHGFFTRAIMQSATANAPWAVITKAEASNRALTLANLLNCFYRNETEIIACLRNKSPEE-------IFEKAVSVLPHRSVIE--------------VNFPPTVDGDFLIEMPEILMQLGQLKKKTQILTGVNKDEGSYFLVYGLPGFSKDHESFI------------NRTQFHKSV-------KLAFPKATELAIDSVLFHYTNWEDEQNPSHN-RDAMDDIVGDYNFICPLLEFT-KWNSELGNNAYLYYFHHRSSKLTWPGWMGVMHGYEIEFVFGIPMYRRL-----NYTKAEETLSRTLMRYWANFAKTGNPNGAQSSENR-WPVFTLDEQHYLMLGTEDS---KTNRKMRAKQCRFWNNFYPKVL 558          
BLAST of COesterase domain-containing protein vs. Ensembl Xenopus
Match: ACHE (acetylcholinesterase (Cartwright blood group) [Source:NCBI gene;Acc:100490673])

HSP 1 Score: 296.975 bits (759), Expect = 3.975e-91
Identity = 188/581 (32.36%), Postives = 289/581 (49.74%), Query Frame = 3
Query:  138 MGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQ-------GAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYL--DDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGL----SSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILPDLLN 1841
            +   +  F  IP+A+PP+   RFR  E     PWT V+D+T  P  C+Q       G P +E         MW     MSEDCLYL IW P    +N    VM+WIYGG + SGSS+L+VYDG  L    NV++VS  +R G  GFL L     ++PGN  + DQ + L+WV ++I  FGGDP+ VT+FGES+GA S+ +H+ S  S   F +A LQSG+   PWA  +   +  + + L +  +C   N+ E++ CLR  +P+ L++  F +                       A   F   F P+ D     +     ++ G+      L++G N NE  +FL+YG      +N  L    + +   KMS P  N      I LE ++ + Y     T       G++++             + +D + GD   ICP   FA  V ++  ++++ Y F+ R +    P W+GV HGYEIE+VFG+P  ++      ++   E+ +SR +M++W NFA+ G+P   +   +  WP YT   +RY+ +   N+  ++     + + C FWN+ LP LLN
Sbjct:   46 LSTHVSAFLGIPFAEPPVDKMRFRRSEP--KKPWTDVWDATAYPNACYQYFDTLYPGFPGME---------MWNPNRPMSEDCLYLNIWVPHPRPSNAT--VMVWIYGGGFYSGSSSLDVYDGRYLCHAENVIVVSMNYRVGAFGFLTLTPGSVDAPGNVGLFDQRLALQWVQDNIAFFGGDPRTVTIFGESAGAVSVGMHVLSPGSHHLFSKAALQSGSPNTPWATITPQEARRRTELLGKFLDCRMGNDTELLNCLRVKQPQELIDHEFSVL---------------------PAPSVFRFAFVPVPDADFFPEPPEILMNMGRFKPCP-LIMGVNQNEGSYFLLYGAPGFSKNNESLITREEFLGGVKMSVPQAN-----DIALEAVV-MQY-----TDWADEHAGVKNR-------------EAMDQLVGDHNVICPLTYFAGKVAET-GNRVYTYFFDHRASNLAWPQWMGVPHGYEIEFVFGLPLDANL-----NYTPQEEALSRRMMRYWANFARTGDPNEGNDAHQPRWPLYTASEQRYMAL---NNKPYQELQGIRVQTCMFWNRFLPKLLN 558          
BLAST of COesterase domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000017364.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:8:101032473:101036224:1 gene:ENSXETG00000008778.1 transcript:ENSXETT00000017364.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 268.085 bits (684), Expect = 8.340e-81
Identity = 183/565 (32.39%), Postives = 279/565 (49.38%), Query Frame = 3
Query:  168 IPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYL-DDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSW----TSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKGF-WPAYTNKNKRY--LKISGTNSGGFKVENHFKQKHCRFWNKILPDLL 1838
            IPY +PP G  RF+  E+    PW GV  +     +C+Q   +   E   P  +M+     MSEDCL+L +W P     +    VM++I+GG + SG+++L++YDGS+LA   NV++VS  +R G  GFL L    ++PGN  + DQ + L+W+N +I +FGG+P +VT+FG S+GA S+  HL S  S  Y+ RAI+QSG+    WA+ S   +   A  LAE   C   ++  I+ CL +  P+ L             T K+ L KE Y       AL     F PI D   +  +DV +   GQ +   D+L+G   ++   F + G S++F +   S I                     E +  L   +PS   L     GIQS     K W      ++  Q ++ I  D  F CP   FA    + +++ +F Y ++ R++    P+W+G +HG E+  +FG PF      N   +   E   S+ +MK W NFA+ G       TE GF WP Y+ K+++Y  LK++G+     +V      ++C+FWN   P LL
Sbjct:   35 IPYGEPPTGRLRFKKTEQ--RKPWHGVLKADKFGKSCFQNRENKFAEF--PGTEMFLVNNEMSEDCLHLNVWVPPSKPKDA--HVMVFIHGGGFESGTTSLDIYDGSVLAYAENVIVVSMNYRVGAFGFLALPGHKDAPGNAGLFDQRLALQWINENIAAFGGNPDRVTIFGHSAGAASVGFHLISTKSYPYYNRAIVQSGSGTSNWALNSEERAKRLALKLAEVLECPQTDDDAIITCLLNEDPKHL-------------TEKQLLAKEPY-------AL---TQFLPIVDHDFL--VDVPENVLGQSMKRTDILLGITKDDGNPFTLIG-STDFNIQTESSIS------------------SAELLERLKRFFPSAGDL-----GIQSILLQYKDWEDVNNGEKNRQAMELILRDYYFACPVKGFARYAVEHQNN-VFFYEYDHRSSNDPWPEWMGALHGAELPMLFGKPF-----INKGRYTRSELLFSKRIMKLWANFARTGYKLVG--TENGFVWPQYSLKDEKYAVLKLNGS-----EVHQMLSMRNCQFWNFFFPSLL 531          
BLAST of COesterase domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000032055.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:8:101032639:101036224:1 gene:ENSXETG00000008778.1 transcript:ENSXETT00000032055.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 267.7 bits (683), Expect = 2.279e-80
Identity = 183/565 (32.39%), Postives = 279/565 (49.38%), Query Frame = 3
Query:  168 IPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYL-DDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSW----TSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKGF-WPAYTNKNKRY--LKISGTNSGGFKVENHFKQKHCRFWNKILPDLL 1838
            IPY +PP G  RF+  E+    PW GV  +     +C+Q   +   E   P  +M+     MSEDCL+L +W P     +    VM++I+GG + SG+++L++YDGS+LA   NV++VS  +R G  GFL L    ++PGN  + DQ + L+W+N +I +FGG+P +VT+FG S+GA S+  HL S  S  Y+ RAI+QSG+    WA+ S   +   A  LAE   C   ++  I+ CL +  P+ L             T K+ L KE Y       AL     F PI D   +  +DV +   GQ +   D+L+G   ++   F + G S++F +   S I                     E +  L   +PS   L     GIQS     K W      ++  Q ++ I  D  F CP   FA    + +++ +F Y ++ R++    P+W+G +HG E+  +FG PF      N   +   E   S+ +MK W NFA+ G       TE GF WP Y+ K+++Y  LK++G+     +V      ++C+FWN   P LL
Sbjct:   59 IPYGEPPTGRLRFKKTEQ--RKPWHGVLKADKFGKSCFQNRENKFAEF--PGTEMFLVNNEMSEDCLHLNVWVPPSKPKDA--HVMVFIHGGGFESGTTSLDIYDGSVLAYAENVIVVSMNYRVGAFGFLALPGHKDAPGNAGLFDQRLALQWINENIAAFGGNPDRVTIFGHSAGAASVGFHLISTKSYPYYNRAIVQSGSGTSNWALNSEERAKRLALKLAEVLECPQTDDDAIITCLLNEDPKHL-------------TEKQLLAKEPY-------AL---TQFLPIVDHDFL--VDVPENVLGQSMKRTDILLGITKDDGNPFTLIG-STDFNIQTESSIS------------------SAELLERLKRFFPSAGDL-----GIQSILLQYKDWEDVNNGEKNRQAMELILRDYYFACPVKGFARYAVEHQNN-VFFYEYDHRSSNDPWPEWMGALHGAELPMLFGKPF-----INKGRYTRSELLFSKRIMKLWANFARTGYKLVG--TENGFVWPQYSLKDEKYAVLKLNGS-----EVHQMLSMRNCQFWNFFFPSLL 555          
BLAST of COesterase domain-containing protein vs. Ensembl Mouse
Match: Ache (acetylcholinesterase [Source:MGI Symbol;Acc:MGI:87876])

HSP 1 Score: 319.316 bits (817), Expect = 1.319e-99
Identity = 185/585 (31.62%), Postives = 292/585 (49.91%), Query Frame = 3
Query:  114 LKGKSIFKMGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDT-ESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANC----TSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSS----NFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILPDLLN 1841
            L+G  +   G  +  F  IP+A+PP+G+RRF  PE     PW+GV D+T     C+Q   ++    +    +MW     +SEDCLYL +WTP    A+   PV+IWIYGG + SG+++L+VYDG  LA +   V+VS  +R G  GFL L  + E+PGN  ++DQ + L+WV  +I +FGGDP  VTLFGES+GA S+ +H+ S  S   F RA+LQSGT   PWA  S+  +  +A  LA    C       N+ E++ CLR+   + LV+  + +  Q +                      F   F P+ D   +S      I+ G    +  +L+G   +E  +FL+YG+      N  L   ++ +   ++  P  +      +VL      D+L+P               H  D           +  + GD   +CP  Q A  +  ++ ++++ Y+F  R +    P W+GV HGYEIE++FG+P          ++  +E+  ++ +MK+WTNFA+ G+P     ++   WP YT   ++Y+ +   N    +V    + + C FWN+ LP LL+
Sbjct:   48 LRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKR--PWSGVLDATTFQNVCYQYVDTLYPGFEG--TEMWNPNRELSEDCLYLNVWTPYPRPASPT-PVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLALPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVSAGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQES---------------------IFRFSFVPVVDGDFLSDTPEALINTGDF-QDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYT---DWLHPE-----------DPTHLRD----------AMSAVVGDHNVVCPVAQLAGRLA-AQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSL-----NYTTEERIFAQRLMKYWTNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSL---NLKPLEVRRGLRAQTCAFWNRFLPKLLS 572          
BLAST of COesterase domain-containing protein vs. Ensembl Mouse
Match: Ache (acetylcholinesterase [Source:MGI Symbol;Acc:MGI:87876])

HSP 1 Score: 319.316 bits (817), Expect = 1.319e-99
Identity = 185/585 (31.62%), Postives = 292/585 (49.91%), Query Frame = 3
Query:  114 LKGKSIFKMGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDT-ESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANC----TSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSS----NFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILPDLLN 1841
            L+G  +   G  +  F  IP+A+PP+G+RRF  PE     PW+GV D+T     C+Q   ++    +    +MW     +SEDCLYL +WTP    A+   PV+IWIYGG + SG+++L+VYDG  LA +   V+VS  +R G  GFL L  + E+PGN  ++DQ + L+WV  +I +FGGDP  VTLFGES+GA S+ +H+ S  S   F RA+LQSGT   PWA  S+  +  +A  LA    C       N+ E++ CLR+   + LV+  + +  Q +                      F   F P+ D   +S      I+ G    +  +L+G   +E  +FL+YG+      N  L   ++ +   ++  P  +      +VL      D+L+P               H  D           +  + GD   +CP  Q A  +  ++ ++++ Y+F  R +    P W+GV HGYEIE++FG+P          ++  +E+  ++ +MK+WTNFA+ G+P     ++   WP YT   ++Y+ +   N    +V    + + C FWN+ LP LL+
Sbjct:   48 LRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKR--PWSGVLDATTFQNVCYQYVDTLYPGFEG--TEMWNPNRELSEDCLYLNVWTPYPRPASPT-PVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLALPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVSAGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQES---------------------IFRFSFVPVVDGDFLSDTPEALINTGDF-QDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYT---DWLHPE-----------DPTHLRD----------AMSAVVGDHNVVCPVAQLAGRLA-AQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSL-----NYTTEERIFAQRLMKYWTNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSL---NLKPLEVRRGLRAQTCAFWNRFLPKLLS 572          
BLAST of COesterase domain-containing protein vs. Ensembl Mouse
Match: Bche (butyrylcholinesterase [Source:MGI Symbol;Acc:MGI:894278])

HSP 1 Score: 318.161 bits (814), Expect = 3.123e-99
Identity = 196/607 (32.29%), Postives = 309/607 (50.91%), Query Frame = 3
Query:   39 LIVLCFCLSYDAIVVHIKIDNQTFPLKGKSIFKMGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIG-KMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFL-YLDDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKP-EVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSW---TSKEILQ-KLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILPDLL 1838
            +++LC             I  +T  ++G S+  +G  +  F  IPYA+PP+G+ RF+ P+ LN   W  ++++T    +C+Q   +I+       G +MW   T +SEDCLYL +W P     N    VM+WIYGG + +G+S+L VYDG  LA +  V++VS  +R G LGFL +  + ++PGN  + DQ + L+WV  +I +FGG+PK +T+FGES+GA S+S+HL    S   F RAIL+SG+   PWA++    +  +   LA+   C+  N  E++KCLRS  P E+L N  F++                     SD+ L   I F P  D   ++ +    +  G+ V    +L+G N +E   FL+YG       F      L ++  +                  L+  +P +++L     G ++  F    W    S E+ +  LD + GD   ICP ++F     + +++  F Y F  R++    P+W+GVMHGYEIE+VFG+P          ++   E+  SRS+MK W NFAKYG+P  T       WP +T+  ++YL ++   S   K+ +  +   C+FW    P +L
Sbjct:   17 ILLLCMPFGKSHTEEDFIITTKTGRVRGLSMPVLGGTVTAFLGIPYAQPPLGSLRFKKPQPLNK--WPDIHNATQYANSCYQ---NIDQAFPGFQGSEMWNPNTNLSEDCLYLNVWIPVPKPKNAT--VMVWIYGGGFQTGTSSLPVYDGKFLARVERVIVVSMNYRVGALGFLAFPGNPDAPGNMGLFDQQLALQWVQRNIAAFGGNPKSITIFGESAGAASVSLHLLCPQSYPLFTRAILESGSSNAPWAVKHPEEARNRTLTLAKFTGCSKENEMEMIKCLRSKDPQEILRNERFVLP--------------------SDSIL--SINFGPTVDGDFLTDMPHTLLQLGK-VKKAQILVGVNKDEGTAFLVYGAPG----FSKDNDSLITRKEFQE---------------GLNMYFPGVSRL-----GKEAVLFYYVDWLGEQSPEVYRDALDDVIGDYNIICPALEFTKKFAELENNAFF-YFFEHRSSKLPWPEWMGVMHGYEIEFVFGLPLGRRV-----NYTRAEEIFSRSIMKTWANFAKYGHPNGTQ-GNSTMWPVFTSTEQKYLTLNTEKS---KIYSKLRAPQCQFWRLFFPKVL 559          
BLAST of COesterase domain-containing protein vs. Ensembl Mouse
Match: Ces2f (carboxylesterase 2F [Source:MGI Symbol;Acc:MGI:1919153])

