Serine/threonine protein kinase, putative

Overview
NameSerine/threonine protein kinase, putative
Smed IDSMED30022813
Length (bp)2650
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine protein kinase, putative (SMED30022813) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine protein kinase, putative (SMED30022813) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine protein kinase, putative (SMED30022813) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine protein kinase, putative (SMED30022813) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022813

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 24

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30022813SMESG000003862.1 Contig985uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30022813SMESG000003862.1 Contig985newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30022813SMESG000062458.1 Contig4602GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30022813SMESG000003862.1 Contig4602GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30022813SMESG000042605.1 Contig985uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30022813SMESG000042605.1 Contig985newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parapharyngeal regionSMED30022813SMESG000003887.1 dd_Smed_v4_14000_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30022813SMESG000003887.1 dd_Smed_v4_14000_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30022813SMESG000003862.1 dd_Smed_v4_3667_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022813SMESG000003862.1 dd_Smed_v4_3667_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022813SMESG000003862.1 dd_Smed_v4_3667_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30022813SMESG000003862.1 dd_Smed_v4_3667_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022813SMESG000003862.1 dd_Smed_v4_3667_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022813SMESG000003862.1 dd_Smed_v4_3667_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022813SMESG000003862.1 Contig14391uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022813SMESG000003862.1 Contig14391newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022813SMESG000003862.1 Contig4418uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022813SMESG000003862.1 Contig4418newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022813SMESG000045245.1 Contig4418uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022813SMESG000045245.1 Contig4418newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022813SMESG000003862.1 Contig6733uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022813SMESG000003862.1 Contig6733newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parenchymal cellSMED30022813SMESG000003862.1 dd_Smed_v6_3667_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022813SMESG000003862.1 dd_Smed_v4_3667_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Human
Match: PLK1 (polo like kinase 1 [Source:HGNC Symbol;Acc:HGNC:9077])

HSP 1 Score: 79.337 bits (194), Expect = 1.646e-14
Identity = 47/163 (28.83%), Postives = 86/163 (52.76%), Query Frame = 3
Query: 1455 KTRIASNDEVIKWY-RQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIH--GQKRNEI--NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGK-CFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELL 1925
            K R A  +   ++Y RQI+ G   LH + +++ +L + ++ L+   ++K+    +AT +   G+++  +    +Y+APE+L  K  + + DVWS G I+  ++ GK  F  S  KE      + +I   +Y  P+ IN     +I + L  DP  R +++ELL
Sbjct:  143 KRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKE-----TYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELL 300          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Human
Match: STK26 (serine/threonine kinase 26 [Source:HGNC Symbol;Acc:HGNC:18174])

HSP 1 Score: 75.8702 bits (185), Expect = 4.850e-14
Identity = 47/159 (29.56%), Postives = 80/159 (50.31%), Query Frame = 3
Query: 1479 EVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIHGQ--KRNEI--NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEAL------NDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELL 1925
            ++    ++IL+GL  LH    ++ ++  +++LL  +GD+KLA   +A  +     KRN       ++APE++   A++ KAD+WS GI  +E+  G+  N       +      N+      D+TK          FK  ID CL +DP++R +  ELL
Sbjct:   43 QIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLVGDFTK---------SFKEFIDACLNKDPSFRPTAKELL 192          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Human
Match: STK26 (serine/threonine kinase 26 [Source:HGNC Symbol;Acc:HGNC:18174])

HSP 1 Score: 75.8702 bits (185), Expect = 9.108e-14
Identity = 47/159 (29.56%), Postives = 80/159 (50.31%), Query Frame = 3
Query: 1479 EVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIHGQ--KRNEI--NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEAL------NDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELL 1925
            ++    ++IL+GL  LH    ++ ++  +++LL  +GD+KLA   +A  +     KRN       ++APE++   A++ KAD+WS GI  +E+  G+  N       +      N+      D+TK          FK  ID CL +DP++R +  ELL
Sbjct:  120 QIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLVGDFTK---------SFKEFIDACLNKDPSFRPTAKELL 269          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Human
Match: STK26 (serine/threonine kinase 26 [Source:HGNC Symbol;Acc:HGNC:18174])

HSP 1 Score: 75.8702 bits (185), Expect = 9.806e-14
Identity = 47/159 (29.56%), Postives = 80/159 (50.31%), Query Frame = 3
Query: 1479 EVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIHGQ--KRNEI--NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEAL------NDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELL 1925
            ++    ++IL+GL  LH    ++ ++  +++LL  +GD+KLA   +A  +     KRN       ++APE++   A++ KAD+WS GI  +E+  G+  N       +      N+      D+TK          FK  ID CL +DP++R +  ELL
Sbjct:  120 QIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLVGDFTK---------SFKEFIDACLNKDPSFRPTAKELL 269          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Human
Match: STK26 (serine/threonine kinase 26 [Source:HGNC Symbol;Acc:HGNC:18174])

HSP 1 Score: 75.8702 bits (185), Expect = 1.229e-13
Identity = 47/159 (29.56%), Postives = 80/159 (50.31%), Query Frame = 3
Query: 1479 EVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIHGQ--KRNEI--NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEAL------NDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELL 1925
            ++    ++IL+GL  LH    ++ ++  +++LL  +GD+KLA   +A  +     KRN       ++APE++   A++ KAD+WS GI  +E+  G+  N       +      N+      D+TK          FK  ID CL +DP++R +  ELL
Sbjct:  142 QIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLVGDFTK---------SFKEFIDACLNKDPSFRPTAKELL 291          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 74.3294 bits (181), Expect = 2.451e-14
Identity = 46/148 (31.08%), Postives = 77/148 (52.03%), Query Frame = 3
Query: 1497 RQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIH-GQKRNEI--NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKIDYTKYIFPRS-INERFKGVIDRCLVEDPNYRISVHELLS 1928
            ++ L+ L  LH H IV+ ++   ++LL   G++KL  +     I  G KR+ +     +++PEIL+ K +N K D+WS GI+ LE+I G+      ++  L        +    I  R  ++  F   +D+CLV DP+ R    ELL+
Sbjct:  101 QECLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFCAQIQPGSKRDTVVGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMIDGEPPYL--RETPLKAIYLIAQNGKPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLA 246          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 74.7146 bits (182), Expect = 1.039e-13
Identity = 46/148 (31.08%), Postives = 77/148 (52.03%), Query Frame = 3
Query: 1497 RQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIH-GQKRNEI--NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKIDYTKYIFPRS-INERFKGVIDRCLVEDPNYRISVHELLS 1928
            ++ L+ L  LH H IV+ ++   ++LL   G++KL  +     I  G KR+ +     +++PEIL+ K +N K D+WS GI+ LE+I G+      ++  L        +    I  R  ++  F   +D+CLV DP+ R    ELL+
Sbjct:  258 QECLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFCAQIQPGSKRDTVVGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMIDGEPPYL--RETPLKAIYLIAQNGKPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLA 403          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 74.3294 bits (181), Expect = 2.379e-13
Identity = 46/148 (31.08%), Postives = 77/148 (52.03%), Query Frame = 3
Query: 1497 RQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIH-GQKRNEI--NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKIDYTKYIFPRS-INERFKGVIDRCLVEDPNYRISVHELLS 1928
            ++ L+ L  LH H IV+ ++   ++LL   G++KL  +     I  G KR+ +     +++PEIL+ K +N K D+WS GI+ LE+I G+      ++  L        +    I  R  ++  F   +D+CLV DP+ R    ELL+
Sbjct:  433 QECLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFCAQIQPGSKRDTVVGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMIDGEPPYL--RETPLKAIYLIAQNGKPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLA 578          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 73.9442 bits (180), Expect = 2.813e-13
Identity = 46/148 (31.08%), Postives = 77/148 (52.03%), Query Frame = 3
Query: 1497 RQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIH-GQKRNEI--NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKIDYTKYIFPRS-INERFKGVIDRCLVEDPNYRISVHELLS 1928
            ++ L+ L  LH H IV+ ++   ++LL   G++KL  +     I  G KR+ +     +++PEIL+ K +N K D+WS GI+ LE+I G+      ++  L        +    I  R  ++  F   +D+CLV DP+ R    ELL+
Sbjct:  430 QECLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFCAQIQPGSKRDTVVGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMIDGEPPYL--RETPLKAIYLIAQNGKPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLA 575          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 73.9442 bits (180), Expect = 2.862e-13
Identity = 46/148 (31.08%), Postives = 77/148 (52.03%), Query Frame = 3
Query: 1497 RQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIH-GQKRNEI--NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKIDYTKYIFPRS-INERFKGVIDRCLVEDPNYRISVHELLS 1928
            ++ L+ L  LH H IV+ ++   ++LL   G++KL  +     I  G KR+ +     +++PEIL+ K +N K D+WS GI+ LE+I G+      ++  L        +    I  R  ++  F   +D+CLV DP+ R    ELL+
Sbjct:  481 QECLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFCAQIQPGSKRDTVVGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMIDGEPPYL--RETPLKAIYLIAQNGKPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLA 626          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Fly
Match: SAK (gene:FBgn0026371 transcript:FBtr0078387)