HSP 1 Score: 240.736 bits (613), Expect = 1.619e-70
Identity = 182/561 (32.44%), Postives = 277/561 (49.38%), Query Frame = 3
Query:  159 FSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFE-LKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRS-TKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEV--PDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILP 1829
            F  IP+AKPP+G  RF  PE     PW+GV D T QP  C Q    +  E LK  I KM      MSEDCLYL I+TP        LPVM+W++GG  ++G +++  YDGS+LA+  +VV+V  Q+R G  GF    D ++ GN   +DQ   L WV  +I +FGG+P  VTLFG+S+G TS+S H+ S +S+  F RAI++SG   +P  I   S   I  K +A  + C + N++ +V+CLR  ++ E+L           A ++  + M               D  F P   +K+++  D   +           +IG N +E  + +        K+F+ S+ +   K++    N     KI  E ++    L      L++ EY   ++      WT +  +Q  + I GD   I P +Q A    +   + ++ Y F  R++  +   P  +   HG E+  +FG    S F    +SF  +EK +SR +MK+W NFA+YGNP   D     +WPA +N++  YL++    S G    +  K +   FW K LP
Sbjct:   60 FLGIPFAKPPVGPLRFAPPEAPE--PWSGVRDGTSQPAMCLQNDDIVNLEGLK--IIKMILPPFSMSEDCLYLNIYTPAHAQEGSNLPVMVWLHGGGLVAGMASM--YDGSVLAATEDVVVVVTQYRLGIPGFYSTGDEQARGNWGFLDQTAALHWVQQNIANFGGNPDSVTLFGQSAGGTSVSFHVLSPVSQGLFHRAIMESGVALLP-TIIPDSPEMIFTK-VANLSGCETSNSEALVRCLRGKSEAEIL-----------AMSKAFRFMPA-----------VVDGKFLPRHPKKLLASADFHPVPS---------IIGVNNDEYGWIIP-------KIFKFSQTI--RKIN--RNNLKAIMKITTEQMM----LPSECGDLLIEEYLRDTE----DPWTLQ--MQFREMI-GDFLIIIPALQVAR--FQRSHAPVYFYEFQHRSSLLKYFRPWHVKADHGDELYLIFG----SFFWGLKFSFTAEEKLLSRKMMKYWANFARYGNPNSEDLP---YWPA-SNQDDLYLQLDIHPSVG----HALKARRLPFWTKTLP 545          
BLAST of COesterase domain-containing protein vs. Ensembl Mouse
Match: Ces2f (carboxylesterase 2F [Source:MGI Symbol;Acc:MGI:1919153])

HSP 1 Score: 240.736 bits (613), Expect = 1.619e-70
Identity = 182/561 (32.44%), Postives = 277/561 (49.38%), Query Frame = 3
Query:  159 FSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFE-LKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRS-TKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEV--PDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILP 1829
            F  IP+AKPP+G  RF  PE     PW+GV D T QP  C Q    +  E LK  I KM      MSEDCLYL I+TP        LPVM+W++GG  ++G +++  YDGS+LA+  +VV+V  Q+R G  GF    D ++ GN   +DQ   L WV  +I +FGG+P  VTLFG+S+G TS+S H+ S +S+  F RAI++SG   +P  I   S   I  K +A  + C + N++ +V+CLR  ++ E+L           A ++  + M               D  F P   +K+++  D   +           +IG N +E  + +        K+F+ S+ +   K++    N     KI  E ++    L      L++ EY   ++      WT +  +Q  + I GD   I P +Q A    +   + ++ Y F  R++  +   P  +   HG E+  +FG    S F    +SF  +EK +SR +MK+W NFA+YGNP   D     +WPA +N++  YL++    S G    +  K +   FW K LP
Sbjct:   60 FLGIPFAKPPVGPLRFAPPEAPE--PWSGVRDGTSQPAMCLQNDDIVNLEGLK--IIKMILPPFSMSEDCLYLNIYTPAHAQEGSNLPVMVWLHGGGLVAGMASM--YDGSVLAATEDVVVVVTQYRLGIPGFYSTGDEQARGNWGFLDQTAALHWVQQNIANFGGNPDSVTLFGQSAGGTSVSFHVLSPVSQGLFHRAIMESGVALLP-TIIPDSPEMIFTK-VANLSGCETSNSEALVRCLRGKSEAEIL-----------AMSKAFRFMPA-----------VVDGKFLPRHPKKLLASADFHPVPS---------IIGVNNDEYGWIIP-------KIFKFSQTI--RKIN--RNNLKAIMKITTEQMM----LPSECGDLLIEEYLRDTE----DPWTLQ--MQFREMI-GDFLIIIPALQVAR--FQRSHAPVYFYEFQHRSSLLKYFRPWHVKADHGDELYLIFG----SFFWGLKFSFTAEEKLLSRKMMKYWANFARYGNPNSEDLP---YWPA-SNQDDLYLQLDIHPSVG----HALKARRLPFWTKTLP 545          
BLAST of COesterase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q92035|ACES_BUNFA (Acetylcholinesterase OS=Bungarus fasciatus OX=8613 GN=ACHE PE=1 SV=2)

HSP 1 Score: 340.502 bits (872), Expect = 5.429e-107
Identity = 204/592 (34.46%), Postives = 302/592 (51.01%), Query Frame = 3
Query:   84 HIKIDNQTFPLKGKSIFKMGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDT-ESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSS----NFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPT-PTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILPDLLN 1841
             +K+  QT  ++G S+  +   +  F  IP+A+PP+G  RF  PE +   PW  V D+T     C+Q   +     +    +MW     MSEDCLYL IW P     +   PV++WIYGG + SG+++L+VYDG  L    NV++VS  +R G  GFL L  + E+PGN  ++DQ + L+W+ N+I  FGG+P+ VT+FGES+GA S+ +HL S  S   FQRAILQSG    PWA  + + S  +A  L ++  C   N+ E+V CLRS  P+ L++              E+     YK         F   F P+ D           +S G     + +L+G   +E  +FL+YGL      N  L   +  +   +MS P  N             D+     +   ++L     Q Q   +K+       + LD I GD   ICP +QFA+   K ++SK++ YLF+ R +    P W+GV HGYEIE+VFG+P +        ++   EK +SR +M++W NFA+ GNPT P D  + G WP YT    +Y+++   N+     +   + + C FWN  LP LLN
Sbjct:   36 ELKVSTQTGSVRGLSLPVLDGHVSAFLGIPFAEPPLGRMRFLRPEPVK--PWQHVLDATSYKPACYQMVDTSYPGFQG--TEMWNPNRGMSEDCLYLNIWVPSPRPKDA--PVLVWIYGGGFYSGAASLDVYDGRFLTYTQNVILVSLSYRVGAFGFLGLPGSPEAPGNMGLLDQRLALQWIQNNIHPFGGNPRAVTVFGESAGAASVGMHLLSTQSRTLFQRAILQSGGPNAPWATVTPAESRGRAALLGKQLGCHFNNDSELVSCLRSKNPQELID--------------EEWSVLPYKS-------IFRFPFVPVIDGDFFPDTPEAMLSSGNFKETQ-VLLGVVKDEGSYFLIYGLPGFSKDNESLISRADFLEGVRMSVPHAN-------------DI-----ATDAVVLQYTDWQDQDNREKN------REALDDIVGDHNVICPVVQFANDYAK-RNSKVYAYLFDHRASNLLWPPWMGVPHGYEIEFVFGLPLNDSL-----NYTPQEKELSRRMMRYWANFARTGNPTDPAD--KSGAWPTYTASQPQYVQL---NTQPLATQPSLRAQICAFWNHFLPKLLN 564          
BLAST of COesterase domain-containing protein vs. UniProt/SwissProt
Match: sp|P04058|ACES_TETCF (Acetylcholinesterase OS=Tetronarce californica OX=7787 GN=ache PE=1 SV=2)

HSP 1 Score: 330.872 bits (847), Expect = 1.570e-103
Identity = 202/589 (34.30%), Postives = 305/589 (51.78%), Query Frame = 3
Query:   93 IDNQTFPLKGKSIFKMGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIG-KMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDT-ESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLVNL--NFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVL--ENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILPDLLN 1841
            ++ ++  + G  +  +   I  F  IP+A+PP+GN RFR PE     PW+GV++++  P  C Q    ++ +     G +MW     MSEDCLYL IW P     +    VM+WIYGG + SGSSTL+VY+G  LA    VV+VS  +R G  GFL L  + E+PGN  ++DQ M L+WV+++I  FGGDPK VT+FGES+G  S+ +H+ S  S   F+RAILQSG+   PWA  S +    +A  L    NC   +++E++ CLR  KP+ L+++  N L  D I                       F   F P+ D +         ++ G     + +L+G N +E  FFL+YG +  F     SKI          E++    K+ +   N L LD +    T  +    GI+++               LD I GD   ICP + F +  TK  +   ++Y FN R +    P+W+GV+HGYEIE+VFG+P   +      ++  +E+ +SR +M +W  FAK GNP     +++  WP +T K ++++ +   N+   KV    + + C FWN+ LP LLN
Sbjct:   29 VNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEP--KKPWSGVWNASTYPNNCQQ---YVDEQFPGFSGSEMWNPNREMSEDCLYLNIWVPSPRPKSTT--VMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHGSQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAEGRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSI-----------------------FRFSFVPVIDGEFFPTSLESMLNSGNFKKTQ-ILLGVNKDEGSFFLLYG-APGFSKDSESKI--------SREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNR-------------DGLDDIVGDHNVICPLMHFVNKYTKFGNGT-YLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKEL-----NYTAEEEALSRRIMHYWATFAKTGNPN-EPHSQESKWPLFTTKEQKFIDL---NTEPMKVHQRLRVQMCVFWNQFLPKLLN 554          
BLAST of COesterase domain-containing protein vs. UniProt/SwissProt
Match: sp|P07692|ACES_TORMA (Acetylcholinesterase OS=Torpedo marmorata OX=7788 GN=ache PE=1 SV=2)

HSP 1 Score: 330.487 bits (846), Expect = 2.856e-103
Identity = 202/572 (35.31%), Postives = 297/572 (51.92%), Query Frame = 3
Query:  138 MGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKN-PIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDT-ESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLVNL--NFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILPDLLN 1841
            +   I  F  IP+A+PP+GN RFR PE     PW+GV++++  P  C Q    ++ +    P  +MW     MSEDCLYL IW P     +    VM+WIYGG + SGSSTL+VY+G  LA    VV+VS  +R G  GFL L  + E+PGN  ++DQ M L+WV+++I  FGGDPK VTLFGES+G  S+ +H+ S  S   F+RAILQSG+   PWA  S +    +A  L    NC   +++++++CLR  KP+ L+++  N L  D I                       F   F P+ D +      +E +          +L+G N +E  FFL+YG +  F     SKI     MS      + P+     N L LD +    T  +    GI+++               LD I GD   ICP + F +  TK  +   ++Y FN R +    P+W+GV+HGYEIE+VFG+P   +      ++  +E+ +SR +M +W  FAK GNP     +++  WP +T K ++++ +   N+   KV    + + C FWN+ LP LLN
Sbjct:   47 LSSHISAFLGIPFAEPPVGNMRFRRPEP--KKPWSGVWNASTYPNNCQQ---YVDEQFPGFPGSEMWNPNREMSEDCLYLNIWVPSPRPKSAT--VMLWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHGSQEAPGNMGLLDQRMALQWVHDNIQFFGGDPKTVTLFGESAGRASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAEGRRRAVELRRNLNCNLNSDEDLIQCLREKKPQELIDVEWNVLPFDSI-----------------------FRFSFVPVIDGEFFPT-SLESMLNAGNFKKTQILLGVNKDEGSFFLLYG-APGFSKDSESKISREDFMS--GVKLSVPHA----NDLGLDAVTLQYTDWMDDNNGIKNR-------------DGLDDIVGDHNVICPLMHFVNKYTKFGNGT-YLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKEL-----NYTAEEEALSRRIMHYWATFAKTGNPN-EPHSQESKWPLFTTKEQKFIDL---NTEPIKVHQRLRVQMCVFWNQFLPKLLN 557          
BLAST of COesterase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q86GC8|ACES_CULPI (Acetylcholinesterase OS=Culex pipiens OX=7175 GN=ACHE1 PE=2 SV=2)

HSP 1 Score: 333.183 bits (853), Expect = 4.302e-103
Identity = 202/573 (35.25%), Postives = 304/573 (53.05%), Query Frame = 3
Query:  141 GKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQ--EIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLD-YLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPT----DFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILPDLL 1838
            GKK+  +  IPYA+PP+G  RFR+P       WTGV ++T  P +C Q   ++  +   P   MW   T +SEDCLY+ +  P+    N    VM+WI+GG + SG++TL+VYD   LAS  NV++VS Q+R   LGFL+L   E+PGN  + DQ++ L+WV ++I  FGGDP +VTLFGES+GA S+S+HL S +S   FQRAILQSG+   PWA+ S   + ++A  LAE  NC     +  + V+CLR+  P  LV+               +    G  +F           F P+ D   + +     ++ G+     D+L G+N  E  +F++Y L+   +L    + V  ++  +            L+ + +L+ Y+  +  + I+ EY    +   D   ++++ L K+    GD  F C   +FA    + + + +FMYL+  R+ G   P W GVMHG EI YVFG P +S        + DDEK+ SR +M++W+NFAK GNP P+    D  E   WP +T   + YL++ G N+         +Q  C FW K LP L+
Sbjct:  152 GKKVDAWMGIPYAQPPLGPLRFRHPRPAER--WTGVLNATKPPNSCVQIVDTVFGDF--PGATMWNPNTPLSEDCLYINVVVPRPRPKNAA--VMLWIFGGGFYSGTATLDVYDHRTLASEENVIVVSLQYRVASLGFLFLGTPEAPGNAGLFDQNLALRWVRDNIHRFGGDPSRVTLFGESAGAVSVSLHLLSALSRDLFQRAILQSGSPTAPWALVSREEATLRALRLAEAVNCPHDATKLSDAVECLRTKDPNELVD--------------NEWGTLGICEFP----------FVPVVDGAFLDETPQRSLASGRF-KKTDILTGSNTEEGYYFIIYYLT---ELLRKEEGVTVTREEF------------LQAVRELNPYVNGAARQAIVFEYTDWIE--PDNPNSNRDALDKMV---GDYHFTCNVNEFAQRYAE-EGNNVFMYLYTHRSKGNPWPRWTGVMHGDEINYVFGEPLNSAL-----GYQDDEKDFSRKIMRYWSNFAKTGNPNPSTPSVDLPE---WPKHTAHGRHYLEL-GLNTTFVGRGPRLRQ--CAFWKKYLPQLV 661          
BLAST of COesterase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q869C3|ACES_ANOGA (Acetylcholinesterase OS=Anopheles gambiae OX=7165 GN=Ace PE=1 SV=3)

HSP 1 Score: 333.183 bits (853), Expect = 1.195e-102
Identity = 199/570 (34.91%), Postives = 304/570 (53.33%), Query Frame = 3
Query:  141 GKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQ--EIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLD-YLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTP-TDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILPDLL 1838
            GKK+  +  IPYA+PP+G  RFR+P       WTGV ++T  P +C Q   ++  +   P   MW   T +SEDCLY+ +  P+    N    VM+WI+GG + SG++TL+VYD   LAS  NV++VS Q+R   LGFL+L   E+PGN  + DQ++ L+WV ++I  FGGDP +VTLFGES+GA S+S+HL S +S   FQRAILQSG+   PWA+ S   + ++A  LAE   C    ++  + V+CLR   P VLVN               +    G  +F           F P+ D   + +     ++ G+     ++L G+N  E  +F++Y L+   +L    + V  ++  +            L+ + +L+ Y+  +  + I+ EY   ++   D   ++++ L K+    GD  F C   +FA    + + + ++MYL+  R+ G   P W GVMHG EI YVFG P +         + +DEK+ SR +M++W+NFAK GNP P T  +E   WP +T   + YL++ G N+         +Q  C FW K LP L+
Sbjct:  185 GKKVDVWLGIPYAQPPVGPLRFRHPRPAEK--WTGVLNTTTPPNSCVQIVDTVFGDF--PGATMWNPNTPLSEDCLYINVVAPRPRPKNAA--VMLWIFGGGFYSGTATLDVYDHRALASEENVIVVSLQYRVASLGFLFLGTPEAPGNAGLFDQNLALRWVRDNIHRFGGDPSRVTLFGESAGAVSVSLHLLSALSRDLFQRAILQSGSPTAPWALVSREEATLRALRLAEAVGCPHEPSKLSDAVECLRGKDPHVLVN--------------NEWGTLGICEF----------PFVPVVDGAFLDETPQRSLASGRF-KKTEILTGSNTEEGYYFIIYYLT---ELLRKEEGVTVTREEF------------LQAVRELNPYVNGAARQAIVFEYTDWTE--PDNPNSNRDALDKMV---GDYHFTCNVNEFAQRYAE-EGNNVYMYLYTHRSKGNPWPRWTGVMHGDEINYVFGEPLNPTL-----GYTEDEKDFSRKIMRYWSNFAKTGNPNPNTASSEFPEWPKHTAHGRHYLEL-GLNTSFVGRGPRLRQ--CAFWKKYLPQLV 694          
BLAST of COesterase domain-containing protein vs. TrEMBL
Match: G7YKI1 (Acetylcholinesterase OS=Clonorchis sinensis OX=79923 GN=CLF_110278 PE=3 SV=1)

HSP 1 Score: 419.083 bits (1076), Expect = 1.431e-133
Identity = 235/626 (37.54%), Postives = 345/626 (55.11%), Query Frame = 3
Query:  159 FSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLD---DTESP-------------GNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSR--NNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLM-----------KEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKIS---EGQLVTNKDLLIGTNANEAMFFLMYGLS--SNFKLFESSKIVLPSKMSY--------PSENYTDPYKIVLENILDLDYLYPSLTKLILHEYG-----IQSQHFDDKS---WTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKG--FWPAYTNKNKRYLKISGTN----SGGFKVENHFKQKHCRFWNKILPDLL--NRLLNKKN 1862
            F  IP+A+PP+G RRF  P+K  +P W+G+ ++T  P  CWQ      F+  NP  +MW + T MSEDCLYL IWTP       LLPVM+WIYGG Y SG+STL+VYD S+L + H V+++S Q+R G LGFL LD    T +P             GNQ ++DQ + L+W++ +I  FGG+PK VT+FGESSGA S S+   S ++++YFQR ILQSG+ +  WA+ES   ++I+ +  A    CTS   + +  +KCL+S  P  LV+    + + + + R+EKL+           K    ++   + ++FD+ F+ + D  +I K   +  S      L  + +LL+G N NEAM+FL+YGL+  +   L E   ++LP  +          P     D ++I     L  D L   +++L    YG     IQ+  + D S    T++ ++ +LD + G++ FICPT+ FA+ V +  +SK+F+Y    +T     P W GVMHGYEIEYVFGMP S  F ++ Y FN +EK +S  +M+ WTNFAK GNP   D    G   WP Y     R   +   +        +     +Q  CRFW   +P L+   RLL+ K+
Sbjct:   54 FHGIPFAQPPVGVRRFAPPQK--HPGWSGIRNATRLPPACWQYILE-GFDKNNPAARMWLNNTEMSEDCLYLNIWTPSYASPTNLLPVMVWIYGGGYTSGTSTLDVYDASVLVAKHKVIVLSMQYRVGALGFLRLDPDSGTANPLPNGVPNANSVARGNQGLLDQQLALEWMHENIAEFGGNPKHVTVFGESSGAVSASIQWLSPLAQRYFQRVILQSGSAYARWALESLGEAHIRGQQFALTCGCTSPSVHREASLKCLQSLHPITLVDNLDSVAEFVGQRRREKLVQLFADSQEVLDKSKLLNWAESSRMYFDVPFKAVVDGYVIPKQPEQMFSPNFHTSLRKSPELLLGVNKNEAMYFLLYGLALGNGSFLHEDGTVILPEAIRLAAARRPQSPDGPLADFHRISSAQFLSEDQLVRGISQLPSFSYGLPVDTIQTTGYADPSDSRMTAEVLMHRLDTLCGELDFICPTLNFAEQVARIANSKVFLYEMQRKTLSCPFPSWTGVMHGYEIEYVFGMPHSEKFQNSFYRFNVEEKKLSDEMMRMWTNFAKRGNPNKNDDGTIGAVVWPTYKAATNRDPALDLDDYIILDTPIRRGKDLRQVGCRFWLHEIPTLVKERRLLDDKD 676          
BLAST of COesterase domain-containing protein vs. TrEMBL
Match: A0A4S2L5T1 (COesterase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009914 PE=3 SV=1)

HSP 1 Score: 417.927 bits (1073), Expect = 4.566e-133
Identity = 234/627 (37.32%), Postives = 347/627 (55.34%), Query Frame = 3
Query:  159 FSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIE-FELKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLD---DTESP-------------GNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSR--NNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLM-----------KEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEG---QLVTNKDLLIGTNANEAMFFLMYGLS--SNFKLFESSKIVLPSKMSY--------PSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGI-----QSQHFDDKS---WTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKG--FWPAYTNKNKRYLKISGTN----SGGFKVENHFKQKHCRFWNKILPDLL--NRLLNKKN 1862
            F  IP+A+PP+G RRF  P+K  +P W+G+ ++T  P  CWQ    +E F+  NP  +MW + T MSEDCLYL IWTP       LLPVM+WIYGG Y SG+STL+VYD S+L + H V+++S Q+R G LGFL LD    T +P             GNQ ++DQ + L+W++ +I  FGG+PK VT+FGESSGA S S+   S ++++YFQR ILQSG+ +  WA++S   ++I+ +  A    CTS   N +  +KCL+S  P  LV+    + + + + R+EKL+           K     +   + ++FD+ F+ + D  +I K   +  S      L  + +LL+G N NEAM+FL+YGL+  +   L E   ++LP  +          P+    D ++I     L  D L   +++L    YG+     Q+  + D S    T++ ++ +LD + G++ FICPT+ FA+ V +  +SK+F+Y    +T     P W GVMHGYEIEYVFGMP S  F ++ Y FN DEK +S  +M+ WTNFAK G+P   D    G   WP Y     R   +   +        +     +Q  CRFW   +P L+   RL++ K+
Sbjct:   56 FHGIPFAQPPVGVRRFAPPQK--HPGWSGIRNATRPPPACWQYI--VEGFDKNNPAARMWLNNTEMSEDCLYLNIWTPSYPSPTNLLPVMVWIYGGGYTSGTSTLDVYDASVLVAKHKVIVLSMQYRVGALGFLRLDPNSGTANPLPNGVPNANSVARGNQGLLDQQLALEWMHENIAEFGGNPKHVTVFGESSGAVSASIQWLSPLAQRYFQRVILQSGSAYARWALDSLGEAHIRGQQFALACGCTSPSVNREASLKCLQSLHPVTLVDNLDSVAEFVGQRRREKLVQLFADSQEFPDKSKLLSWAESSRMYFDVPFKAVVDGYVIPKQPEQMFSPSFHTSLRRSPELLLGVNKNEAMYFLLYGLALGNGSFLHEDGTVLLPEAIRLAAARRPQSPNGPLADFHRISSAQFLSEDQLLRGISQLPSFSYGLPVDTSQTNGYADPSDSRMTAEVLMHRLDTLCGELDFICPTLNFAEQVARIANSKVFLYEMQRKTLSCPFPSWTGVMHGYEIEYVFGMPHSEKFQNSFYRFNVDEKKLSDEMMRMWTNFAKRGDPNKNDDGTIGAVVWPTYKAAKHRDPALDLDDYIILDTPIRRGKDLRQVGCRFWLHEIPTLVKEKRLMDDKD 678          
BLAST of COesterase domain-containing protein vs. TrEMBL
Match: A0A074ZLQ9 (COesterase domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_05062 PE=3 SV=1)

HSP 1 Score: 416.001 bits (1068), Expect = 2.997e-132
Identity = 226/616 (36.69%), Postives = 342/616 (55.52%), Query Frame = 3
Query:  159 FSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLD----------------DTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSR--NNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLM-----------KEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKIS---EGQLVTNKDLLIGTNANEAMFFLMYGLS--SNFKLFESSKIVLPSKMSY--------PSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGI-----QSQHFDDKS---WTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKG--FWPAYTNKNKRYLKISGTN----SGGFKVENHFKQKHCRFWNKILPDLL 1838
            F  IP+A+PP+G RRF  P+K  +P W+G+ ++T  P  CWQ      F+  NP  +MW + T MSEDCLYL IWTP       LLPVM+WIYGG Y SG+STL+VYD S+L + H V+++S Q+R G LGFL LD                ++ + GNQ ++DQ + L+W++ +I  FGG+PK VT+FGESSGA S S+   S ++++YFQR ILQSG+++  WA++S   ++++ +  A    CTS   N +  +KCL+S  P  LV+    + + + + R+ KL+           K     +   + ++FD+ F+ + D  +I K   +  S      L  + +LL+G N NEAM+FL+YGL+  +   L E   ++LP  +          P+    D ++I     L  D L   +++L    YG+     Q+  + D S    T++ ++ +LD + G++ FICPT+ FA+ V +  +SK+F+Y    +T     P W GVMHGYEIEYVFGMP+S  F ++ Y FN +EK +S  +M+ WTNFAK G+P   D    G   WPAY    +R   +   +        +     +Q  CRFW   +P L+
Sbjct:   54 FHGIPFAQPPVGVRRFAPPQK--HPGWSGIRNATRLPPACWQYILE-GFDKNNPAARMWLNNTEMSEDCLYLNIWTPSYASPTNLLPVMVWIYGGGYTSGTSTLDVYDASVLVAKHKVIVLSMQYRVGALGFLRLDPDSGAANPLPNGVPNANSVARGNQGLLDQQLALEWMHENIAEFGGNPKHVTVFGESSGAVSASIQWLSPLAQRYFQRVILQSGSVYARWALDSLGEAHMRGQQFAVACGCTSPSVNREASLKCLQSLHPITLVDNLDSVAEFVGQRRRGKLVQLFEDSQKVPDKTTLLSWAESSRMYFDVPFKAVVDGYVIPKQPEQMFSPNFHTSLRRSPELLLGVNKNEAMYFLLYGLALGNGSFLHEDGSVLLPEAIQLAAARRPQSPNGPLADFHRISSAQFLSEDQLVRGISQLPSFSYGLPVDTSQTNGYADPSDSRMTAEALMHRLDTLCGELDFICPTLNFAEQVARIANSKVFLYEMQRKTLSCPFPSWTGVMHGYEIEYVFGMPYSEKFQNSFYRFNVEEKKLSDEMMRMWTNFAKRGDPNRNDDGTIGAVVWPAYKAAKQRDPALDLDDYIILDTPIRRGKDLRQAGCRFWLHEIPTLV 666          
BLAST of COesterase domain-containing protein vs. TrEMBL
Match: A0A4S2L472 (Carboxylic ester hydrolase OS=Opisthorchis felineus OX=147828 GN=CRM22_009914 PE=3 SV=1)

HSP 1 Score: 401.749 bits (1031), Expect = 1.257e-127
Identity = 217/556 (39.03%), Postives = 320/556 (57.55%), Query Frame = 3
Query:  159 FSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIE-FELKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLD---DTESP-------------GNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSR--NNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLM-----------KEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEG---QLVTNKDLLIGTNANEAMFFLMYGLS--SNFKLFESSKIVLPSKMSY--------PSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGI-----QSQHFDDKS---WTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGN 1673
            F  IP+A+PP+G RRF  P+K  +P W+G+ ++T  P  CWQ    +E F+  NP  +MW + T MSEDCLYL IWTP       LLPVM+WIYGG Y SG+STL+VYD S+L + H V+++S Q+R G LGFL LD    T +P             GNQ ++DQ + L+W++ +I  FGG+PK VT+FGESSGA S S+   S ++++YFQR ILQSG+ +  WA++S   ++I+ +  A    CTS   N +  +KCL+S  P  LV+    + + + + R+EKL+           K     +   + ++FD+ F+ + D  +I K   +  S      L  + +LL+G N NEAM+FL+YGL+  +   L E   ++LP  +          P+    D ++I     L  D L   +++L    YG+     Q+  + D S    T++ ++ +LD + G++ FICPT+ FA+ V +  +SK+F+Y    +T     P W GVMHGYEIEYVFGMP S  F ++ Y FN DEK +S  +M+ WTNFAK G 
Sbjct:   56 FHGIPFAQPPVGVRRFAPPQK--HPGWSGIRNATRPPPACWQYI--VEGFDKNNPAARMWLNNTEMSEDCLYLNIWTPSYPSPTNLLPVMVWIYGGGYTSGTSTLDVYDASVLVAKHKVIVLSMQYRVGALGFLRLDPNSGTANPLPNGVPNANSVARGNQGLLDQQLALEWMHENIAEFGGNPKHVTVFGESSGAVSASIQWLSPLAQRYFQRVILQSGSAYARWALDSLGEAHIRGQQFALACGCTSPSVNREASLKCLQSLHPVTLVDNLDSVAEFVGQRRREKLVQLFADSQEFPDKSKLLSWAESSRMYFDVPFKAVVDGYVIPKQPEQMFSPSFHTSLRRSPELLLGVNKNEAMYFLLYGLALGNGSFLHEDGTVLLPEAIRLAAARRPQSPNGPLADFHRISSAQFLSEDQLLRGISQLPSFSYGLPVDTSQTNGYADPSDSRMTAEVLMHRLDTLCGELDFICPTLNFAEQVARIANSKVFLYEMQRKTLSCPFPSWTGVMHGYEIEYVFGMPHSEKFQNSFYRFNVDEKKLSDEMMRMWTNFAKRGQ 607          
BLAST of COesterase domain-containing protein vs. TrEMBL
Match: A0A4E0RQY0 (Acetyl cholinesterase OS=Fasciola hepatica OX=6192 GN=D915_006203 PE=4 SV=1)