HSP 1 Score: 74.7146 bits (182), Expect = 2.228e-13
Identity = 56/260 (21.54%), Postives = 128/260 (49.23%), Query Frame = 3
Query: 1170 FSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINNSSLIKELRKLTVMNA---SERFVRIFAIYKGEGLVSVSMELMAISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIHGQKRNEI----NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGK-CFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELL 1925
            + +  +  K   + +YKA     +++VA+   ++ D K  I  + L   +R+   +++       ++++  ++    V + +EL      E  + ++   R  +  E     +Q++ GL  LH H I++ ++++S++LL  +  +K+A   +AT +       +      +Y++PE++   +  + ADVWS G +L  ++ G+  F   A +  LN     K+  ++YI P  ++   + +I++ L + P+ RI++  +L
Sbjct:   14 YEVQHLLGKGGFATVYKARCLHTHQDVAI---KMID-KKLIQGTGLTNRVRQEVEIHSRLKHPSVLQLYTFFQDANYVYLVLELAHNG--ELHRYMNHIARPFTETEAASILKQVVAGLLYLHSHNIMHRDISLSNLLLSREMHVKIADFGLATQLKRPDERHMTMCGTPNYISPEVVSRTSHGLPADVWSVGCMLYTLLVGRPPFETDAVQSTLN-----KVVMSEYIMPAHLSYEAQDLINKLLKKLPHERITLEAVL 262          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Fly
Match: Akt1 (gene:FBgn0010379 transcript:FBtr0083226)

HSP 1 Score: 74.3294 bits (181), Expect = 2.286e-13
Identity = 44/154 (28.57%), Postives = 76/154 (49.35%), Query Frame = 3
Query: 1461 RIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATA--IHGQKRNEI--NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRIS 1910
            RI + D    +  +I+  L  LH  GI+Y +L + ++LLD  G IK+A   +      +G+         +YLAPE+LD+  +    D W  G+++ E+I G+   ++   + L    F  I   +  FPR+I +  K ++   L +DP  R+ 
Sbjct:  278 RIFTEDRTRFYGAEIISALGYLHSQGIIYRDLKLENLLLDKDGHIKVADFGLCKEDITYGRTTKTFCGTPEYLAPEVLDDNDYGQAVDWWGTGVVMYEMICGRLPFYNRDHDVL----FTLILVEEVKFPRNITDEAKNLLAGLLAKDPKKRLG 427          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Fly
Match: Akt1 (gene:FBgn0010379 transcript:FBtr0344470)

HSP 1 Score: 74.3294 bits (181), Expect = 2.286e-13
Identity = 44/154 (28.57%), Postives = 76/154 (49.35%), Query Frame = 3
Query: 1461 RIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATA--IHGQKRNEI--NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRIS 1910
            RI + D    +  +I+  L  LH  GI+Y +L + ++LLD  G IK+A   +      +G+         +YLAPE+LD+  +    D W  G+++ E+I G+   ++   + L    F  I   +  FPR+I +  K ++   L +DP  R+ 
Sbjct:  278 RIFTEDRTRFYGAEIISALGYLHSQGIIYRDLKLENLLLDKDGHIKVADFGLCKEDITYGRTTKTFCGTPEYLAPEVLDDNDYGQAVDWWGTGVVMYEMICGRLPFYNRDHDVL----FTLILVEEVKFPRNITDEAKNLLAGLLAKDPKKRLG 427          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Fly
Match: Akt1 (gene:FBgn0010379 transcript:FBtr0344717)

HSP 1 Score: 74.3294 bits (181), Expect = 2.286e-13
Identity = 44/154 (28.57%), Postives = 76/154 (49.35%), Query Frame = 3
Query: 1461 RIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATA--IHGQKRNEI--NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRIS 1910
            RI + D    +  +I+  L  LH  GI+Y +L + ++LLD  G IK+A   +      +G+         +YLAPE+LD+  +    D W  G+++ E+I G+   ++   + L    F  I   +  FPR+I +  K ++   L +DP  R+ 
Sbjct:  278 RIFTEDRTRFYGAEIISALGYLHSQGIIYRDLKLENLLLDKDGHIKVADFGLCKEDITYGRTTKTFCGTPEYLAPEVLDDNDYGQAVDWWGTGVVMYEMICGRLPFYNRDHDVL----FTLILVEEVKFPRNITDEAKNLLAGLLAKDPKKRLG 427          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Fly
Match: Akt1 (gene:FBgn0010379 transcript:FBtr0083227)

HSP 1 Score: 74.3294 bits (181), Expect = 2.286e-13
Identity = 44/154 (28.57%), Postives = 76/154 (49.35%), Query Frame = 3
Query: 1461 RIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATA--IHGQKRNEI--NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRIS 1910
            RI + D    +  +I+  L  LH  GI+Y +L + ++LLD  G IK+A   +      +G+         +YLAPE+LD+  +    D W  G+++ E+I G+   ++   + L    F  I   +  FPR+I +  K ++   L +DP  R+ 
Sbjct:  278 RIFTEDRTRFYGAEIISALGYLHSQGIIYRDLKLENLLLDKDGHIKVADFGLCKEDITYGRTTKTFCGTPEYLAPEVLDDNDYGQAVDWWGTGVVMYEMICGRLPFYNRDHDVL----FTLILVEEVKFPRNITDEAKNLLAGLLAKDPKKRLG 427          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Zebrafish
Match: plk1 (polo-like kinase 1 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-021115-7])

HSP 1 Score: 85.8853 bits (211), Expect = 8.961e-17
Identity = 51/164 (31.10%), Postives = 88/164 (53.66%), Query Frame = 3
Query: 1455 KTRIASNDEVIKWY-RQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIH--GQKRNEI--NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGK-CFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELLS 1928
            K R A  +   +++ RQ ++G+  LH++ +++ +L + ++ L+   D+K+    +AT I   G+++  +    +Y+APE+L  K  + + D+WS G IL  ++ GK  F  S  KE      + +I   +Y  PR IN     +I R L  DP  R SV ELL+
Sbjct:  129 KRRKAVTEPEARYFMRQTIQGVQYLHNNRVIHRDLKLGNLFLNDDMDVKIGDFGLATKIEFDGERKKTLCGTPNYIAPEVLCKKGHSFEVDIWSLGCILYTLLVGKPPFETSCLKE-----TYIRIKKNEYSVPRHINPVASALIRRMLHADPTLRPSVAELLT 287          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Zebrafish
Match: plk1 (polo-like kinase 1 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-021115-7])