HSP 1 Score: 404.06 bits (1037), Expect = 2.593e-127
Identity = 227/669 (33.93%), Postives = 359/669 (53.66%), Query Frame = 3
Query:   45 VLCFC-LSYDAIVV--HIKIDNQTFPLKGKSIFKMGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQINV-----------ANELL------PVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNN-----QEIVKCLRSTKPEVLVNLN----FLIRDQIAKTRKEKLMKEGYKDF----YSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSK------LFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNP--TPTDF---TEKGFWPAYTNK---------NKRYLKISG---TNSGGF---------KVENHFKQKHCRFWNKILPDLLNRLLNK 1856
            V C C L++  +    +I +     P+ G   + +GK ++HF  +PYA+PPIG+ RF+YP K    PW  + +ST  P +C Q +P    E KN   +MW +++ MSEDCLYL IWT   N+           ++ L       PVM+WI+GGS   G+ +LEVY+G+ LAS+ +VV+VS Q+R GP GFLYL   ++PGNQ +MDQ   L+WV  +I  FGG+P++VTLFG + G   +++HL S +++  FQ+AILQSG+    WAIE   ++  KA+ L + + C           E+  CLRS     L  LN     ++R +I  TR+ +L     K F       A  ++DI F+P+    ++ +   E ++ G+L     +++G N +E M+ L+  L S F +  +    +P +  Y   +  DP  ++   I+D ++L+P L +  + EY I S+      W + E+L+ L+ +GGD    CP ++FAD  ++  S++      +F+Y F  RT     P+W GVM G+E EY+FG PF+ DF    Y+F D+EK +S  +M+ WTNFA  G+P   P +F    +K +W  Y  +         NKR L+I+     +S             +  + ++ HC FW + LP +   ++ +
Sbjct:    6 VTCVCFLAWSRVTFGDNIIVRTNYGPISGTQKYILGKNVYHFLGVPYAQPPIGDLRFKYPRKPR--PWKNILNSTQHPKSCIQPSPE-SHEFKNSATRMWLTRSEMSEDCLYLNIWTRASNLTVLEDNIPMLESSALFGPKGGRPVMVWIHGGSLTRGAISLEVYNGAYLASMMDVVVVSIQYRLGPFGFLYLGTEDAPGNQGLMDQAAALEWVRENIAYFGGNPQQVTLFGHAGGVICVALHLLSPVTKSLFQQAILQSGSPLAWWAIEGPKSALEKAQLLTQLSGCVVSERSATYLSELASCLRSVSASSL-ELNQWQMQMLRSRINSTRRVQLEAIYQKRFSPHLLQSAGYYYDIPFKPVVSAPLLPQWPYEILASGKLDIRHRIMLGVNQDEGMYHLINSLRSYF-MQNAQWPSMPRQFDY-DVSMLDPMDLLAFYIMDENFLHPVLLQATVFEYQIPSRALGKFGWRASEVLEALNQVGGDYNIKCPVVEFADFYSRGTSAQASLDNYVFLYSFEHRTVAFSWPEWTGVMQGFEAEYIFGAPFNPDFQREFYNFTDEEKRLSEEMMRCWTNFASTGSPNLNPGEFHTRNKKLYWERYQTQSASNGQIPVNKRGLQIASEPLADSSRMHMVFTLPHSHMSQNLRRHHCMFWREQLPLMREHIVTR 668          
BLAST of COesterase domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000006974.2 (cholinesterase [Source:NCBI gene;Acc:103037776])

HSP 1 Score: 317.39 bits (812), Expect = 5.141e-99
Identity = 201/602 (33.39%), Postives = 306/602 (50.83%), Query Frame = 3
Query:   60 LSYDAIVVHI---KIDNQTFPLKGKSIFKMGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIG-KMWFSKTVMSEDCLYLTIWTPQINVAN---ELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTES-PGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANC-TSRNNQEIVKCLRSTKPEVLVNLNF-LIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILPDL 1835
            L +D +VV     K+      + G S       +  F  IPYAKPP+G  RF  PE +    W+GV D++    +CWQ   S++ + +   G +MW   T +SEDCLYL +WTP   + +    L+PVM+WIYGG + SG+++L+VYDG  L+    VV+VS  +R GPLGFL L  +E   GN A+ DQ + L WV  +I +FGGDP  VTLFGES+GA SI  H+ S  S   F RAILQSG+    WA   ++ ++ ++  LA+  NC    ++ E++ CLR+  PE +VN  + +I D                          +I F P  D   +  +    +  GQ + N ++L+G N +E  +FL+YG +  F L   S I              D +   + + L      P  +++       Q   + D+  + ++    L ++ GD  F CP + FA    +   S   +YLFN R++    P+W+GVMHG EIE+VFG+P +S        + ++E  +SR +M+ W NFAK GNP+         WP +T + + Y+ +   N+   +     + + C+FWN  LP L
Sbjct:   30 LGWDELVVPTNKGKVRGVKLSVPGSS-----GTVVGFLGIPYAKPPLGALRFSRPEPVE--AWSGVRDTSQFSNSCWQ---SVDTKFQGFAGAEMWNPNTKLSEDCLYLNVWTPSGRLQDPHQALVPVMVWIYGGGFSSGTASLDVYDGRYLSRSEEVVVVSMNYRLGPLGFLSLPGSEEVKGNAALFDQRLALTWVAENIAAFGGDPSSVTLFGESAGAGSIGHHVLSVGSHALFHRAILQSGSPNAVWAAVEATEAWNRSLTLADLLNCPIGPSSNEVLTCLRTIDPEKIVNQQYTVIHDTT----------------------ILNIPFPPTVDGDFLLDMPEVLMQSGQFL-NTEILLGLNQDEGPYFLIYG-AKGFGLSHQSLIT------------RDQFLQGVASSL------PGFSEMAREAAAFQYTDWMDEL-SGQKNRDALGWLVGDRYFSCPLLDFARKYVEHGGSA-SLYLFNHRSSSNAWPEWMGVMHGDEIEFVFGLPLNSS-----RGYTEEEVAMSRRMMRHWANFAKTGNPS----AGGSAWPPFTVEQQEYVSL---NTSPPQTLRMLRAQQCKFWNSFLPKL 565          
BLAST of COesterase domain-containing protein vs. Ensembl Cavefish
Match: ache (acetylcholinesterase (Cartwright blood group) [Source:NCBI gene;Acc:103043295])

HSP 1 Score: 291.967 bits (746), Expect = 1.403e-89
Identity = 190/579 (32.82%), Postives = 283/579 (48.88%), Query Frame = 3
Query:  150 IFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQ-------GAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLD-DTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGL----SSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNP---TPTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILPDLLN 1841
            +  F  IP+A+PP+G RRF+  E     PW  V+++   P  C+Q       G P  E         MW     MSEDCLYL +W P     + L  VM+WIYGG + SGSS+L+VYDG  LA    VV+VS  +R G  GFL  +  +++PGN  ++DQ + L+WV ++I  FGG+P++VT+FGES+G  S+ +HL S  S   F RAILQSG    PWA  +   +  +A  LA    C   N+ E++ CLR+  P  L+   + +                    YS     F   F P+ D  ++       ++ G    +  +L+G N NE  +FL+YG       N  L      +   KMS P  N      +VL+    +D                     +D    ++E    +D I GD   ICP  QFA +  +  S  +++YLF+ R +    P+W+GV+HGYEIE+VFG+P           +  +E+ +S+ +MK+W NFA+ GNP   T      +  WP +T   ++++ +   N+   K+    K + C  WN+ LP LLN
Sbjct:   37 VIAFLGIPFAEPPVGRRRFKPAEP--KKPWNDVFEAKEYPNACYQFVDTSYPGFPGTE---------MWNPNRNMSEDCLYLNVWVPSSPRPHNLT-VMVWIYGGGFYSGSSSLDVYDGRYLAHSEKVVVVSMNYRVGAFGFLTFNGSSDAPGNVGLLDQRLALQWVQDNIQFFGGNPRQVTIFGESAGGASVGMHLLSPESRPKFTRAILQSGVPNCPWATVTFDEARRRATKLATLVGCPDGNDTELIACLRNRDPLELIEHEWQVLP------------------YSS---LFRFSFVPVVDGVVLPDSPEAMLNAGNF-KDTQILLGVNQNEGSYFLIYGAPGFSKDNESLISREDFLEGVKMSVPHANEIGLEAVVLQYTDWMD---------------------EDNPLKNRE---AMDDIVGDHNVICPLQQFAKAYAQHGS--IYLYLFDHRASNLAWPEWMGVIHGYEIEFVFGLPLEKKL-----GYTVEEEKLSKRMMKYWANFARTGNPNINTDGSIDARKRWPLFTANEQKHVSL---NTEPIKIIKGLKTQFCALWNRFLPRLLN 547          
BLAST of COesterase domain-containing protein vs. Ensembl Cavefish
Match: ache (acetylcholinesterase (Cartwright blood group) [Source:NCBI gene;Acc:103043295])

HSP 1 Score: 284.263 bits (726), Expect = 3.158e-86
Identity = 190/604 (31.46%), Postives = 283/604 (46.85%), Query Frame = 3
Query:  150 IFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQ-------GAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLD-DTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSS----NFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTK-------------------------SKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNP---TPTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILPDLLN 1841
            +  F  IP+A+PP+G RRF+  E     PW  V+++   P  C+Q       G P  E         MW     MSEDCLYL +W P     + L  VM+WIYGG + SGSS+L+VYDG  LA    VV+VS  +R G  GFL  +  +++PGN  ++DQ + L+WV ++I  FGG+P++VT+FGES+G  S+ +HL S  S   F RAILQSG    PWA  +   +  +A  LA    C   N+ E++ CLR+  P  L+   + +                    YS     F   F P+ D  ++       ++ G    +  +L+G N NE  +FL+YG       N  L      +   KMS P  N      +VL+    +D                     +D    ++E    +D I GD   ICP  QFA +  +                           S  +++YLF+ R +    P+W+GV+HGYEIE+VFG+P           +  +E+ +S+ +MK+W NFA+ GNP   T      +  WP +T   ++++ +   N+   K+    K + C  WN+ LP LLN
Sbjct:   51 VIAFLGIPFAEPPVGRRRFKPAEP--KKPWNDVFEAKEYPNACYQFVDTSYPGFPGTE---------MWNPNRNMSEDCLYLNVWVPSSPRPHNLT-VMVWIYGGGFYSGSSSLDVYDGRYLAHSEKVVVVSMNYRVGAFGFLTFNGSSDAPGNVGLLDQRLALQWVQDNIQFFGGNPRQVTIFGESAGGASVGMHLLSPESRPKFTRAILQSGVPNCPWATVTFDEARRRATKLATLVGCPDGNDTELIACLRNRDPLELIEHEWQVLP------------------YSS---LFRFSFVPVVDGVVLPDSPEAMLNAGNF-KDTQILLGVNQNEGSYFLIYGAPGFSKDNESLISREDFLEGVKMSVPHANEIGLEAVVLQYTDWMD---------------------EDNPLKNRE---AMDDIVGDHNVICPLQQFAKAYAQHGAQNAHAGAMNQGNLGYGNSAGNSGNSGSIYLYLFDHRASNLAWPEWMGVIHGYEIEFVFGLPLEKKL-----GYTVEEEKLSKRMMKYWANFARTGNPNINTDGSIDARKRWPLFTANEQKHVSL---NTEPIKIIKGLKTQFCALWNRFLPRLLN 588          
BLAST of COesterase domain-containing protein vs. Ensembl Cavefish
Match: nlgn4xa (neuroligin-4, X-linked [Source:NCBI gene;Acc:103022482])

HSP 1 Score: 240.736 bits (613), Expect = 2.019e-68
Identity = 192/645 (29.77%), Postives = 288/645 (44.65%), Query Frame = 3
Query:   33 SSLIVLCFCLSYDAIVV-----HIKIDNQTFPLKG-KSIF--KMGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPP--WTGVYDSTVQPLTCWQGAPSIEFE-LKNPIGKMWFSKTV---------MSEDCLYLTIWTP---QINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKE----ILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPT-------------PTDFTEKGFWPAYTNKNKRYLKISGTNSGGFK--VENHFKQKHCRFWNKILPDLLN 1841
            S ++VL  CL+   +       H  +      L+G K+    ++   +  +  IPYA PP G RRF+ PE    PP  W G+ ++T     C Q    +E   L N +  +WF+  +          SEDCLYL I+ P    I+  N L PVM++I+GGSYM G+  +   DGSILAS  NV++V+  +R G LGFL   D  + GN  ++DQ   L+W+  +I +F GDPK+VT+FG  +GA+ +S+   S  SE  FQ+AI+QSGT    WA+    A Y   + LAEK  C   +  ++V+CL+        N   LI   I + +                   + I F P+ D  +I   D + + E     N D+++G N  E   F+   + S   +  +                   +   + + +D  Y YP   K  L E    +  F    W  KE      + L  +  D Q++ P +  AD +     S  + Y F         P W    HG E+ YVFG+P          +F+ ++  +S  VM +WTNFAK G+P              P  F E   W  Y  K++ YL I      G K  V +H++     FW +++P L N
Sbjct:   25 SRIVVLVACLATSCLAAAQAQQHPIVTTNYGKLRGLKTALPNEILGPVEQYLGIPYALPPTGERRFQPPE----PPMSWPGIRNATQFAAVCPQ---FLEDRFLLNDMLPVWFTANLDTVVTYVQDQSEDCLYLNIYVPTEDDIHDENGLRPVMVYIHGGSYMEGTGNM--IDGSILASYGNVIVVTLNYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWIKENIQAFKGDPKRVTIFGSGAGASCVSLLTLSHYSEDLFQKAIIQSGTALSSWAVNYQPAKY--TRMLAEKVGCNMLDTIDLVECLQKK------NHKELIEQYITQAK-------------------YHIAFGPVIDGDVIPD-DPQILMEQGEFLNYDIMLGVNQGEGFKFVDGIVDSEDGVSAND------------------FDFAVSDFVDHLYGYPE-GKDTLRE----TIKFMYTDWADKENPETRRKTLVALFTDHQWVAPAVATAD-LHAQYGSPTYFYAFYHHCQSEMKPSWADSAHGDEVPYVFGIPMIGPTDLFNCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVA-WSKYNPKDQLYLHI------GLKPRVRDHYRATKVAFWLELVPHLHN 601          
BLAST of COesterase domain-containing protein vs. Ensembl Cavefish
Match: nlgn4xb (neuroligin-4, X-linked-like [Source:NCBI gene;Acc:103022054])

HSP 1 Score: 236.113 bits (601), Expect = 5.296e-67
Identity = 178/591 (30.12%), Postives = 272/591 (46.02%), Query Frame = 3
Query:  168 IPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTV---------MSEDCLYLTIWTPQINVANE---LLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKE----ILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYS--FNDDEKNVSRSVMKFWTNFAKYGNPT-------------PTDFTEKGFWPAYTNKNKRYLKISGTNSGGFK--VENHFKQKHCRFWNKILPDLLN 1841
            +PYA PP G RRF+ PE  N+  W G+ ++T     C Q     +  L + +  +WF+  +          +EDCLYL ++ P      E   L PVM++I+GGSY+ G+  +   DGS+LAS  NV++V+  +R G LGFL   D  + GN  ++DQ   L+WV  +I +F GDP++VT+FG  +GA+ +S+   S  SE  FQ+AI+QSGT    WA+    A Y   + LAEK  C   ++ E+V+CL++       N   LI   I   +                   + I F P+ D  +I   D + + E     N D+++G N  E   F+         + +S   V  +            ++  + + +D  Y YP   K  L E    +  F    W  KE      + L  +  D Q++ P +  AD +     S  + Y F         P W    HG E+ YVFG+P      ++L+S  F+ ++  +S  VM +WTNFAK G+P              P  F E   W  Y  K++ YL I      G K  V +H++     FW +++P L N
Sbjct:   57 VPYALPPTGERRFQAPEPPNS--WPGIRNATQFAAVCPQYLE--DRLLLSDMLPVWFTANLDTVATYVQDQNEDCLYLNVYVPTEEDTQEDDGLKPVMVYIHGGSYVEGTGNM--IDGSVLASYGNVIVVTINYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWVKENIQAFNGDPRRVTIFGSGAGASCVSLLTLSHYSEDLFQKAIIQSGTALSSWAVNYQPAKY--TRMLAEKVGCNEDDSMEVVQCLQNK------NYKELIEQNITPAK-------------------YHIAFGPVIDGDVIPD-DPQILMEQGEFLNYDIMLGVNQGEGYKFVD-------SIVDSEDGVTGND-----------FEFAISDFVDNLYGYPE-GKDTLRE----TIKFMYTDWADKENPETRRKTLVALFTDHQWVAPAVATAD-LHAQYGSPTYFYAFYHHCQSEMKPAWADSAHGDELPYVFGIPMIG--PTDLFSCNFSKNDIMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVA-WSKYNPKDQLYLHI------GLKPRVRDHYRATKVAFWLELVPHLHN 580          
BLAST of COesterase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007813.1 (pep scaffold:Pmarinus_7.0:GL477731:150595:158527:1 gene:ENSPMAG00000007070.1 transcript:ENSPMAT00000007813.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 165.622 bits (418), Expect = 2.434e-46
Identity = 108/279 (38.71%), Postives = 151/279 (54.12%), Query Frame = 3
Query:  114 LKGKSI-FKMGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTV-------MSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAI--ESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLVNLN 920
            L+G  I    G  +  F  IPYAKPPIG+ RFR P  L    W GVY++T     C+Q              K WF + +         EDCLYL ++ P+  V+   + VM+WI+GG+Y  G  T E Y+G  LA+   V++V+  +R GPLG+L   D +S GN  + DQH  L WV ++I SFGGD  +VT+FGESSG     +HLFSK S+  FQ A+ QSG     WAI      AS   A+ LA    C +   ++++ CL++   EV  +++
Sbjct:   51 LQGLRINLGQGISVEAFVGIPYAKPPIGDLRFRKPVPLEK--WDGVYNATTFSPACYQ--------------KPWFLEEISFGKFDHFDEDCLYLNVFIPE--VSENKMAVMVWIHGGAYRYG--TAEEYEGRFLAAA-GVILVTVNYRLGPLGWLSTGDEQSRGNYGLWDQHAALMWVKHNIESFGGDANRVTIFGESSGGGGTGLHLFSKHSQGLFQAAVSQSGCALAHWAILLPPWKASDTAAQ-LANALQCPTSPTKDMITCLKTKPAEVFHDVD 307          
BLAST of COesterase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002735.1 (pep scaffold:Pmarinus_7.0:GL485913:3796:8263:-1 gene:ENSPMAG00000002501.1 transcript:ENSPMAT00000002735.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 130.568 bits (327), Expect = 1.484e-34
Identity = 85/248 (34.27%), Postives = 122/248 (49.19%), Query Frame = 3
Query:  150 IFHFSKIPYAKPPIGNRRFRYPEKLNNPP--WTGVYDSTVQPLTCWQGAPSIE-------FELKNPIGKMWFSKTVMSEDCLYLTIWTP-----QINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLG-FLYLDDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANC 848
            +  F  +PYA+ P G RRF   E    PP  W+G  ++  +   C Q  P+         +E  N     W S    SE+CL L ++ P      I      L VM++++GGS++ G+  L  YDGS LA+  +V++V   +R G LG F    D+ + GN  ++DQ M L+WV  ++  FGGD  +VTL G  +GA   S+   S  +E  FQR I QSGT    WA+       + A  LA    C
Sbjct:    1 VTQFLGVPYARAPRGERRFSAAE----PPAVWSGEREAATRGPPCPQPVPNHRGWGMLPVWEAGNERLATWLSSK-QSEECLNLDVYIPGRDGESIPGERPPLAVMVFLHGGSFLDGAGGL--YDGSALAAHGDVIVVIVTYRLGVLGSFFSTGDSLARGNYGLLDQVMALRWVRENVGHFGGDQGRVTLVGAGTGAACASLLALSHHAEGLFQRVIAQSGTALSSWALNHR--PELSAAALARSVGC 239          
BLAST of COesterase domain-containing protein vs. Ensembl Sea Lamprey
Match: tg (thyroglobulin [Source:ZFIN;Acc:ZDB-GENE-030519-1])

HSP 1 Score: 136.346 bits (342), Expect = 3.309e-33
Identity = 81/248 (32.66%), Postives = 129/248 (52.02%), Query Frame = 3
Query:  159 FSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELK----NPIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSAS-YIKAKYLAEKANCTSRNNQEIVKCLR 887
            F  +PYA PP+   RF  P+    PP         +PL   +   +  ++ +     P G+     T +SEDCLYL I+ P++   N    V+++ +GG    G S     D S LA+L ++++V+  +R G  GFL   D  + GN  ++DQ   L+WV +H   FGG    VT+ G+ S A ++ +HL +  S   FQRAIL  G++  P A++  SA+   +A  LA+   C   +++ +V+CLR
Sbjct: 2235 FLGVPYAAPPLDANRFSGPQ----PP---------RPLAVNETWDADRYKTRPDCLQPDGQ---RGTSLSEDCLYLNIFVPKVKPHNA--SVLVFFHGGDNSFGGSAQGPLDPSYLAALGDIIVVTANYRLGLFGFLSTGDEAAAGNWGLLDQQAALRWVRDHAALFGGSAGAVTVAGDRSSADNVGLHLVAPGSRGLFQRAILMGGSVLSPSAVQLDSATARSQAASLAQLVGCGHSSSEYLVRCLR 2464          
BLAST of COesterase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007921.1 (pep scaffold:Pmarinus_7.0:GL476391:291925:322499:1 gene:ENSPMAG00000007162.1 transcript:ENSPMAT00000007921.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.227 bits (269), Expect = 7.231e-25
Identity = 99/381 (25.98%), Postives = 157/381 (41.21%), Query Frame = 3
Query:  741 FQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGN---PTPTDFT---------EKGFWPAYTNKNKRYLKISGTNSGGFK--VENHFKQKHCRFWNKILPDLLN 1841
            FQRAI QSGT    WAI      Y +   LAE  NC   + Q++V+CLRS     LVN +             K M+             + + F P+ D  +I   D + + E     N D+++G N  E + F+             S + +   +S  + N+ +    ++ N +D  Y YP     +          + D++  ++   + L  +  D Q++ P +  AD +     S  ++Y F         P W    HG E  YVFG+P          +F+ ++  +S  VM +WTNFAK G+   P P D           E+  W  Y+ K++ YL I      G K  V  H++     FW +++P L N
Sbjct:   10 FQRAITQSGTALSSWAINYQPVKYTR--LLAENVNCNMLDTQDVVECLRSRSFRELVNQDI------------KPMR-------------YHVAFGPVIDGDVIPD-DPQILMEQGEFLNYDVMLGINQGEGLKFV------------ESMVDIDDGVS--AANFDN----IVSNFVDNLYGYPEGKDELRATIKFMYTDWADRN-NAETRRKTLVALFTDHQWVAPAMATAD-LHAQYGSPTYVYAFYHHCQSEMKPAWADAAHGDETPYVFGVPMVGPTLLFPCNFSKNDVMLSAVVMTYWTNFAKTGDPNAPVPQDTKFIHNKPNRYEEMAWSKYSPKDQHYLHI------GLKPRVREHYRATKVAFWLELVPHLHN 336          
BLAST of COesterase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010324.1 (pep scaffold:Pmarinus_7.0:GL476365:247673:258231:-1 gene:ENSPMAG00000009350.1 transcript:ENSPMAT00000010324.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.064 bits (253), Expect = 3.434e-23
Identity = 92/382 (24.08%), Postives = 148/382 (38.74%), Query Frame = 3
Query:  741 FQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPT-------------PTDFTEKGFWPAYTNKNKRYLKISGTNSGGFK--VENHFKQKHCRFWNKILPDLLN 1841
            FQRA+ QSGT    WA       Y +   LAEK  C   +  ++V+CLRS       + + L+  +I   R                   + + F P+ D  +I       + +G+ + N D+++G N  E   F+         + +    V  +   Y           V+ N +D  Y YP     +          + D+   ++   + L  +  D Q++ P +  AD +     S  + Y F         P W    HG EI YVFG+P          +F+ ++  +S  VM +WTNFAK G+P              P  F E   W  Y  +++ YL I      G K  +  H++     FW +++P L N
Sbjct:    9 FQRAVTQSGTALSSWAFNYQPIKYTR--MLAEKVTCNRLDTHDLVECLRSR------SFHELVAQEITPVR-------------------YHVAFGPVIDGDVIPDDPQILMEQGEFL-NYDVMLGINQGEGFKFVE-------DIVDGEDGVAANDFDY-----------VVSNFVDNLYGYPEGKDELRATIKFMYTDWADRD-NAETRRKTLVALFTDHQWVAPAVATAD-LHAQYGSPTYFYAFYHHCQSEMKPAWADAAHGDEIPYVFGVPMVGPTELFPCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVA-WSKYNPRDQHYLHI------GLKPRMREHYRATKVAFWLELVPHLHN 335          
BLAST of COesterase domain-containing protein vs. Ensembl Nematostella
Match: EDO47082 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN68])

HSP 1 Score: 229.565 bits (584), Expect = 6.187e-67
Identity = 169/581 (29.09%), Postives = 271/581 (46.64%), Query Frame = 3
Query:  141 GKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFE----LKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAE----KANCTSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYG---LSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYS-----FNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILPDL 1835
            G ++  F  IPYA+PP+G  RF  P  L   PW+GV D+T     C Q  P  EF     L  P GK   +    +EDCL ++++TPQ +  ++   VM++I+GG + SG+S    YD S+L +L++V++V+  +R G LGF  + DTE  GN  ++DQ + L+WV  +I SFGG+PK VT+FGES+G  S+S+HL S +S+  F R I QSG+       +S    Y+K   L E       C    + ++V CLR T  E +    F  +  ++                    +   +   P+ D+  +       + EG+ V   D+++G  ANE     M     +     L E  +++     + P +N       + +  +  +Y               Q     + S T++++   L     D  FI P I F  +   S     F+Y F    +   +P +   +HG +I Y FG P +   +S L++      ++ EK +S  +MK W +FAK+G+P   D      WP Y    + +L I+       +VE  F+ +   FWN+ +P L
Sbjct:   28 GLQVRQFRAIPYAQPPVGKLRFAAP--LPAKPWSGVRDATQHGPVCPQ-LPDEEFGKMLGLDLPPGKTIENS---NEDCLTISVYTPQNSDPDKQRAVMVFIHGGGFTSGAS--RDYDPSVLVALNDVIVVTINYRLGVLGFFNIPDTEYKGNYGLLDQVLALQWVQQNIASFGGNPKSVTIFGESAGGMSVSLHLLSPLSKGLFHRVIAQSGSAVT----DSFVGHYVKTTALLEVFSKAVGCPF--DDKLVDCLRITSSEDV----FAAQSNVSYPNN----------------VGAQLLTTPVIDKHFLPDKARRLLGEGR-VNKADVMLGVTANEGALLAMMTPGRIEGGLTLQELHQVIEYGLDTCPPDN------TMCKEAIKFEY---------------QDHRDPNNSVTNRQLYMDLY---SDSMFIAPAI-FEANALASAGHATFVYKFENLPDFFALPPYCASVHGIDIPYTFGFPLTLGESSPLFASLVRRHSEREKGLSMYMMKTWADFAKHGDPN-HDGDAPVPWPRYNTTAQAHLVIAHEP----RVEYKFRAEKVAFWNEFIPKL 543          
BLAST of COesterase domain-containing protein vs. Ensembl Nematostella
Match: EDO35390 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLM1])

HSP 1 Score: 223.402 bits (568), Expect = 1.000e-64
Identity = 183/610 (30.00%), Postives = 282/610 (46.23%), Query Frame = 3
Query:   39 LIVLCFCLSYDAIVV--HIKIDNQTFPLKGKSIFKMGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPP--WTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNK-----DLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKS-WTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYS-FNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILPDL 1835
            L  +C     D ++     KI     P+ G      G ++  F  IPYA+ P+G  RF  P+    PP  WTG+ D+      C Q AP +      P  +       +SEDCL+L ++ P     N  LPVM+WI+GG Y    +T   +DGS+LAS +NV++V+  +R   LGFL++  T+  GN  ++DQ   LKWV  +I SFGG+P  VTLFGESSGA S+++H+ S +S   FQ AI++SG+   P+   S  AS     ++ E+  C  + N  ++ CLR  KP                          ++DF             P+F    + K+ +    E  L+  +      ++IG N +E  F           L+ S++ V  +  S  + +       + +N  D +     L +  +H Y   + H D  + W   E  + L    GD  F  P  + A+S+ K+  S  +MYLF  R+  +  P   GV H  E++YVFG P+  +    L S + + E+ +S  +MK WT+FAK  +P      E   WP Y+ + ++YL+I        +V          FWNK +P L
Sbjct:   16 LFSVCSLAEQDVVITLEQGKIQGMREPVPG------GYEVEIFLGIPYARAPVGELRFADPQ----PPLEWTGIRDAKSYRAVCPQ-APFL------PNFQPLTENDTISEDCLFLNVYRP--TKFNHKLPVMVWIHGGGYYH--ATANWFDGSVLASHNNVIVVTINYRLALLGFLHIPGTQLRGNYGMLDQVQALKWVQQNIASFGGNPSHVTLFGESSGAASVTLHILSPLSAGLFQTAIIESGSAVSPFGAYSPRASNHYDVFI-ERLGCFDKEN--LLNCLRE-KP--------------------------FEDFERAVGGVDPRMPGPMFPVPTVDKVFLPDEPEALLLAGRFNKIESVIIGFNKDEGTF-----------LYSSAEPVTYAPPSIGAFHKAVHEVTLTQNGDDCEL----LKQAAIHRY---TNHSDPSNPWNLWENWKNLM---GDTFFFAPVTRTANSLAKAGIST-YMYLFTHRSTFSMFPPETGVCHFVEVQYVFGSPWKPNPKIGLTSGYTEVERGLSSFLMKLWTDFAKNRDP-----NETVTWPLYSAERQKYLEIDLVT----RVRRMPHADRVAFWNKFVPKL 543          
BLAST of COesterase domain-containing protein vs. Ensembl Nematostella
Match: EDO35372 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLM2])

HSP 1 Score: 219.55 bits (558), Expect = 3.184e-63
Identity = 175/600 (29.17%), Postives = 291/600 (48.50%), Query Frame = 3
Query:   69 DAIVVHIKIDNQTFPLKG--KSIFKMGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFR-PIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPS----LTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYS-FNDDEKNVSRSVMKFWTNFAKYGNPTPT-DFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQK--HCRFWNKILPDL 1835
            D +VVH+ +      L+G  +S+    ++   F  IP+A+PPIG+ RF  P K     W+GV ++      C  G       +  P+     S   MSEDCL+L ++ P    A + LPVM++I+GG Y  GS   +VYDG+ LA+ ++V++V+  +R G LGFL++  T+  GN A+ DQ + LKWV  HI  FGGDP +VTLFG+S+G  S+ +   S +S+  F+RAIL+S T        +++  YI      ++  C   + ++++ CL+S                  K+ +E L  +G  DF     L   I F  P  D   + K     I+EGQ+     +++G N+NE  F   +G             V+ +  S PS +      +  E+I+++ +        + + I++ Y   ++ F     +   +L     +  + +F  P I+ A +  K+     F Y F+  +  ++ P  +GV+H  EI YVFG+P+  +    + + + D E+ +S  VM+ W  FA  G+P    D  +   WP Y+ + + YL I      G ++  H K +     FWN+ +P L
Sbjct:   28 DDVVVHLSVGK----LRGIRESVSGTEREAESFYGIPFAEPPIGDLRF-VPSKPAKG-WSGVRNARKPGARCVYG------RVMPPMAAKPASPDSMSEDCLFLNVFRPAGTKATKDLPVMVFIHGGGYYRGSG--DVYDGTPLAAYNDVIVVTMNYRLGLLGFLHVAGTDVTGNYAMYDQILALKWVQQHIGCFGGDPSQVTLFGQSAGGASVLLLTLSPLSKGLFKRAILESPTETYGTYPTNNTKVYI------DRLGC---HGEKVLACLQS------------------KSLEEILKAQGIADF-----LLLGIVFPVPAVDGSFLGKDPDVMIAEGQVHPLDAVIVGVNSNEGGFH-WHG-------------VMETPDSQPSVS------MFKESIVNVSFTKQGDCDIVKEAIMYRYTNHTEPF-----SPHNLLHNWQRLVTEYRFFAPAIRMAQAYVKAGIPTYF-YHFSHWSTFSKRPKSVGVVHFDEIPYVFGLPWKPNKGIQVATKYTDVERGLSTMVMRMWGEFAYTGSPMKAGDSPQNVTWPLYSTEQEEYLDI------GLQLSVHRKLRPDGMAFWNEFVPLL 549          
BLAST of COesterase domain-containing protein vs. Ensembl Nematostella
Match: EDO37610 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFA0])