HSP 1 Score: 85.8853 bits (211), Expect = 8.961e-17
Identity = 51/164 (31.10%), Postives = 88/164 (53.66%), Query Frame = 3
Query: 1455 KTRIASNDEVIKWY-RQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIH--GQKRNEI--NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGK-CFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELLS 1928
            K R A  +   +++ RQ ++G+  LH++ +++ +L + ++ L+   D+K+    +AT I   G+++  +    +Y+APE+L  K  + + D+WS G IL  ++ GK  F  S  KE      + +I   +Y  PR IN     +I R L  DP  R SV ELL+
Sbjct:  129 KRRKAVTEPEARYFMRQTIQGVQYLHNNRVIHRDLKLGNLFLNDDMDVKIGDFGLATKIEFDGERKKTLCGTPNYIAPEVLCKKGHSFEVDIWSLGCILYTLLVGKPPFETSCLKE-----TYIRIKKNEYSVPRHINPVASALIRRMLHADPTLRPSVAELLT 287          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 78.9518 bits (193), Expect = 1.359e-14
Identity = 76/287 (26.48%), Postives = 134/287 (46.69%), Query Frame = 3
Query: 1107 NEMDAQDQEVKPLKESVGRLRFSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINN--SSLIKELRKLTVMNASERFVRIFAIYK--GEGLVSVSMELM-AISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASIN-------IATAIHGQKRNEINKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKI--DYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELL 1925
            + +  QD+ V P K     + +    +  +    ++Y   D    +E+A  Q          +   S+L  E++ L  ++  ER V+ +   +   E  +++ ME M   S+K+  KA    T   +     K+ RQILEG++ LH + IV+ ++  ++IL DS G++KL           I  +  G +       +++PE++  + +  KADVWS G  ++E++T K     A+ EA+  +  FKI    T    P  I+E  +  + RC+  +  YR S  ELL
Sbjct:  324 SRLRPQDRAV-PHKSPTAPVTWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEVSALECEIQLLKNLH-HERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR----KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEK--PPWAEFEAM--AAIFKIATQPTNPQLPSHISEHTRDFL-RCIFVEAKYRPSAEELL 599          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 78.1814 bits (191), Expect = 2.126e-14
Identity = 76/287 (26.48%), Postives = 134/287 (46.69%), Query Frame = 3
Query: 1107 NEMDAQDQEVKPLKESVGRLRFSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINN--SSLIKELRKLTVMNASERFVRIFAIYK--GEGLVSVSMELM-AISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASIN-------IATAIHGQKRNEINKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKI--DYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELL 1925
            + +  QD+ V P K     + +    +  +    ++Y   D    +E+A  Q          +   S+L  E++ L  ++  ER V+ +   +   E  +++ ME M   S+K+  KA    T   +     K+ RQILEG++ LH + IV+ ++  ++IL DS G++KL           I  +  G +       +++PE++  + +  KADVWS G  ++E++T K     A+ EA+  +  FKI    T    P  I+E  +  + RC+  +  YR S  ELL
Sbjct:  342 SRLRPQDRAV-PHKSPTAPVTWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEVSALECEIQLLKNLH-HERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR----KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEK--PPWAEFEAM--AAIFKIATQPTNPQLPSHISEHTRDFL-RCIFVEAKYRPSAEELL 617          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 78.1814 bits (191), Expect = 2.479e-14
Identity = 76/287 (26.48%), Postives = 134/287 (46.69%), Query Frame = 3
Query: 1107 NEMDAQDQEVKPLKESVGRLRFSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINN--SSLIKELRKLTVMNASERFVRIFAIYK--GEGLVSVSMELM-AISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASIN-------IATAIHGQKRNEINKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKI--DYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELL 1925
            + +  QD+ V P K     + +    +  +    ++Y   D    +E+A  Q          +   S+L  E++ L  ++  ER V+ +   +   E  +++ ME M   S+K+  KA    T   +     K+ RQILEG++ LH + IV+ ++  ++IL DS G++KL           I  +  G +       +++PE++  + +  KADVWS G  ++E++T K     A+ EA+  +  FKI    T    P  I+E  +  + RC+  +  YR S  ELL
Sbjct:  336 SRLRPQDRAV-PHKSPTAPVTWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEVSALECEIQLLKNLH-HERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR----KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEK--PPWAEFEAM--AAIFKIATQPTNPQLPSHISEHTRDFL-RCIFVEAKYRPSAEELL 611          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Xenopus
Match: ENSXETT00000045672.1 (protein kinase C delta type-like [Source:NCBI gene;Acc:101734050])

HSP 1 Score: 81.2629 bits (199), Expect = 3.613e-16
Identity = 58/212 (27.36%), Postives = 105/212 (49.53%), Query Frame = 3
Query: 1185 IFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINNSSLIKELRKLTVMNASERFVRIFAIYKGEGLVSVSMELMA-------ISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATA-IHGQKRNEINKD---YLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEA 1787
            +  K    Q+  A+   NN +VA+    +      +N  S+++E R L V         + A ++ +    ++ME  +       ++ K H K     TR     +VI +  +++ GL  LH  GI++ +L   +IL+ S+G IK+A   +A   I G     +++    Y+APE+L+++ +N   D W+FGIIL ++ TG+ + F+ K  A
Sbjct:   11 VLGKGTFGQVVLASTPTNNHQVAIKV--IPKKSRMVNRESILREARVLRVAAGHPYLCHMHAAFQTQNYAFIAMEFASRGSLKDLLTKKHHLK-----TR-----QVIFYSAEMVCGLQYLHSRGIIHSDLKPDNILVSSEGHIKIADFGLAAENIFGNDTICVHRGTMKYMAPEVLEDQQYNAAVDWWAFGIILCQMATGR-YPFNDKNGA 209          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Xenopus
Match: cpvl (carboxypeptidase, vitellogenic-like [Source:Xenbase;Acc:XB-GENE-1014879])

HSP 1 Score: 76.2554 bits (186), Expect = 6.224e-14
Identity = 48/167 (28.74%), Postives = 83/167 (49.70%), Query Frame = 3
Query: 1461 RIASNDE--VIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIHGQ--KRNEI--NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEAL------NDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELL 1925
            R+   DE  +    ++IL+GL  LH    ++ ++  +++LL  +GD+KLA   +A  +     KRN       ++APE++   A++ KAD+WS GI  +E+  G+  N       +      N+      D++K          FK  +D CL +DP++R +  ELL
Sbjct:  112 RVGPFDEFQIATMLKEILKGLDYLHSENKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPSLTGDFSK---------PFKEFVDACLNKDPSFRPTARELL 269          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Xenopus
Match: cpvl (carboxypeptidase, vitellogenic-like [Source:Xenbase;Acc:XB-GENE-1014879])

HSP 1 Score: 75.8702 bits (185), Expect = 7.692e-14
Identity = 48/167 (28.74%), Postives = 83/167 (49.70%), Query Frame = 3
Query: 1461 RIASNDE--VIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIHGQ--KRNEI--NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEAL------NDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELL 1925
            R+   DE  +    ++IL+GL  LH    ++ ++  +++LL  +GD+KLA   +A  +     KRN       ++APE++   A++ KAD+WS GI  +E+  G+  N       +      N+      D++K          FK  +D CL +DP++R +  ELL
Sbjct:  105 RVGPFDEFQIATMLKEILKGLDYLHSENKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPSLTGDFSK---------PFKEFVDACLNKDPSFRPTARELL 262          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Xenopus
Match: cpvl (carboxypeptidase, vitellogenic-like [Source:Xenbase;Acc:XB-GENE-1014879])

HSP 1 Score: 75.8702 bits (185), Expect = 7.934e-14
Identity = 48/167 (28.74%), Postives = 83/167 (49.70%), Query Frame = 3
Query: 1461 RIASNDE--VIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIHGQ--KRNEI--NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEAL------NDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELL 1925
            R+   DE  +    ++IL+GL  LH    ++ ++  +++LL  +GD+KLA   +A  +     KRN       ++APE++   A++ KAD+WS GI  +E+  G+  N       +      N+      D++K          FK  +D CL +DP++R +  ELL
Sbjct:  105 RVGPFDEFQIATMLKEILKGLDYLHSENKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPSLTGDFSK---------PFKEFVDACLNKDPSFRPTARELL 262          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Xenopus
Match: cpvl (carboxypeptidase, vitellogenic-like [Source:Xenbase;Acc:XB-GENE-1014879])

HSP 1 Score: 75.485 bits (184), Expect = 9.555e-14
Identity = 48/167 (28.74%), Postives = 83/167 (49.70%), Query Frame = 3
Query: 1461 RIASNDE--VIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIHGQ--KRNEI--NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEAL------NDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELL 1925
            R+   DE  +    ++IL+GL  LH    ++ ++  +++LL  +GD+KLA   +A  +     KRN       ++APE++   A++ KAD+WS GI  +E+  G+  N       +      N+      D++K          FK  +D CL +DP++R +  ELL
Sbjct:  100 RVGPFDEFQIATMLKEILKGLDYLHSENKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPSLTGDFSK---------PFKEFVDACLNKDPSFRPTARELL 257          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Mouse
Match: Plk1 (polo like kinase 1 [Source:MGI Symbol;Acc:MGI:97621])

HSP 1 Score: 82.8037 bits (203), Expect = 9.659e-16
Identity = 48/163 (29.45%), Postives = 86/163 (52.76%), Query Frame = 3
Query: 1455 KTRIASNDEVIKWY-RQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIH--GQKRNEI--NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGK-CFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELL 1925
            K R A  +   ++Y RQI+ G   LH + +++ +L + ++ L+   ++K+    +AT +   G+++  +    +Y+APE+L  K  + + DVWS G I+  ++ GK  F  S  KE      + +I   +Y  P+ IN     +I + L  DP  R ++HELL
Sbjct:  143 KRRKALTEPEARYYLRQIVLGCQYLHRNQVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYEGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKE-----TYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTIHELL 300          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Mouse
Match: Stk26 (serine/threonine kinase 26 [Source:MGI Symbol;Acc:MGI:1917665])