HSP 1 Score: 216.083 bits (549), Expect = 1.058e-61
Identity = 161/573 (28.10%), Postives = 269/573 (46.95%), Query Frame = 3
Query:  150 IFHFSKIPYAKPPIGNRRFRYPEKLNNPP--WT-GVYDSTVQPLTCWQGAPSIEFELKNPIGKMW--FSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSS--ASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLT-KLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILPDLLNR 1844
            ++ F  +PYA+PP+ N RF+ P     PP  W   +Y++T     C Q        + N     W  F++   SEDCLYL I+TP IN      PV+ +I+GG + +G+   +V  G  L  L  +V+V+ Q+R G  GFL   D E+PGN  ++DQ   L+W   +I +FGG+P  +T+ GES+G  S+ +HL S +S+  FQRAI  SG  F P+A+  +    +Y+K K +AE+  C   ++  +++CLR      L                        + +++      D +F P    ++  + D  ++          LL G  ++E  F           L E++++       Y  E   +      ++ L +++   S+  K+ L     Q   + DK   S +I +K+  +  D   I PT   + ++     +  +M+ F  R+   + P W+GV+HG    Y FG+P     ++  + +++ ++NVS  ++  + NFAKYGNPTP+       W  +   NK YLKI         + + F      FWN+  P L++R
Sbjct:   49 VYKFLGVPYAEPPVKNLRFKGPI----PPRSWAPSIYEATEFKDICTQSYRHYGGSINN----AWPTFTEKRFSEDCLYLNIYTPSINPDGTHYPVIFYIHGGGFFAGTPIRDVTPGEFLP-LRGIVLVTVQYRLGIFGFLTTGDAEAPGNAGLLDQVEALQWTKRNIFNFGGEPNNITIMGESAGGASVGLHLMSPLSKGLFQRAIAVSGVEFSPFALLPNDVVVNYVK-KTVAEELECNFDSSSAMLECLREMPSSKL------------------------EPYFNLVKPIIDGFFLPDDPHRLREQGDFHRVP---------LLSGFVSHEGSF-----------LLENARV------KYTMEGMRN----FAQHFLRMEFYSNSMPDKVSLDALLFQYTPWLDKK-DSNKIRKKMIEMLSDSFVIAPT-HASLTLHSKHGAPTYMFEFTHRSRRHKKPAWMGVVHGDTTAYKFGVPL---LSAQQHIYDEQDRNVSDMLVTMFVNFAKYGNPTPSPVHGTN-WERFNTSNKAYLKIQPN----VVLASKFHPARMAFWNEYFPGLVSR 547          
BLAST of COesterase domain-containing protein vs. Ensembl Nematostella
Match: EDO36346 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIV4])

HSP 1 Score: 206.838 bits (525), Expect = 8.699e-59
Identity = 160/566 (28.27%), Postives = 261/566 (46.11%), Query Frame = 3
Query:  156 HFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKN---PIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLY-----SFNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILP 1829
             F  I YA+ PIG+ RF   + + +  W GV D+T     C Q    +   + N   P G         SEDCL L+I+TPQ + + +L  VM+W++       S +   +D S+L +LH+V++V+  +R G LGF  + DT+  GN  + DQ + L+WV  +I SFGG+P+ VT+FGES G  S+S HL S IS+  F R I QSG+      +   + S    K  A+   C    N  +V CLR+   + +       R+  A     K++                    P+ D + ++    + + EG+ +   D+++G NANE  FF +        LF         K   P +      +  L++   ++ +     K    EY  Q     + + T++++L +    G D  F+ P +  A ++  +  +  F Y+F    +   V  WL  MHG ++ ++ G+PFS    + L      +++  +K +S  +M+ WTNFAKYG+P  T  T    WP +    + +L IS       +VE   +     FWN+  P
Sbjct:   28 QFRAIRYAEAPIGDLRFAKSKPVRS--WNGVKDATQHGPICPQEKDEVFIRMLNIDIPEG---------SEDCLTLSIYTPQ-HTSPKLRAVMVWVH--GGGFSSGSSRGFDPSVLVALHDVIVVTINYRLGVLGFFNIPDTDVKGNYGLFDQSLALQWVQQNIASFGGNPQSVTIFGESVGGMSVSAHLLSPISKGLFHRVIAQSGSASFDSFVGHEANSAGLVKVFADAIGC--EFNASLVVCLRTKSVKEVFEAQ---RNVTAPQNSGKML-----------------LTTPVVDGEFLTGSTKQLLREGK-INKADVMLGVNANEGGFFAL--------LFPGHL-----KNGLPQQQLHAAMETSLKSFTGMNTIALEAVKF---EY--QDNKKLNDNITNRQMLMEF---GTDYMFLAPAVFEAIALANAGQAPFF-YVFEHLPDFYHVGPWLSSMHGLDLLFMTGVPFSPGHNAKLLQALVGNYSAMDKGLSLYMMELWTNFAKYGDPNHTQSTPV-VWPRFNATFQSHLIISLNP----RVEQMPRADKMAFWNEFFP 529          
BLAST of COesterase domain-containing protein vs. Ensembl Medaka
Match: ache (acetylcholinesterase (Cartwright blood group) [Source:NCBI gene;Acc:101161586])

HSP 1 Score: 326.25 bits (835), Expect = 2.407e-102
Identity = 203/595 (34.12%), Postives = 293/595 (49.24%), Query Frame = 3
Query:  144 KKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQ-------GAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDT-ESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSS----NFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSK-----------------LFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILPDLLN 1841
            + +  F  IP+ +PP+G RRFR  E     PW GVY +   P  C+Q       G P IE         MW     MSEDCLYL IW P  +V    LPVM+WIYGG + SGSS+L+VYDG  LAS+ NV++VS  +R G  GFL LD T E+PGN  ++DQ M L+WV N+I SFGGDP++VT+FGES+G  S+  HL S  S   F RAILQSG    PWA  + + +  +A  LA    C   N+ E+V CLR   P+ L++  + +    A                      F   F P+ D +++       ++ G    +  +L+G N +E  +FL+YG       N  L      +   KM  P  N      I LE ++                  +Q   + D++   ++    +D I GD   ICP   FA S  +  + K                 +++YLF+ R +    P+W+GV+HGYEIE+VFG+P          ++  +E+ +SR +M++W NFA+ GNP          WP +T   ++++   G N+   K+    + + C FWN+ LP LLN
Sbjct:   49 RPVVGFLGIPFGEPPVGKRRFRPAEPKR--PWQGVYKADSYPNACFQFVDKSYPGFPGIE---------MWNPNREMSEDCLYLNIWVPS-SVKPHNLPVMVWIYGGGFYSGSSSLDVYDGRYLASVENVIVVSMNYRIGAFGFLALDGTSEAPGNVGLLDQRMALQWVQNNIASFGGDPRQVTIFGESAGGASVGYHLLSPGSRPLFTRAILQSGVPNCPWASVTYAEARRRATQLANAVGCNGGNDTELVDCLRGKTPQELIDQEWQVLPWTA---------------------LFRFSFVPVVDGEVLPDAPEAMVNSGDF-KDTQILLGVNQDEGSYFLLYGAPGFSKDNDSLISRKDFLAGVKMGVPHAN-----DIGLEAVV------------------LQYTDWMDEN-NGEKNRDAMDDIVGDHNVICPLALFASSYARHHAEKANNGFGHLNNAGNSQGGVYLYLFDHRASNLAWPEWMGVIHGYEIEFVFGLPLEKRL-----NYTSEEEKLSRRMMRYWANFARTGNPNEGIPDRGRRWPVFTLSEQKHV---GLNTEPMKIHKGLRNQMCAFWNRFLPRLLN 577          
BLAST of COesterase domain-containing protein vs. Ensembl Medaka
Match: bche (butyrylcholinesterase [Source:NCBI gene;Acc:100529181])

HSP 1 Score: 317.39 bits (812), Expect = 2.616e-99
Identity = 195/581 (33.56%), Postives = 299/581 (51.46%), Query Frame = 3
Query:  114 LKGKSIFKMGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANEL--LPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTES-PGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEI-LQKLDFIG---GDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILPDL 1835
            ++GK I  +G ++  F  IPY KPP+G  RFR PE      W  V D+T  P +C+Q  P   F       +MW   T +SEDCLYL +WTP  N    L   PV++WI+GG +++G+ST+++Y G IL+    VV+VS  +R G  GFL L D ++  GN  ++DQ + L+WV+++I +FGGDP KVTLFGES+GA S+  HL S  S  +FQRA++QSG    PWA  +    + ++  L++   C   N   +  CL+                   +   +K+  + Y        L F   F P  D   ++  +VEK+  G  +  K+L+IG N +E   FL+YG S  F +   S I     ++  +   T+ + I+ E ++                       F+   WT KE  ++  D IG   GD  F+CP + FA+  +++   K F Y F+ R++    P+W+GV HGYEIE+VFGMP ++        +  +E N+++ +MK WTNFA+ G P      +   WP +T + + Y+ +   N    + +   K K C+ WN ILP +
Sbjct:   39 VQGKLISVLGGEVRAFLGIPYGKPPLGKLRFRAPEPAEK--WEAVKDATKFPNSCYQ-MPDTAFPGFQG-AEMWNPNTPLSEDCLYLNVWTPVFNKTQPLPSAPVLVWIHGGGFVTGTSTIDLYHGHILSKSEGVVVVSINYRLGAFGFLSLPDNKNIRGNAGLLDQSLALRWVSSNIAAFGGDPSKVTLFGESAGAASVGFHLLSPASHGFFQRAVMQSGCPNAPWATVNQKDLWDRSMMLSKALGCPMSNRGLLETCLQ-------------------QADAKKITAKQYDIITKPPLLNFP--FGPTVDGVFLTA-EVEKLLTGGNLPKKELMIGLNKDEGTCFLVYG-SPGFSITGQSLISRRDFLAGVNLTLTNAHSIIKEAVI-----------------------FEYTDWTDKESRMKNRDSIGQLVGDQMFVCPVVDFANKYSQN-GGKTFFYFFDHRSSLMSWPEWMGVAHGYEIEFVFGMPLNTSL-----GYTKNEVNMTKKIMKHWTNFARTGQPG----IDGAAWPHFTAQ-QEYVTL---NYNHPEKKMMIKPKECQLWNSILPQI 555          
BLAST of COesterase domain-containing protein vs. Ensembl Medaka
Match: bche (butyrylcholinesterase [Source:NCBI gene;Acc:100529181])

HSP 1 Score: 317.39 bits (812), Expect = 2.616e-99
Identity = 195/581 (33.56%), Postives = 299/581 (51.46%), Query Frame = 3
Query:  114 LKGKSIFKMGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANEL--LPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTES-PGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEI-LQKLDFIG---GDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILPDL 1835
            ++GK I  +G ++  F  IPY KPP+G  RFR PE      W  V D+T  P +C+Q  P   F       +MW   T +SEDCLYL +WTP  N    L   PV++WI+GG +++G+ST+++Y G IL+    VV+VS  +R G  GFL L D ++  GN  ++DQ + L+WV+++I +FGGDP KVTLFGES+GA S+  HL S  S  +FQRA++QSG    PWA  +    + ++  L++   C   N   +  CL+                   +   +K+  + Y        L F   F P  D   ++  +VEK+  G  +  K+L+IG N +E   FL+YG S  F +   S I     ++  +   T+ + I+ E ++                       F+   WT KE  ++  D IG   GD  F+CP + FA+  +++   K F Y F+ R++    P+W+GV HGYEIE+VFGMP ++        +  +E N+++ +MK WTNFA+ G P      +   WP +T + + Y+ +   N    + +   K K C+ WN ILP +
Sbjct:   39 VQGKLISVLGGEVRAFLGIPYGKPPLGKLRFRAPEPAEK--WEAVKDATKFPNSCYQ-MPDTAFPGFQG-AEMWNPNTPLSEDCLYLNVWTPVFNKTQPLPSAPVLVWIHGGGFVTGTSTIDLYHGHILSKSEGVVVVSINYRLGAFGFLSLPDNKNIRGNAGLLDQSLALRWVSSNIAAFGGDPSKVTLFGESAGAASVGFHLLSPASHGFFQRAVMQSGCPNAPWATVNQKDLWDRSMMLSKALGCPMSNRGLLETCLQ-------------------QADAKKITAKQYDIITKPPLLNFP--FGPTVDGVFLTA-EVEKLLTGGNLPKKELMIGLNKDEGTCFLVYG-SPGFSITGQSLISRRDFLAGVNLTLTNAHSIIKEAVI-----------------------FEYTDWTDKESRMKNRDSIGQLVGDQMFVCPVVDFANKYSQN-GGKTFFYFFDHRSSLMSWPEWMGVAHGYEIEFVFGMPLNTSL-----GYTKNEVNMTKKIMKHWTNFARTGQPG----IDGAAWPHFTAQ-QEYVTL---NYNHPEKKMMIKPKECQLWNSILPQI 555          
BLAST of COesterase domain-containing protein vs. Ensembl Medaka
Match: bche (butyrylcholinesterase [Source:NCBI gene;Acc:100529181])

HSP 1 Score: 317.39 bits (812), Expect = 2.616e-99
Identity = 195/581 (33.56%), Postives = 299/581 (51.46%), Query Frame = 3
Query:  114 LKGKSIFKMGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANEL--LPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTES-PGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEI-LQKLDFIG---GDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILPDL 1835
            ++GK I  +G ++  F  IPY KPP+G  RFR PE      W  V D+T  P +C+Q  P   F       +MW   T +SEDCLYL +WTP  N    L   PV++WI+GG +++G+ST+++Y G IL+    VV+VS  +R G  GFL L D ++  GN  ++DQ + L+WV+++I +FGGDP KVTLFGES+GA S+  HL S  S  +FQRA++QSG    PWA  +    + ++  L++   C   N   +  CL+                   +   +K+  + Y        L F   F P  D   ++  +VEK+  G  +  K+L+IG N +E   FL+YG S  F +   S I     ++  +   T+ + I+ E ++                       F+   WT KE  ++  D IG   GD  F+CP + FA+  +++   K F Y F+ R++    P+W+GV HGYEIE+VFGMP ++        +  +E N+++ +MK WTNFA+ G P      +   WP +T + + Y+ +   N    + +   K K C+ WN ILP +
Sbjct:   39 VQGKLISVLGGEVRAFLGIPYGKPPLGKLRFRAPEPAEK--WEAVKDATKFPNSCYQ-MPDTAFPGFQG-AEMWNPNTPLSEDCLYLNVWTPVFNKTQPLPSAPVLVWIHGGGFVTGTSTIDLYHGHILSKSEGVVVVSINYRLGAFGFLSLPDNKNIRGNAGLLDQSLALRWVSSNIAAFGGDPSKVTLFGESAGAASVGFHLLSPASHGFFQRAVMQSGCPNAPWATVNQKDLWDRSMMLSKALGCPMSNRGLLETCLQ-------------------QADAKKITAKQYDIITKPPLLNFP--FGPTVDGVFLTA-EVEKLLTGGNLPKKELMIGLNKDEGTCFLVYG-SPGFSITGQSLISRRDFLAGVNLTLTNAHSIIKEAVI-----------------------FEYTDWTDKESRMKNRDSIGQLVGDQMFVCPVVDFANKYSQN-GGKTFFYFFDHRSSLMSWPEWMGVAHGYEIEFVFGMPLNTSL-----GYTKNEVNMTKKIMKHWTNFARTGQPG----IDGAAWPHFTAQ-QEYVTL---NYNHPEKKMMIKPKECQLWNSILPQI 555          
BLAST of COesterase domain-containing protein vs. Ensembl Medaka
Match: nlgn3b (neuroligin 3b [Source:NCBI gene;Acc:100529175])