HSP 1 Score: 75.485 bits (184), Expect = 7.822e-14
Identity = 47/153 (30.72%), Postives = 78/153 (50.98%), Query Frame = 3
Query: 1497 RQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIHGQ--KRNEI--NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEAL------NDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELL 1925
            ++IL+GL  LH    ++ ++  +++LL  +GD+KLA   +A  +     KRN       ++APE++   A++ KAD+WS GI  +E+  G+  N       +      N+      D+TK          FK  ID CL +DP++R +  ELL
Sbjct:  126 KEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLIGDFTK---------SFKEFIDACLNKDPSFRPTAKELL 269          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Mouse
Match: Stk26 (serine/threonine kinase 26 [Source:MGI Symbol;Acc:MGI:1917665])

HSP 1 Score: 75.485 bits (184), Expect = 8.261e-14
Identity = 47/159 (29.56%), Postives = 80/159 (50.31%), Query Frame = 3
Query: 1479 EVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIHGQ--KRNEI--NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEAL------NDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELL 1925
            ++    ++IL+GL  LH    ++ ++  +++LL  +GD+KLA   +A  +     KRN       ++APE++   A++ KAD+WS GI  +E+  G+  N       +      N+      D+TK          FK  ID CL +DP++R +  ELL
Sbjct:  120 QIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLIGDFTK---------SFKEFIDACLNKDPSFRPTAKELL 269          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Mouse
Match: Prkcd (protein kinase C, delta [Source:MGI Symbol;Acc:MGI:97598])

HSP 1 Score: 76.6406 bits (187), Expect = 8.453e-14
Identity = 45/142 (31.69%), Postives = 76/142 (53.52%), Query Frame = 3
Query: 1500 QILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATA-IHGQKRNEI---NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISV 1913
            +I+ GL  LH  GI+Y +L + +++LD  G IK+A   +    I G+ R        DY+APEIL    ++   D WSFG++L E++ G+       ++ L +S   ++D   Y  PR I +  K ++++    DP+ R+ V
Sbjct:  454 EIICGLQFLHSKGIIYRDLKLDNVMLDRDGHIKIADFGMCKENIFGEGRASTFCGTPDYIAPEILQGLKYSFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFES--IRVDTPHY--PRWITKESKDIMEKLFERDPDKRLGV 591          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Mouse
Match: Prkcd (protein kinase C, delta [Source:MGI Symbol;Acc:MGI:97598])

HSP 1 Score: 76.2554 bits (186), Expect = 9.142e-14
Identity = 45/142 (31.69%), Postives = 76/142 (53.52%), Query Frame = 3
Query: 1500 QILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATA-IHGQKRNEI---NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISV 1913
            +I+ GL  LH  GI+Y +L + +++LD  G IK+A   +    I G+ R        DY+APEIL    ++   D WSFG++L E++ G+       ++ L +S   ++D   Y  PR I +  K ++++    DP+ R+ V
Sbjct:  339 EIICGLQFLHSKGIIYRDLKLDNVMLDRDGHIKIADFGMCKENIFGEGRASTFCGTPDYIAPEILQGLKYSFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFES--IRVDTPHY--PRWITKESKDIMEKLFERDPDKRLGV 476          
BLAST of Serine/threonine protein kinase, putative vs. UniProt/SwissProt
Match: sp|Q07832|PLK1_MOUSE (Serine/threonine-protein kinase PLK1 OS=Mus musculus OX=10090 GN=Plk1 PE=1 SV=2)

HSP 1 Score: 82.8037 bits (203), Expect = 6.757e-15
Identity = 48/163 (29.45%), Postives = 86/163 (52.76%), Query Frame = 3
Query: 1455 KTRIASNDEVIKWY-RQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIH--GQKRNEI--NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGK-CFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELL 1925
            K R A  +   ++Y RQI+ G   LH + +++ +L + ++ L+   ++K+    +AT +   G+++  +    +Y+APE+L  K  + + DVWS G I+  ++ GK  F  S  KE      + +I   +Y  P+ IN     +I + L  DP  R ++HELL
Sbjct:  143 KRRKALTEPEARYYLRQIVLGCQYLHRNQVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYEGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKE-----TYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTIHELL 300          
BLAST of Serine/threonine protein kinase, putative vs. UniProt/SwissProt
Match: sp|Q2TA25|PLK1_BOVIN (Serine/threonine-protein kinase PLK1 OS=Bos taurus OX=9913 GN=PLK1 PE=2 SV=2)

HSP 1 Score: 82.4185 bits (202), Expect = 7.040e-15
Identity = 48/163 (29.45%), Postives = 86/163 (52.76%), Query Frame = 3
Query: 1455 KTRIASNDEVIKWY-RQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIH--GQKRNEI--NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGK-CFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELL 1925
            K R A  +   ++Y RQI+ G   LH + +++ +L + ++ L+   ++K+    +AT +   G+++  +    +Y+APE+L  K  + + DVWS G I+  ++ GK  F  S  KE      + +I   +Y  P+ IN     +I + L  DP  R ++HELL
Sbjct:  141 KRRKALTEPEARYYLRQIVLGCQYLHGNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKE-----TYLRIKNNEYSIPKHINPVASSLIKKMLQPDPTARPTIHELL 298          
BLAST of Serine/threonine protein kinase, putative vs. UniProt/SwissProt
Match: sp|Q62673|PLK1_RAT (Serine/threonine-protein kinase PLK1 OS=Rattus norvegicus OX=10116 GN=Plk1 PE=2 SV=2)

HSP 1 Score: 82.4185 bits (202), Expect = 7.368e-15
Identity = 48/164 (29.27%), Postives = 87/164 (53.05%), Query Frame = 3
Query: 1455 KTRIASNDEVIKWY-RQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIH--GQKRNEI--NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGK-CFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELLS 1928
            K R A  +   ++Y RQI+ G   LH + +++ +L + ++ L+   ++K+    +AT +   G+++  +    +Y+APE+L  K  + + DVWS G I+  ++ GK  F  S  KE      + +I   +Y  P+ IN     +I + L  DP  R ++HELL+
Sbjct:  143 KRRKALTEPEARYYLRQIVLGCQYLHRNQVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYEGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKE-----TYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTIHELLN 301          
BLAST of Serine/threonine protein kinase, putative vs. UniProt/SwissProt
Match: sp|Q0PKV7|MKK5_LEIME (Mitogen-activated protein kinase kinase 5 OS=Leishmania mexicana OX=5665 GN=MKK5 PE=1 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 7.934e-15
Identity = 65/261 (24.90%), Postives = 126/261 (48.28%), Query Frame = 3
Query: 1182 GIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINNSSLIKELRKLTVMN-ASERFVRIFAIYKGEGLVSVSMELMAISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLH-DHGIVYDELTMSHILLDSK-GDIKLASINIATAIHGQKRNEIN----KDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKI------DYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELL 1925
            G   K     + +A    +NK VAL + +++  +  IN   + +EL  L   + A+   V  +  +  EG V ++ME M  SL E +K V           +    R +L+GL  LH +  +++ +L  S++L +S+ GDIK++   +++ +   K +  +      Y++PE L  + ++  AD+WS G+++ E+  G C  ++  +   +++ F+ +      D T    P  ++      I  C+V+ P+ R +  ELL
Sbjct:   63 GFLGKGSSGSVRRAVHRGSNKVVALKEIKVTG-QTHINE--IRRELETLHAGDFATPYLVSFYGAFAHEGSVFIAMEAMDGSLHELYKPVPPPV-------LACITRLMLKGLTYLHRNRHLIHRDLKPSNVLYNSRTGDIKISDFGVSSNLECTKADAHSFVGTVTYMSPERLRGEHYSYGADIWSLGLVVAELAVGVC-PYAGLRGGSSEARFWALLQHLNGDGTALELPPEMDSDLADFISACVVKSPDRRPTCTELL 312          
BLAST of Serine/threonine protein kinase, putative vs. UniProt/SwissProt
Match: sp|B4KYX8|PLK4_DROMO (Serine/threonine-protein kinase PLK4 OS=Drosophila mojavensis OX=7230 GN=SAK PE=3 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 2.651e-14
Identity = 43/160 (26.88%), Postives = 89/160 (55.62%), Query Frame = 3
Query: 1461 RIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIHGQKRNEI----NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGK-CFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELL 1925
            R  + DE     RQ+++GL  LH H I++ ++++S++LL     +K+A   +AT +       +      +Y++PE++ + +  + AD+WS G +L  ++ G+  F+  A +  LN     K+ ++ Y  P  ++   + +ID+ L ++P+ RIS+ ++L
Sbjct:  109 RPFTEDEASSILRQVVDGLLYLHSHNIMHRDISLSNLLLSKDMHVKIADFGLATQLKRPDERHMTMCGTPNYISPEVVSHMSHGLPADLWSVGCMLYTLLVGRPPFDTDAVQSTLN-----KVVHSDYTMPSHLSYEARDLIDKLLRKNPHERISLEQVL 263          
BLAST of Serine/threonine protein kinase, putative vs. TrEMBL
Match: A0A2V8LVA0 (Protein kinase domain-containing protein OS=Acidobacteria bacterium OX=1978231 GN=DMF75_16680 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 2.730e-17
Identity = 72/262 (27.48%), Postives = 129/262 (49.24%), Query Frame = 3
Query: 1167 RFSIIGIFKKQELSQIYKATDNFNNKEVAL---MQYRLSDWKAFINNSSLIKELRKLTVMNASERFVRIFAIYKGEGLVSVSMELMAISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIHGQKRNEI---NKDYLAPEILDNKAWNIKADVWSFGIILLEIITG-KCFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKG-------VIDRCLVEDPNYRIS 1910
            R+ I+G+  +  + ++Y+A D    + VAL    ++ L+D  A       ++  R++T  N      R++ I + EG   +SME +     E   ++  +      D+ I+  RQI  GLA  HD G+++ +L  +++++D  G+ ++    +A        +EI      Y+APE LD + + +++D++S G++L E+ TG K F      EA       K+  ++   P + +E  KG       VIDRCL +DP  R S
Sbjct:   70 RYRIVGLLGRGGMGEVYRAEDLKLGQPVALKFLPEHLLTDGAALARFHREVRVARQVTHRNV----CRVYDIGEVEGRHFLSMEFIR---GEELSSLSRRIGRLPQDKAIQIARQICAGLAAAHDVGVLHRDLKPANVMIDENGNARITDFGLAGLAEEFHEDEIRAGTPAYMAPEQLDGRTFTVRSDIYSLGLVLYELFTGRKAF------EAPTLGELVKLRRSETT-PTTPSEIVKGLDPLIEKVIDRCLQKDPEDRPS 317          
BLAST of Serine/threonine protein kinase, putative vs. TrEMBL
Match: A0A2V8ZLD8 (Protein kinase domain-containing protein OS=Acidobacteria bacterium OX=1978231 GN=DMG41_28340 PE=4 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 6.796e-16
Identity = 68/253 (26.88%), Postives = 128/253 (50.59%), Query Frame = 3
Query: 1167 RFSIIGIFKKQELSQIYKATDNFNNKEVAL--MQYRLS-DWKAFINNSSLIKELRKLTVMNASERFVRIFAIYKGEGLVSVSMELMAISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASIN---IATAIHGQKRNEINKDYLAPEILDNKAWNIKADVWSFGIILLEIITG-KCFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYR 1904
            R+ I+ +  +  + ++++A D    + VA+  +  RLS D +A     + ++  R+++  N      R+F I + +G + ++ME +     E   +V  +    S D+  +  RQI  GLA  H+ G+++ +L  ++I+LD  G I++       IA +I G++       Y+APE L  K    ++D++S G++L EI+TG + F  S  +E +       I +   +  R ++   + VI RCL  DP+ R
Sbjct:  113 RYRIVALAGRGGMGEVFRAEDLTLGQIVAMKFLPERLSQDARALARFHAEVRNARQVSHPNV----CRVFDIGETDGTLFLTMEYVD---GEDLASVVRRIGRLSPDKATEIARQICAGLAAAHERGVIHRDLKPANIMLDGAGKIRITDFGLAGIAASIQGEEARAGTPAYMAPEQLAGKQVTTRSDIYSLGLVLYEILTGQRAFEASTLRELVRLRESGTITHPSTLV-RDLDPLIERVILRCLESDPDKR 357          
BLAST of Serine/threonine protein kinase, putative vs. TrEMBL
Match: A0A2V8R1J5 (Uncharacterized protein (Fragment) OS=Acidobacteria bacterium OX=1978231 GN=DMF70_09885 PE=4 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 9.318e-16
Identity = 67/259 (25.87%), Postives = 129/259 (49.81%), Query Frame = 3
Query: 1167 RFSIIGIFKKQELSQIYKATDNFNNKEVAL---MQYRLSDWKAFINNSSLIKELRKLTVMNASERFVRIFAIYKGEGLVSVSMELMAISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIHGQKRNEI---NKDYLAPEILDNKAWNIKADVWSFGIILLEIITG-KCFNFSAKKEALNDSNFFKIDYTKYIFPRSI----NERFKGVIDRCLVEDPNYRIS 1910
            R+ I+G+  +  + ++Y+A D    + VAL    ++ LSD  A       ++  R+++  N      R++ I + +G   +SME +     E   ++  +       + I+  RQI  GLA  HD G+++ +L  S++++D  G+ ++    +A  +     +E+      Y++PE ++ +   +K+DV+S G++L E+ TG + F  S    +LND    +   T    P SI    +   + VIDRC+ +DP+ R +
Sbjct:  217 RYRIVGLLGRGGMGEVYRADDLKLGQPVALKFLPEHLLSDGAALARFHREVRVARQVSHRN----VCRVYDIGEIDGRHFLSMEFIK---GEELSSLLRRIGRLPGAKAIQIARQICAGLAAAHDVGVLHRDLKPSNVMIDEHGNARILDFGLAGLVEEFGHDEMRAGTPAYMSPEQIEGQEQTVKSDVYSLGLVLYELFTGQRAFEAS----SLNDMIKLRRSDTAPTTPTSIVKDLDPGVEKVIDRCIQKDPSLRPA 464          
BLAST of Serine/threonine protein kinase, putative vs. TrEMBL
Match: A0A4P9XQV2 (Kinase-like domain-containing protein (Fragment) OS=Thamnocephalis sphaerospora OX=78915 GN=THASP1DRAFT_2332 PE=3 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 1.803e-15
Identity = 60/224 (26.79%), Postives = 113/224 (50.45%), Query Frame = 3
Query: 1278 WKAFINNSSLIKELRKLTVMNASERFVRIFAIYKGEGLVSVSMELMAISLKEHFKAV--DGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIHGQKRNEI-----NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKC-FNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELL 1925
            WK  +N  ++   LR   V+       R++  ++    V + MEL   +  E F  +  +G+ R  +        RQ++ GL  LH HG+++ +L +S++LL +   +KL    +AT +   + +E        +Y+APE+L ++ +  ++D+WS G IL+ ++TG+  F   +  E L++     I    Y  P S++   + +  R L +DP+ RIS+ + L
Sbjct:   47 WKRVVNEVTIHLRLRHPAVL-------RLYDCFEDADHVYLVMEL--CTGGELFGQLHRNGRRRRLTEARTRDIMRQLISGLMYLHAHGVLHRDLKLSNVLLTADHRVKLGDFGLATLLRANRPDERRTLCGTPNYIAPEVLAHEPYGFESDIWSLGCILVALLTGRGPFEGQSTAETLDN-----IRNCTYSLPGSMSVASRDLARRFLQKDPHRRISLQKAL 256          
BLAST of Serine/threonine protein kinase, putative vs. TrEMBL
Match: C4M8G8 (Serine/threonine protein kinase, putative OS=Entamoeba histolytica OX=5759 GN=EHI_063010 PE=4 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 2.569e-15
Identity = 67/264 (25.38%), Postives = 126/264 (47.73%), Query Frame = 3
Query: 1170 FSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINNSSLIKELRKLTVMNASERFVRIFAIYKGEGLVSVSMELM-AISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIHGQKRNEINKD--------YLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKI---DYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELL 1925
            FSI     +    ++++  +  + + VA+ Q +++           I+ L+KL      +  VR  A  +  G + + ME M + SL    K  +      S     K+  Q+L+GLA +HD GIV+ ++  ++IL+   G +K+A   ++  ++G ++ E   D        ++APE++  +   +KAD+W+ G  ++E+ITG    +     A      +KI   DY    FP +++ + + ++  C   DPN R S  +LL
Sbjct:    2 FSIANSIGRGAYGEVFQGMNADSGEFVAIKQMKVNKKSVMKEVMEEIRLLKKL----KHKHIVRYIASTESHGFLYIIMEYMESGSLLNIVKKFNHLNESLS----AKYIHQVLDGLAFIHDQGIVHRDIKAANILVAKDGSVKIADFGVSVQMNGNEKQETGSDEDPIGTPNWMAPEVIQMQGTTVKADIWALGCTVIELITGNPPYYDLNPTAA----LYKIVNDDYPP--FPNTVSPQLREILFSCFKRDPNQRASSRDLL 251          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Cavefish
Match: plk1 (polo like kinase 1 [Source:NCBI gene;Acc:103034005])