HSP 1 Score: 230.72 bits (587), Expect = 4.724e-65
Identity = 172/592 (29.05%), Postives = 267/592 (45.10%), Query Frame = 3
Query:  144 KKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTV---------MSEDCLYLTIWTPQIN--VANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQK-LDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGN---PTPTDFT---------EKGFWPAYTNKNKRYLKISGTNSGGFK--VENHFKQKHCRFWNKILPDLLN 1841
            + +  +  +PYA PP+G +RF  PE+ ++  W+GV ++T     C Q   S   E+  PI   WF+  +          SEDCLYL I+ P  +    +E  PVM++I+GGSYM G+  +   DGSILAS  NV++V+  +R G LGFL   D  + GN  ++DQ   L+W++ +I  FGGDP ++T+FG   GA+ +S+   S  SE  F RAI+QSG+    WA+      Y   + LAE+  C   +  ++V CL+    + LV  +     Q A+ R                     + F P+ D  +I   D E + E     N D+++G N  E + F+   +     +  S                   +   + + +D  Y YP     +          + DK   + E  +K L  +  D Q++ P++  AD   +  S   F Y F         P W    HG E+ YVFG+P          +F+ ++  +S  VM +WTNFAK G+   P P D           E+  W  Y   ++ YL I      G K  + +H++     FW  ++P L N
Sbjct:   72 RPVDQYLGVPYAAPPVGEKRFMPPEQPSS--WSGVKNATHFMPVCPQNIHSTVPEIMMPI---WFTYNLDTVATYIQDQSEDCLYLNIYAPTDDDIRDSEARPVMVYIHGGSYMEGTGNM--MDGSILASYGNVIVVTLNYRIGILGFLSTGDQAAKGNYGLLDQIQALRWISKNIGYFGGDPGRITVFGSGIGASCVSLLTLSHHSEGLFHRAIIQSGSALSSWAVNYQPVKY--TRMLAERVGCNVLDTVDMVSCLQKKSAKELVEQDI----QAARYR---------------------VAFGPVIDGDVIPD-DPEILMEQGEFLNYDIMLGVNQGEGLRFVENAMDLEDGVSGSD------------------FDFAVSDFVDSLYGYPEGKDTLRETIKFMYTDWADKD--NPETRRKTLVALFTDHQWVEPSVVTADLHARYGSPTYF-YAFYHHCQSLMKPVWSDSAHGDEVPYVFGIPMVGPTDLFPCNFSRNDIMLSAVVMTYWTNFAKSGDPNKPVPQDTKFIHTKANRFEEVAWSKYNPYDQMYLHI------GLKPRIRDHYRATKVAFWKHLVPHLYN 601          
BLAST of COesterase domain-containing protein vs. Planmine SMEST
Match: SMESG000017894.1 (SMESG000017894.1)

HSP 1 Score: 1290.79 bits (3339), Expect = 0.000e+0
Identity = 645/648 (99.54%), Postives = 645/648 (99.54%), Query Frame = 3
Query:   12 MRVEFEASSLIVLCFCLSYDAIVVHIKIDNQTFPLKGKSIFKMGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILPDLLNRLLNKKNGXXXXXXXXXXXXXXXXXXXXXFMALCFRSI 1955
            MRVEFEASSLIVLCFCLSYDAIVVHIKIDNQTFPLKGKSIFKMGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQIN ANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFW KILPDLLNRLLNKKNGSSALLLVDSLLVS VLKVLASFMALCFRSI
Sbjct:    1 MRVEFEASSLIVLCFCLSYDAIVVHIKIDNQTFPLKGKSIFKMGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQINAANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRFWTKILPDLLNRLLNKKNGSSALLLVDSLLVSYVLKVLASFMALCFRSI 648          
BLAST of COesterase domain-containing protein vs. Planmine SMEST
Match: SMESG000010788.1 (SMESG000010788.1)

HSP 1 Score: 517.309 bits (1331), Expect = 5.254e-176
Identity = 260/595 (43.70%), Postives = 369/595 (62.02%), Query Frame = 3
Query:   87 IKIDNQTFPLKGKSIFKMGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQ--EIVKCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKLDVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPTD---FTEKGFWPAYTNKNKRYLKISGTNSGGFKVEN-HFKQKHCRFWNKILPDLLNRLLN 1853
            I I  + + L G ++   GK I HF++IPYA PPI N RF+YP+++    W GVY++T  P TCWQ     EF+  NP  ++W SKT MSEDCLYLTIW+P+       LPVM+WIYGGS+ SGSSTLEVYDGSILA+ H VV+VS Q+R GPLGFLYLDDT +PGNQ +MDQ M LKWV ++I +F GD + +T+FGES+G+  +S+H+ S +S   F+RAI++S T    WAIE+   S  K   +++  NC   + Q   ++KCL+  KP++LV+  F +++ + K R + L + G K+ ++DA+ FFDI+FRP +D   I++     +++     N +LL+G NANE MFFL+YGL+     F   ++   S +S  + NY    K +LEN+   D  Y +L  L+LHEY I S  F+ K W S ++L  LD + GD  F+CP I +A+ +   K+ K+++Y F  RT+    P W G MHGYEIEYVFGMPFS +F +  Y+F  +E  +S  +M  W NFAK+GNPT      F     WP Y   +K  +  +  +         + K   C+FWNK++P +L +  N
Sbjct:   33 ILIKEKRYELLGLTLNIYGKTIDHFARIPYALPPINNLRFKYPQEIVGNQWKGVYNATTSPNTCWQ-VEGGEFDKLNPAARLWLSKTPMSEDCLYLTIWSPR--TVKTKLPVMVWIYGGSFFSGSSTLEVYDGSILAAKHEVVVVSLQYRLGPLGFLYLDDTLAPGNQGLMDQRMALKWVKDNIYNFNGDSESITIFGESAGSVGVSIHVLSPLSNNLFKRAIMESATASAAWAIETKKESKEKGLAISKFVNCNYDSWQVNVLLKCLQKVKPDLLVSKQFDLKNIVNKQRSDLLRRRGVKNLFTDASFFFDIFFRPTYDANFINQPVNLLLNDSTFKPNIELLMGYNANEGMFFLLYGLNKWLNFFNKGEVEDTSLLSSNNPNYIKASKFLLENLTPNDIAYTNLLPLLLHEYKIPSTIFNWKKWNSTDVLSALDQLTGDQNFVCPVIDYAE-LLADKNVKVYLYSFQHRTSRMTFPKWTGTMHGYEIEYVFGMPFSKNFQNLFYTFTTEEAKLSNYIMTLWANFAKFGNPTTQKIEYFDSTLSWPLYNTTSKLSVYFTTPHESQLNAARLNDKAMKCKFWNKVIPPILEKFKN 623          
BLAST of COesterase domain-containing protein vs. Planmine SMEST
Match: SMESG000005922.1 (SMESG000005922.1)

HSP 1 Score: 343.969 bits (881), Expect = 4.948e-109
Identity = 215/603 (35.66%), Postives = 322/603 (53.40%), Query Frame = 3
Query:  138 MGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQIN------VANE--LLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIV--------KCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSD-----AALFFDIYFRPIFDQKIISKLDVEKISEGQ-LVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPT-----DFTEKGFWPAY--TNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILPDLLNRLLNKK 1859
            +GK ++ F  IPYAKPP+G  RFR PE +N   W G Y +T  P TC+Q  P   +EL NP  ++W + T MSEDCLYL+IWTP+IN      + NE  ++  ++WI+GG +  GSSTL++Y+G ILAS  NV++V+ Q+R GP GFL  +  E PGNQ +MDQ + L+W+ ++I  FGGD K VT+FG +SGA S S HL S +++  F +AI+QSG+    WA +    +  KA + A  + C   N++E V        +CLRS  P  LV              + K++ E Y++  +      A+ +FDI F+P      + K      +  +  +  K +++GT  NE +  L  G    F   + S +V P+   Y   N  DP  ++   I++  ++     + I  EY + S+ F   +W S++I+   D I GD  F CP + FAD     K +++++Y F  +T    +P W GV+ G EI YVFG PF  +F    Y+F+++E  +S  +M +WTNFA+ G P          T    W  Y  TN N R   I   N        +F++  C FW   LPD+   +L+K+
Sbjct:   44 LGKPVYVFLGIPYAKPPVGRLRFRNPELVNK--WEGTYSATKLPKTCYQNLPE-HYELNNPAWRIWTNNTEMSEDCLYLSIWTPKINKNQNRKMFNEKFIISTLVWIHGGGFTGGSSTLDIYNGEILASKMNVIVVNIQYRLGPFGFLSYNVKEIPGNQGLMDQVLALQWIRDNIGFFGGDSKLVTIFGANSGAVSASFHLLSPLTQDLFNQAIMQSGSALSWWAYDDPKTAISKAYHFANLSGC--HNSKETVEIKTSDLFECLRSLDPITLV------------VNQWKMLNERYREKLTKPILPYASFYFDIPFKPTIGGLYLPKPPSSYFAGKEPKILRKRVMLGTTKNEGLIHLFKGFRHYFMPSDDS-LVQPALFRY-GPNTKDPADLLAHYIVNDKFVNHFNIEAIAFEYELPSKIFQQSNWKSQDIINVFDNIAGDFSFKCPVVDFADKYL--KIAQVYLYSFEQQTQFLPLPPWSGVLQGQEIAYVFGKPFDMEFRKKYYNFSEEEMKLSEKIMSYWTNFAQTGQPNNRMREYHTRTRGMHWDTYSGTNINGRKHLIFRNNR--VLAGRNFRRHECLFWRNYLPDMRKNILSKR 623          
BLAST of COesterase domain-containing protein vs. Planmine SMEST
Match: SMESG000005922.1 (SMESG000005922.1)

HSP 1 Score: 342.813 bits (878), Expect = 1.037e-108
Identity = 215/603 (35.66%), Postives = 321/603 (53.23%), Query Frame = 3
Query:  138 MGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQIN------VANE--LLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIV--------KCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSD-----AALFFDIYFRPIFDQKIISKLDVEKISEGQ-LVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPT-----DFTEKGFWPAY--TNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILPDLLNRLLNKK 1859
            +GK ++ F  IPYAKPP+G  RFR PE +N   W G Y +T  P TC+Q  P   +EL NP  ++W + T MSEDCLYL+IWTP+IN      + NE  ++  ++WI+GG +  GSSTL++Y+G ILAS  NV++V+ Q+R GP GFL  +  E PGNQ +MDQ + L+W+ ++I  FGGD K VT+FG +SGA S S HL S +++  F +AI+QSG+    WA +    +  KA + A  + C   N++E V        +CLRS  P  LV              + K++ E Y++  +      A+ +FDI F+P      + K      +  +  +  K +++GT  NE +  L  G    F   + S +V P+   Y   N  DP  ++   I++  ++     + I  EY + S+ F   +W S++I+   D I GD  F CP + FAD     K +++++Y F  +T    +P W GV+ G EI YVFG PF  +F    Y+F+++E  +S  +M +WTNFA+ G P          T    W  Y  TN N R   I   N        +F++  C FW   LPD+   +L+ K
Sbjct:   44 LGKPVYVFLGIPYAKPPVGRLRFRNPELVNK--WEGTYSATKLPKTCYQNLPE-HYELNNPAWRIWTNNTEMSEDCLYLSIWTPKINKNQNRKMFNEKFIISTLVWIHGGGFTGGSSTLDIYNGEILASKMNVIVVNIQYRLGPFGFLSYNVKEIPGNQGLMDQVLALQWIRDNIGFFGGDSKLVTIFGANSGAVSASFHLLSPLTQDLFNQAIMQSGSALSWWAYDDPKTAISKAYHFANLSGC--HNSKETVEIKTSDLFECLRSLDPITLV------------VNQWKMLNERYREKLTKPILPYASFYFDIPFKPTIGGLYLPKPPSSYFAGKEPKILRKRVMLGTTKNEGLIHLFKGFRHYFMPSDDS-LVQPALFRY-GPNTKDPADLLAHYIVNDKFVNHFNIEAIAFEYELPSKIFQQSNWKSQDIINVFDNIAGDFSFKCPVVDFADKYL--KIAQVYLYSFEQQTQFLPLPPWSGVLQGQEIAYVFGKPFDMEFRKKYYNFSEEEMKLSEKIMSYWTNFAQTGQPNNRMREYHTRTRGMHWDTYSGTNINGRKHLIFRNNR--VLAGRNFRRHECLFWRNYLPDMRKNILSSK 623          
BLAST of COesterase domain-containing protein vs. Planmine SMEST
Match: SMESG000005922.1 (SMESG000005922.1)