HSP 1 Score: 82.4185 bits (202), Expect = 8.145e-16
Identity = 50/164 (30.49%), Postives = 87/164 (53.05%), Query Frame = 3
Query: 1455 KTRIASNDEVIKWY-RQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIH--GQKRNEI--NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGK-CFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELLS 1928
            K R A  +   +++ RQ ++G+  LH++ +++ +L + ++ L    ++K+    +AT I   G+++  +    +Y+APE+L  K  + + DVWS G IL  ++ GK  F  S  KE      + +I   +Y  PR IN     +I R L  DP  R SV +LL+
Sbjct:  128 KRRKAVTEPEARYFMRQTIQGVHYLHNNRVIHRDLKLGNLFLSDDMEVKIGDFGLATKIEFDGERKKTLCGTPNYIAPEVLCKKGHSFEVDVWSLGCILYTLLVGKPPFETSCLKE-----TYVRIKKNEYSIPRQINPVAASLIRRMLHADPTLRPSVADLLT 286          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Cavefish
Match: plk1 (polo like kinase 1 [Source:NCBI gene;Acc:103034005])

HSP 1 Score: 82.0333 bits (201), Expect = 1.001e-15
Identity = 50/164 (30.49%), Postives = 87/164 (53.05%), Query Frame = 3
Query: 1455 KTRIASNDEVIKWY-RQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIH--GQKRNEI--NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGK-CFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELLS 1928
            K R A  +   +++ RQ ++G+  LH++ +++ +L + ++ L    ++K+    +AT I   G+++  +    +Y+APE+L  K  + + DVWS G IL  ++ GK  F  S  KE      + +I   +Y  PR IN     +I R L  DP  R SV +LL+
Sbjct:  128 KRRKAVTEPEARYFMRQTIQGVHYLHNNRVIHRDLKLGNLFLSDDMEVKIGDFGLATKIEFDGERKKTLCGTPNYIAPEVLCKKGHSFEVDVWSLGCILYTLLVGKPPFETSCLKE-----TYVRIKKNEYSIPRQINPVAASLIRRMLHADPTLRPSVADLLT 286          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Cavefish
Match: stk17b (serine/threonine kinase 17b [Source:NCBI gene;Acc:103028616])

HSP 1 Score: 78.5666 bits (192), Expect = 4.091e-15
Identity = 78/266 (29.32%), Postives = 130/266 (48.87%), Query Frame = 3
Query: 1155 VGRLRFSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINNSSLIKELRKLTVMNASERFVRIFAIYKGEGLVSVSMELMAIS-LKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSK---GDIKLASINIATAIH--GQKRNEIN-KDYLAPEILDNKAWNIKADVWSFGIILLEIITGKC-FNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELLS 1928
            +GR +F+++   KK     + KAT      +    + R  D KA      +I E+  L    ++ R V + A Y+ E  + + +E  A   + EH  + +    + S  +VI+  RQ LEG+  LH   +V+ +L   +ILL S    GDIKL    +A  +   G+ R  +   +Y+APEIL+ +     +D+WS G+I   +ITG+  F    K++   + +   +DY+K  F R ++E     I + LV+ P  R S  + LS
Sbjct:   38 LGRGKFAVV---KKC----VEKATGKVFAAKFVRKRRRGRDCKA-----EVIHEMAVLEAAKSNPRVVNLHAAYETEHDIVLLLEYAAGGEIFEHCVSDE----LLSEGQVIRLIRQTLEGIHQLHQSNVVHLDLKPQNILLTSLNPLGDIKLVDFGLARRLGSAGELREILGTPEYVAPEILNYEPITTASDLWSVGVITYMLITGESPFAGEDKQQTFLNVSQVNVDYSKEAFAR-VSELAVHFIRKLLVKAPEDRPSAADCLS 286          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 78.5666 bits (192), Expect = 1.412e-14
Identity = 77/287 (26.83%), Postives = 134/287 (46.69%), Query Frame = 3
Query: 1107 NEMDAQDQEVKPLKESVGRLRFSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINN--SSLIKELRKLTVMNASERFVRIFAIYK--GEGLVSVSMELM-AISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASIN-------IATAIHGQKRNEINKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKI--DYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELL 1925
            + +  QD+ V P K     + +    +  +    ++Y   D    +E+A  Q +        +   S+L  E++ L  ++  ER V+ +   +   E  +++ ME M   S+K+  KA    T   +     K+ RQILEG++ LH + IV+ ++  ++IL DS G++KL           I  +  G +       +++PE++    +  KADVWS G  ++E++T K     A+ EA+  +  FKI    T  I P   +E+ +  I R  VE   +R S  ELL
Sbjct:  336 SRLRPQDRPV-PHKSPTAPVTWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPASPETSKEVSTLECEIQLLKNLH-HERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR----KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGDGYGRKADVWSLGCTVVEMLTEK--PPWAEYEAM--AAIFKIATQPTNPILPSHTSEQTRDFIRRIFVEA-KHRPSAEELL 611          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 78.5666 bits (192), Expect = 1.412e-14
Identity = 77/287 (26.83%), Postives = 134/287 (46.69%), Query Frame = 3
Query: 1107 NEMDAQDQEVKPLKESVGRLRFSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINN--SSLIKELRKLTVMNASERFVRIFAIYK--GEGLVSVSMELM-AISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASIN-------IATAIHGQKRNEINKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKI--DYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELL 1925
            + +  QD+ V P K     + +    +  +    ++Y   D    +E+A  Q +        +   S+L  E++ L  ++  ER V+ +   +   E  +++ ME M   S+K+  KA    T   +     K+ RQILEG++ LH + IV+ ++  ++IL DS G++KL           I  +  G +       +++PE++    +  KADVWS G  ++E++T K     A+ EA+  +  FKI    T  I P   +E+ +  I R  VE   +R S  ELL
Sbjct:  336 SRLRPQDRPV-PHKSPTAPVTWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPASPETSKEVSTLECEIQLLKNLH-HERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTR----KYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGDGYGRKADVWSLGCTVVEMLTEK--PPWAEYEAM--AAIFKIATQPTNPILPSHTSEQTRDFIRRIFVEA-KHRPSAEELL 611          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Sea Lamprey
Match: PRKCD (protein kinase C delta [Source:HGNC Symbol;Acc:HGNC:9399])

HSP 1 Score: 75.8702 bits (185), Expect = 2.382e-15
Identity = 46/142 (32.39%), Postives = 74/142 (52.11%), Query Frame = 3
Query: 1500 QILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATA-IHGQKRNEI---NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISV 1913
            +I+ GL  LHD GI+Y +L + +ILLD  G +K+A   +    I G  R        DY+APEI+  + +N   D WSFG++L E++ G+       +E L +S    + Y    +PR I +  + ++   L  +P  R+ V
Sbjct:   96 EIVSGLQFLHDQGIIYRDLKLDNILLDKDGHVKIADFGMCKENIVGDVRAGTFCGTPDYIAPEIVIGQKYNCSVDWWSFGVLLYEMLIGQSPFRGDDEEELFESIRTSVPY----YPRWITKDSRDILPLLLEREPMKRLGV 233          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Sea Lamprey
Match: cdk2 (cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2741])

HSP 1 Score: 75.485 bits (184), Expect = 4.608e-15
Identity = 77/272 (28.31%), Postives = 120/272 (44.12%), Query Frame = 3
Query: 1212 IYKATDNFNNKEVALMQYRLSDWKAFINNSSLIKELRKLTVMNASERFVRIFAIYKGEGLVSVSMELMAISLKEHFKAVDGKTRIASNDEVIKWY-RQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIHGQKRNEINKD----YLAPEI-LDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKI----------------DYTKYIFPRSINERFKGVIDRCLVE-----------DPNYRISVHELLS 1928
            +YKA +    + VAL + RL D +     S+ I+E+  L  +N     VR+  I   E  + +  EL+   LK   K +D  T       ++K Y  Q+L+G+A  H H I++ +L   ++L++++G IKLA   +A A    +R   ++     Y APEI L  K ++   DVWS G I  E++T +   F    E       F+                 DY K  FPR  N+    V+     E           DPN R++ +  LS
Sbjct:   18 VYKARNKLTGEAVALKKIRL-DTETEGVPSTAIREISLLRELNHPN-IVRLLTIIHSEKKLYLVFELLDQDLK---KFMDNATPSGIPLPLVKSYLYQLLQGIAFCHSHRILHRDLKPQNLLINAEGAIKLADFGLARAFGVPQRTYTHEVVTLWYRAPEILLGCKHYSTSVDVWSIGCIFAEMLTRRAL-FPGDSEIDQLFRIFRTLGTPDEVVWPGVSQLPDY-KSTFPRWANQELTKVVPTLNFEGRDLLALMLQYDPNQRVTANMALS 282          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Sea Lamprey
Match: plk3 (polo-like kinase 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-030131-6134])

HSP 1 Score: 73.559 bits (179), Expect = 1.130e-13
Identity = 49/196 (25.00%), Postives = 98/196 (50.00%), Query Frame = 3
Query: 1356 VRIFAIYKGEGLVSVSMELM-AISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIHG---QKRNEIN-KDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELLS 1928
            V+  + +K E  + + +EL    SL    ++     ++ +  EV  + RQ++ GL  LH  G+V+ +L + +  +    ++K+  + +AT +     +KR      +YLAPE+L+ +    +AD+WS G  +  ++ G+   FS    A   + +  I   ++ FP S++   + ++   L  DP+ R S+ +L S
Sbjct:   88 VQFISSFKDENFIYIILELCNGQSLAHMLRS----RKVLTETEVKYYLRQLISGLRYLHQCGVVHRDLKLGNFFVTDSMEVKIGDLGLATTLEPPEMRKRTVCGTPNYLAPEVLNKRGHGPEADIWSLGCAVFTMLAGRP-PFSTSDLA---NTYACIRSGRFNFPPSLSHAARDLLTSALTPDPDLRASLLDLQS 275          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Sea Lamprey
Match: stk39 (serine threonine kinase 39 [Source:ZFIN;Acc:ZDB-GENE-140106-194])

HSP 1 Score: 70.8626 bits (172), Expect = 3.146e-13
Identity = 44/159 (27.67%), Postives = 81/159 (50.94%), Query Frame = 3
Query: 1497 RQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIAT--AIHGQ-KRNEINKDY------LAPEILDN-KAWNIKADVWSFGIILLEIITGKC--FNFSAKKEAL----NDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELL 1925
            +++LEGL  LH +G ++ ++   +ILL   G I++A   ++   A  G   RN++ K +      +APE+++  + ++ KAD+WSFGI  +E+ +G      +   K  +    ND    +         +   + F+ +I +CL +DP  R +  ELL
Sbjct:   12 KEVLEGLDYLHRNGQIHRDVKAGNILLGEDGTIQIADFGVSAFLATGGDVTRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADIWSFGITAMELASGAAPYHKYPPMKVLMLTLQNDPPTLETGVEDKEMVKKYGKSFRKLISQCLQKDPAKRPTAAELL 170          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Sea Lamprey
Match: stk25a (serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-GENE-041010-92])

HSP 1 Score: 71.2478 bits (173), Expect = 3.539e-13
Identity = 46/155 (29.68%), Postives = 78/155 (50.32%), Query Frame = 3
Query: 1497 RQILEGLACLHDHGIVYDEL--TMSHILLDSKGDIKLASINIATAIHGQ--KRNEI--NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEAL------NDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELL 1925
            R+IL+GL  LH    ++ ++    +++LL  +GD+KLA   +A  +     KRN       ++APE++   A++ KAD+WS GI  +E+  G+  N       +      N+    + +Y+K          FK  +D CL +DP +R +  ELL
Sbjct:  128 REILKGLDYLHSERKIHRDIKGPAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSELHPMRVLFLIPKNNPPTLEGNYSKA---------FKEFVDSCLNKDPQFRPTAKELL 273          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 72.7886 bits (177), Expect = 1.808e-13
Identity = 41/154 (26.62%), Postives = 80/154 (51.95%), Query Frame = 3
Query: 1470 SNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIHGQKRNEINK-DYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSN-FFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELL 1925
            S +E   +  Q L GL  LH  G+++ ++  ++ILL +   +KLA   ++T ++          +++APEIL N+  +  +D+WS G  ++E++T      +     L D+N ++ ++   Y  P S +E  K  + +C V++   R +  +LL
Sbjct:  119 SENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVNSSALTLAGTLNWMAPEILGNRGASTLSDIWSLGATVVEMLTK-----NPPYHNLTDANIYYAVENDTYYPPSSFSEPLKDFLSKCFVKNMYKRPTADQLL 267          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Yeast
Match: SNF1 (AMP-activated S/T protein kinase; forms a complex with Snf4p and members of the Sip1p/Sip2p/Gal83p family; required for transcription of glucose-repressed genes, thermotolerance, sporulation, and peroxisome biogenesis; regulates nucleocytoplasmic shuttling of Hxk2p; regulates filamentous growth and acts as a non-canonical GEF, activating Arf3p during invasive growth; SUMOylation by Mms21p inhibits its function and targets Snf1p for destruction via the Slx5-Slx8 Ub ligase [Source:SGD;Acc:S000002885])

HSP 1 Score: 71.633 bits (174), Expect = 2.657e-13
Identity = 53/185 (28.65%), Postives = 90/185 (48.65%), Query Frame = 3
Query: 1470 SNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASI---NIATAIHGQKRNEINKDYLAPEILDNKAW-NIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELLSIDXXXXXXXXXXXXXADWLHLLLPQYLL 2012
            S  E  ++++QI+  +   H H IV+ +L   ++LLD   ++K+A     NI T  +  K +  + +Y APE++  K +   + DVWS G+IL  ++   C       E++    F  I    Y  P+ ++    G+I R L+ +P  RIS+HE++                 DW  + LP+YLL
Sbjct:  150 SEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVML---CRRLPFDDESI-PVLFKNISNGVYTLPKFLSPGAAGLIKRMLIVNPLNRISIHEIMQ---------------DDWFKVDLPEYLL 315          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Yeast
Match: PHO85 (Cyclin-dependent kinase; has ten cyclin partners; involved in regulating the cellular response to nutrient levels and environmental conditions and progression through the cell cycle; human lissencephaly-associated homolog CDK5 functionally complements null mutation [Source:SGD;Acc:S000005952])

HSP 1 Score: 68.9366 bits (167), Expect = 4.589e-13
Identity = 53/196 (27.04%), Postives = 101/196 (51.53%), Query Frame = 3
Query: 1206 SQIYKATDNFNNKEVALMQYRLSDWKAFINNS----SLIKELRKLTVMNASERFVRIFAIYKGEGLVSVSMELMAISLKEHFKA-VDGKTRIASNDEVIKWYR-QILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIHGQKRNEINKD-----YLAPEIL-DNKAWNIKADVWSFGIILLEIITGK 1757
            + +YK  +      VAL + +L   +   + +    SL+KEL+        E  VR++ +   E  +++  E M   LK++  +   G T       ++K+++ Q+L+GLA  H++ I++ +L   ++L++ +G +KL    +A A  G   N  + +     Y AP++L  ++ ++   D+WS G IL E+ITGK
Sbjct:   19 ATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELKH-------ENIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAF-GIPVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGK 206          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Yeast
Match: MKK1 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk2p; MKK1 has a paralog, MKK2, that arose from the whole genome duplication [Source:SGD;Acc:S000005757])

HSP 1 Score: 69.707 bits (169), Expect = 8.878e-13
Identity = 55/212 (25.94%), Postives = 101/212 (47.64%), Query Frame = 3
Query: 1344 SERFVRIFAIYKGE--GLVSVSMELMA-ISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIHGQKRNEINKD------YLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKIDYTKYIFPRSINE---------RFKGVIDRCLVEDPNYRISVHELL 1925
            SE  VR + ++  +    + ++ME M   SL   +K +  +    S   + K    +L GL+ LH+  +++ ++   +ILL+  G +KL    ++    G+  N +         Y+APE +  + +++ +DVWS G+ +LE+  GK F  S++K A N + F  + +     P   +E          FK  ID CL +D   R S  +++
Sbjct:  277 SEYIVRYYGMFTDDENSSIYIAMEYMGGRSLDAIYKNLLERGGRISEKVLGKIAEAVLRGLSYLHEKKVIHRDIKPQNILLNENGQVKLCDFGVS----GEAVNSLATTFTGTSFYMAPERIQGQPYSVTSDVWSLGLTILEVANGK-FPCSSEKMAANIAPFELLMWILTFTPELKDEPESNIIWSPSFKSFIDYCLKKDSRERPSPRQMI 483          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Yeast
Match: MKK2 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk1p; MKK2 has a paralog, MKK1, that arose from the whole genome duplication [Source:SGD;Acc:S000006061])