HSP 1 Score: 342.043 bits (876), Expect = 1.420e-107
Identity = 214/600 (35.67%), Postives = 319/600 (53.17%), Query Frame = 3
Query:  138 MGKKIFHFSKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFELKNPIGKMWFSKTVMSEDCLYLTIWTPQIN------VANE--LLPVMIWIYGGSYMSGSSTLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTESPGNQAIMDQHMLLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQSGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIV--------KCLRSTKPEVLVNLNFLIRDQIAKTRKEKLMKEGYKDFYSD-----AALFFDIYFRPIFDQKIISKLDVEKISEGQ-LVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSKMSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWTSKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEVPDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFAKYGNPTPT-----DFTEKGFWPAY--TNKNKRYLKISGTNSGGFKVENHFKQKHCRFWNKILPDLLNRLL 1850
            +GK ++ F  IPYAKPP+G  RFR PE +N   W G Y +T  P TC+Q  P   +EL NP  ++W + T MSEDCLYL+IWTP+IN      + NE  ++  ++WI+GG +  GSSTL++Y+G ILAS  NV++V+ Q+R GP GFL  +  E PGNQ +MDQ + L+W+ ++I  FGGD K VT+FG +SGA S S HL S +++  F +AI+QSG+    WA +    +  KA + A  + C   N++E V        +CLRS  P  LV              + K++ E Y++  +      A+ +FDI F+P      + K      +  +  +  K +++GT  NE +  L  G    F   + S +V P+   Y   N  DP  ++   I++  ++     + I  EY + S+ F   +W S++I+   D I GD  F CP + FAD     K +++++Y F  +T    +P W GV+ G EI YVFG PF  +F    Y+F+++E  +S  +M +WTNFA+ G P          T    W  Y  TN N R   I   N        +F++  C FW   LPD+   +L
Sbjct:   44 LGKPVYVFLGIPYAKPPVGRLRFRNPELVNK--WEGTYSATKLPKTCYQNLPE-HYELNNPAWRIWTNNTEMSEDCLYLSIWTPKINKNQNRKMFNEKFIISTLVWIHGGGFTGGSSTLDIYNGEILASKMNVIVVNIQYRLGPFGFLSYNVKEIPGNQGLMDQVLALQWIRDNIGFFGGDSKLVTIFGANSGAVSASFHLLSPLTQDLFNQAIMQSGSALSWWAYDDPKTAISKAYHFANLSGC--HNSKETVEIKTSDLFECLRSLDPITLV------------VNQWKMLNERYREKLTKPILPYASFYFDIPFKPTIGGLYLPKPPSSYFAGKEPKILRKRVMLGTTKNEGLIHLFKGFRHYFMPSDDS-LVQPALFRY-GPNTKDPADLLAHYIVNDKFVNHFNIEAIAFEYELPSKIFQQSNWKSQDIINVFDNIAGDFSFKCPVVDFADKYL--KIAQVYLYSFEQQTQFLPLPPWSGVLQGQEIAYVFGKPFDMEFRKKYYNFSEEEMKLSEKIMSYWTNFAQTGQPNNRMREYHTRTRGMHWDTYSGTNINGRKHLIFRNNR--VLAGRNFRRHECLFWRNYLPDMRKNIL 620          
The following BLAST results are available for this feature:
BLAST of COesterase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BCHE1.228e-10032.51butyrylcholinesterase [Source:HGNC Symbol;Acc:HGNC... [more]
BCHE6.256e-10032.45butyrylcholinesterase [Source:HGNC Symbol;Acc:HGNC... [more]
ACHE3.559e-9631.62acetylcholinesterase (Cartwright blood group) [Sou... [more]
ACHE3.559e-9631.62acetylcholinesterase (Cartwright blood group) [Sou... [more]
ACHE8.513e-9631.62acetylcholinesterase (Cartwright blood group) [Sou... [more]
back to top
BLAST of COesterase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ace-15.364e-9130.47Acetylcholinesterase 1 [Source:UniProtKB/Swiss-Pr... [more]
ace-15.364e-9130.47Acetylcholinesterase 1 [Source:UniProtKB/Swiss-Pr... [more]
ace-49.606e-8631.92Carboxylic ester hydrolase [Source:UniProtKB/TrEM... [more]
ace-25.298e-8431.96Carboxylic ester hydrolase [Source:UniProtKB/TrEM... [more]
ace-35.249e-7829.11Carboxylic ester hydrolase [Source:UniProtKB/TrEM... [more]
back to top
BLAST of COesterase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ace1.200e-7327.63gene:FBgn0000024 transcript:FBtr0082780[more]
Ace1.200e-7327.63gene:FBgn0000024 transcript:FBtr0300486[more]
Ace2.194e-7327.63gene:FBgn0000024 transcript:FBtr0335223[more]
CG64141.547e-4834.00gene:FBgn0029690 transcript:FBtr0070624[more]
CG64141.547e-4834.00gene:FBgn0029690 transcript:FBtr0445312[more]
back to top
BLAST of COesterase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ache1.284e-8630.90acetylcholinesterase [Source:NCBI gene;Acc:114549][more]
nlgn2a2.324e-6830.48neuroligin 2a [Source:ZFIN;Acc:ZDB-GENE-090918-2][more]
nlgn4xa1.957e-6730.80neuroligin 4 X-linked a [Source:ZFIN;Acc:ZDB-GENE-... [more]
nlgn4xb4.344e-6630.13neuroligin 4 X-linked b [Source:ZFIN;Acc:ZDB-GENE-... [more]
nlgn4xb4.344e-6630.13neuroligin 4 X-linked b [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of COesterase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nfasc4.362e-10031.83neurofascin [Source:Xenbase;Acc:XB-GENE-922969][more]
ENSXETT00000046462.12.955e-9933.06butyrylcholinesterase [Source:NCBI gene;Acc:100495... [more]
ACHE3.975e-9132.36acetylcholinesterase (Cartwright blood group) [Sou... [more]
ENSXETT00000017364.18.340e-8132.39pep primary_assembly:Xenopus_tropicalis_v9.1:8:101... [more]
ENSXETT00000032055.12.279e-8032.39pep primary_assembly:Xenopus_tropicalis_v9.1:8:101... [more]
back to top
BLAST of COesterase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ache1.319e-9931.62acetylcholinesterase [Source:MGI Symbol;Acc:MGI:87... [more]
Ache1.319e-9931.62acetylcholinesterase [Source:MGI Symbol;Acc:MGI:87... [more]
Bche3.123e-9932.29butyrylcholinesterase [Source:MGI Symbol;Acc:MGI:8... [more]
Ces2f1.619e-7032.44carboxylesterase 2F [Source:MGI Symbol;Acc:MGI:191... [more]
Ces2f1.619e-7032.44carboxylesterase 2F [Source:MGI Symbol;Acc:MGI:191... [more]
back to top
BLAST of COesterase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q92035|ACES_BUNFA5.429e-10734.46Acetylcholinesterase OS=Bungarus fasciatus OX=8613... [more]
sp|P04058|ACES_TETCF1.570e-10334.30Acetylcholinesterase OS=Tetronarce californica OX=... [more]
sp|P07692|ACES_TORMA2.856e-10335.31Acetylcholinesterase OS=Torpedo marmorata OX=7788 ... [more]
sp|Q86GC8|ACES_CULPI4.302e-10335.25Acetylcholinesterase OS=Culex pipiens OX=7175 GN=A... [more]
sp|Q869C3|ACES_ANOGA1.195e-10234.91Acetylcholinesterase OS=Anopheles gambiae OX=7165 ... [more]
back to top
BLAST of COesterase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7YKI11.431e-13337.54Acetylcholinesterase OS=Clonorchis sinensis OX=799... [more]
A0A4S2L5T14.566e-13337.32COesterase domain-containing protein OS=Opisthorch... [more]
A0A074ZLQ92.997e-13236.69COesterase domain-containing protein OS=Opisthorch... [more]
A0A4S2L4721.257e-12739.03Carboxylic ester hydrolase OS=Opisthorchis felineu... [more]
A0A4E0RQY02.593e-12733.93Acetyl cholinesterase OS=Fasciola hepatica OX=6192... [more]
back to top
BLAST of COesterase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000006974.25.141e-9933.39cholinesterase [Source:NCBI gene;Acc:103037776][more]
ache1.403e-8932.82acetylcholinesterase (Cartwright blood group) [Sou... [more]
ache3.158e-8631.46acetylcholinesterase (Cartwright blood group) [Sou... [more]
nlgn4xa2.019e-6829.77neuroligin-4, X-linked [Source:NCBI gene;Acc:10302... [more]
nlgn4xb5.296e-6730.12neuroligin-4, X-linked-like [Source:NCBI gene;Acc:... [more]
back to top
BLAST of COesterase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007813.12.434e-4638.71pep scaffold:Pmarinus_7.0:GL477731:150595:158527:1... [more]
ENSPMAT00000002735.11.484e-3434.27pep scaffold:Pmarinus_7.0:GL485913:3796:8263:-1 ge... [more]
tg3.309e-3332.66thyroglobulin [Source:ZFIN;Acc:ZDB-GENE-030519-1][more]
ENSPMAT00000007921.17.231e-2525.98pep scaffold:Pmarinus_7.0:GL476391:291925:322499:1... [more]
ENSPMAT00000010324.13.434e-2324.08pep scaffold:Pmarinus_7.0:GL476365:247673:258231:-... [more]
back to top
BLAST of COesterase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of COesterase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO470826.187e-6729.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353901.000e-6430.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353723.184e-6329.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376101.058e-6128.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363468.699e-5928.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of COesterase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ache2.407e-10234.12acetylcholinesterase (Cartwright blood group) [Sou... [more]
bche2.616e-9933.56butyrylcholinesterase [Source:NCBI gene;Acc:100529... [more]
bche2.616e-9933.56butyrylcholinesterase [Source:NCBI gene;Acc:100529... [more]
bche2.616e-9933.56butyrylcholinesterase [Source:NCBI gene;Acc:100529... [more]
nlgn3b4.724e-6529.05neuroligin 3b [Source:NCBI gene;Acc:100529175][more]
back to top
BLAST of COesterase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017894.10.000e+099.54SMESG000017894.1[more]
SMESG000010788.15.254e-17643.70SMESG000010788.1[more]
SMESG000005922.14.948e-10935.66SMESG000005922.1[more]
SMESG000005922.11.037e-10835.66SMESG000005922.1[more]
SMESG000005922.11.420e-10735.67SMESG000005922.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022815 ID=SMED30022815|Name=COesterase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2060bp
CTAATTAAAAGATGAGAGTCGAATTTGAAGCTAGTTCATTAATTGTTTTA
TGTTTTTGTTTGTCGTATGATGCAATTGTAGTTCATATTAAAATTGATAA
CCAAACCTTTCCACTGAAAGGAAAATCCATCTTTAAAATGGGTAAAAAGA
TATTTCACTTTTCAAAAATTCCATACGCCAAACCTCCAATTGGAAATCGA
AGATTCCGATATCCCGAAAAACTAAATAACCCTCCTTGGACCGGAGTATA
TGATTCGACAGTCCAACCTCTGACGTGTTGGCAAGGAGCTCCGTCGATAG
AATTTGAGTTGAAAAATCCCATTGGGAAAATGTGGTTTTCTAAAACCGTA
ATGAGTGAAGATTGCCTTTATTTGACTATTTGGACCCCTCAAATAAATGT
AGCGAATGAACTTCTTCCAGTAATGATTTGGATCTATGGTGGATCGTATA
TGTCGGGCAGTAGTACTCTTGAAGTTTATGATGGATCGATATTAGCAAGT
CTACACAATGTTGTTATTGTTAGTTTTCAATTCAGAAGTGGGCCTTTGGG
ATTTTTGTATTTAGACGATACTGAAAGTCCTGGAAATCAAGCCATAATGG
ATCAACATATGCTTTTGAAATGGGTGAATAATCATATAGTATCATTTGGA
GGAGATCCTAAAAAAGTCACCTTGTTTGGTGAGTCCTCCGGTGCCACTAG
CATTTCAGTTCATTTATTTTCGAAAATTTCCGAAAAATATTTTCAAAGAG
CAATCCTTCAAAGTGGGACCATTTTTGTTCCTTGGGCTATAGAAAGTTCT
TCAGCAAGTTATATCAAAGCAAAATATCTAGCTGAAAAAGCTAACTGCAC
GAGCCGTAACAACCAAGAAATTGTCAAATGTCTTAGAAGTACCAAACCTG
AAGTTCTTGTAAATTTGAACTTTTTAATCCGTGATCAAATCGCGAAAACA
AGAAAGGAAAAACTAATGAAAGAAGGTTATAAAGACTTCTATTCTGATGC
TGCACTGTTCTTCGATATATATTTTCGTCCGATTTTCGATCAAAAAATAA
TCTCAAAATTGGATGTTGAGAAAATTAGTGAAGGCCAGCTAGTAACAAAT
AAAGATTTATTAATAGGGACAAATGCCAACGAAGCCATGTTTTTTCTGAT
GTACGGTTTAAGCAGTAACTTCAAGCTTTTCGAATCATCCAAAATTGTAC
TTCCGTCAAAAATGTCTTATCCCTCTGAAAATTACACAGATCCCTATAAA
ATTGTTTTGGAAAATATTCTAGATTTGGATTACTTATATCCAAGCCTAAC
AAAATTAATTTTACACGAATATGGCATTCAATCCCAACATTTTGACGATA
AATCTTGGACATCTAAAGAAATTTTACAAAAGCTAGATTTTATTGGGGGG
GATATGCAATTTATTTGCCCGACAATTCAGTTTGCCGATTCAGTTACGAA
ATCCAAATCTTCGAAATTGTTTATGTACCTTTTTAATTGTCGAACTAATG
GAACAGAAGTACCTGACTGGTTAGGGGTCATGCATGGATATGAAATTGAG
TATGTGTTTGGGATGCCTTTTTCCAGCGACTTCACCTCAAATCTTTACTC
ATTTAACGACGACGAGAAGAACGTCAGTAGATCTGTCATGAAATTTTGGA
CAAACTTTGCAAAATATGGAAACCCAACTCCAACCGATTTCACTGAGAAG
GGGTTTTGGCCAGCATATACTAACAAAAACAAGCGCTATTTAAAAATATC
AGGAACAAATTCCGGTGGATTTAAAGTAGAAAATCATTTCAAGCAAAAGC
ATTGTAGATTTTGGAACAAAATTTTACCAGATTTGTTAAACAGACTTCTT
AACAAAAAGAATGGCAGCTCGGCTTTATTATTAGTTGACAGTCTGTTGGT
CTCATCCGTTCTGAAAGTTTTGGCGTCATTTATGGCATTATGTTTTAGAA
GTATATGATTGATTTTTTTCTACAAAAGAAACGTTAGATTGTTATTTATT
ATTATTACTAGTTTATAATATTAAATTTATCATTATTGTAGCTGGAATTT
GTTAAATTGA
back to top

protein sequence of SMED30022815-orf-1

>SMED30022815-orf-1 ID=SMED30022815-orf-1|Name=SMED30022815-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=649bp
MRVEFEASSLIVLCFCLSYDAIVVHIKIDNQTFPLKGKSIFKMGKKIFHF
SKIPYAKPPIGNRRFRYPEKLNNPPWTGVYDSTVQPLTCWQGAPSIEFEL
KNPIGKMWFSKTVMSEDCLYLTIWTPQINVANELLPVMIWIYGGSYMSGS
STLEVYDGSILASLHNVVIVSFQFRSGPLGFLYLDDTESPGNQAIMDQHM
LLKWVNNHIVSFGGDPKKVTLFGESSGATSISVHLFSKISEKYFQRAILQ
SGTIFVPWAIESSSASYIKAKYLAEKANCTSRNNQEIVKCLRSTKPEVLV
NLNFLIRDQIAKTRKEKLMKEGYKDFYSDAALFFDIYFRPIFDQKIISKL
DVEKISEGQLVTNKDLLIGTNANEAMFFLMYGLSSNFKLFESSKIVLPSK
MSYPSENYTDPYKIVLENILDLDYLYPSLTKLILHEYGIQSQHFDDKSWT
SKEILQKLDFIGGDMQFICPTIQFADSVTKSKSSKLFMYLFNCRTNGTEV
PDWLGVMHGYEIEYVFGMPFSSDFTSNLYSFNDDEKNVSRSVMKFWTNFA
KYGNPTPTDFTEKGFWPAYTNKNKRYLKISGTNSGGFKVENHFKQKHCRF
WNKILPDLLNRLLNKKNGSSALLLVDSLLVSSVLKVLASFMALCFRSI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000997Cholinesterase
IPR002018CarbesteraseB
IPR029058AB_hydrolase
IPR019826Carboxylesterase_B_AS
Vocabulary: molecular function
TermDefinition
GO:0004104cholinesterase activity
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000997CholinesterasePRINTSPR00878CHOLNESTRASEcoord: 142..171
score: 52.69
coord: 461..469
score: 45.73
coord: 500..507
score: 51.44
coord: 508..520
score: 70.41
IPR002018Carboxylesterase, type BPFAMPF00135COesterasecoord: 35..601
e-value: 7.1E-133
score: 444.2
IPR029058Alpha/Beta hydrolase foldGENE3DG3DSA:3.40.50.1820coord: 32..618
e-value: 2.0E-150
score: 504.2
IPR029058Alpha/Beta hydrolase foldSUPERFAMILYSSF53474alpha/beta-Hydrolasescoord: 43..613
NoneNo IPR availablePANTHERPTHR43918FAMILY NOT NAMEDcoord: 34..619
IPR019826Carboxylesterase type B, active sitePROSITEPS00122CARBOXYLESTERASE_B_1coord: 212..227