HSP 1 Score: 69.707 bits (169), Expect = 8.911e-13
Identity = 55/212 (25.94%), Postives = 101/212 (47.64%), Query Frame = 3
Query: 1344 SERFVRIFAIYKGEGLVSV--SMELMA-ISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIHGQKRNEINKD------YLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKIDYTKYIFPR---------SINERFKGVIDRCLVEDPNYRISVHELL 1925
            S+  V+ + ++  E   S+  +ME M   SL+  +K +  +    S   + K    +L GL+ LH+  +++ ++   +ILL+ KG+IKL    ++    G+  N +         Y+APE +  + +++  DVWS G+ LLE+  G+ F F + K   N +    +       P+         S ++ F+  ID CL +D   R S  ++L
Sbjct:  270 SDYIVQYYGMFTDEQSSSIYIAMEYMGGKSLEATYKNLLKRGGRISERVIGKIAESVLRGLSYLHERKVIHRDIKPQNILLNEKGEIKLCDFGVS----GEAVNSLAMTFTGTSFYMAPERIQGQPYSVTCDVWSLGLTLLEVAGGR-FPFESDKITQNVAPIELLTMILTFSPQLKDEPELDISWSKTFRSFIDYCLKKDARERPSPRQML 476          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Nematostella
Match: EDO49822 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG20])

HSP 1 Score: 77.411 bits (189), Expect = 1.416e-15
Identity = 54/170 (31.76%), Postives = 88/170 (51.76%), Query Frame = 3
Query: 1437 FKAVDGKTRIA-SNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIHGQ---KRNEINKDY-LAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNF-FKIDYTKY-IFPRSINERFKGVIDRCLVEDPNYRISVHELL 1925
            +K ++G+  IA S D+V+ W+ QI  GL  +HD  I++ ++   +I L   G IK+    IA  +H      R  I   Y L+PEI++N+ +N K+D+WS G +L E++T          EA N  N   KI    Y   P   +   + ++ + L  +P+ R SV+ +L
Sbjct:   89 YKKINGQRGIAFSEDQVMDWFVQICLGLKHVHDRKILHRDIKSQNIFLTRHGIIKMGDFGIARVLHSTVELARTCIGTPYYLSPEIVENRPYNNKSDIWSLGCVLYEMLT-----LKHAFEAGNMKNLVLKIIRGSYPPIPLRYSADIRMLVAQLLKRNPHDRPSVNTVL 253          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Nematostella
Match: EDO45846 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRL1])

HSP 1 Score: 75.8702 bits (185), Expect = 7.932e-15
Identity = 42/158 (26.58%), Postives = 82/158 (51.90%), Query Frame = 3
Query: 1470 SNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIH---GQKRNEINKDY-LAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKK-EALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELLS 1928
            S ++V    R +L+ L  LH  G+++ ++    ILL S G +KL+       +     ++++ +   Y +APE++  K +  + D+WS GI++LE++ G+   F+    +A+      +   ++   P  I+ R +  +D  L+ DP YR +  ELL+
Sbjct:  121 SEEQVACVCRAVLKALTFLHSQGVIHRDIKSDSILLTSNGTVKLSDFGFCAQVTEDMPRRKSLVGTPYWMAPEVISRKPYGTEVDIWSLGIMVLEMVDGEPPYFNEPPLQAMRKLRDLEPPTSRN--PIQISPRLQSFLDNALIRDPLYRATAFELLN 276          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Nematostella
Match: EDO36150 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJF2])

HSP 1 Score: 75.485 bits (184), Expect = 6.113e-14
Identity = 50/159 (31.45%), Postives = 90/159 (56.60%), Query Frame = 3
Query: 1482 VIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKG-DIKLA----SINIATAIHG----QKRNEINKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKIDYT--KYIFPRSINERFKGVIDRCLVEDPNYRISVHELL 1925
            +I++ RQIL+G++ LH++ +V+ ++  ++IL+DS G DI++A    +  +AT I G    Q +      ++APE+L  +++    DVWS G +L+E+ TGK   ++A + + + +  FKI         P  +N   + V+ RCL   P  R +  +LL
Sbjct:  680 LIRYLRQILQGVSYLHENQVVHRDIKGANILVDSTGQDIRIADFGAAARLATQITGAGEFQGQLLGTIAFMAPEVLRGESYGRSCDVWSVGCVLIEMATGK-PPWNAHEHSNHLALIFKIACAIGPPDIPEHLNPGVRDVVLRCLESKPEDRPAAVDLL 837          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Nematostella
Match: EDO35437 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLH0])

HSP 1 Score: 72.0182 bits (175), Expect = 1.541e-13
Identity = 42/149 (28.19%), Postives = 79/149 (53.02%), Query Frame = 3
Query: 1488 KWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIHGQKRNEI--NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELLS 1928
            K+ RQ+ + LA  H   +++ ++   ++LL+ KGDIK+A    +      +R  +    DYL PE+++ K  + K D+WS G++  E + GK   F A  E  N++ + +I      FP  ++   + +I + L  +PN R+ +  +L+
Sbjct:  150 KYIRQLADALAYCHSKKVIHRDIKPENLLLNYKGDIKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGKEHDEKVDLWSIGVLCYEFLVGKP-PFEA--EGHNET-YRRISRVDLRFPSHVSPGARDLISKLLQHNPNNRLPLKAVLN 294          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Nematostella
Match: EDO38399 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCY8])

HSP 1 Score: 72.7886 bits (177), Expect = 3.122e-13
Identity = 43/142 (30.28%), Postives = 72/142 (50.70%), Query Frame = 3
Query: 1503 ILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIHGQKRNEI---NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHE 1919
            ++EG   LH  GIVY +L   ++LLD+KG +KL     A  I   ++        +Y+APEI+ NK  ++ +D WS GI++ E++TG    FS+  + +   N          FP+ I    + +I R   ++P  R+   +
Sbjct:  431 VVEGFEYLHSKGIVYRDLKPENLLLDAKGYVKLVDFGFAKKIGSGRKTWTFCGTPEYVAPEIILNKGHDLSSDYWSLGILIFELLTGSP-PFSS-SDPMKTYNIILRGLDMVEFPKRIGRNPQNLIKRLCKDNPVERLGYQK 570          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Medaka
Match: PLK1 (polo like kinase 1 [Source:NCBI gene;Acc:101170155])

HSP 1 Score: 75.8702 bits (185), Expect = 8.315e-14
Identity = 48/162 (29.63%), Postives = 83/162 (51.23%), Query Frame = 3
Query: 1455 KTRIASNDEVIKWY-RQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIH--GQKRNEI--NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGK-CFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHEL 1922
            K R A  +   ++Y  Q+L+G+  LH + +++ +L + +I L+   ++K+    +AT I   G+++  +    +Y+APE+L  K  + + DVWS G IL  ++ GK  F  S  K+  N     +I    Y  P  IN     +I R L  DP  R ++ +L
Sbjct:  128 KRRKAVTEPEARYYMTQLLKGVHYLHSNKVIHRDLKLGNIFLNDDMEVKIGDFGLATKIEFDGERKKTLCGTPNYIAPEVLCKKGHSYEVDVWSLGCILYTLLVGKPPFETSCLKDTYN-----RIKKNNYTIPWQINPSASALIKRMLHADPAQRPTITDL 284          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Medaka
Match: PLK1 (polo like kinase 1 [Source:NCBI gene;Acc:101170155])

HSP 1 Score: 75.8702 bits (185), Expect = 9.979e-14
Identity = 48/162 (29.63%), Postives = 83/162 (51.23%), Query Frame = 3
Query: 1455 KTRIASNDEVIKWY-RQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIH--GQKRNEI--NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGK-CFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHEL 1922
            K R A  +   ++Y  Q+L+G+  LH + +++ +L + +I L+   ++K+    +AT I   G+++  +    +Y+APE+L  K  + + DVWS G IL  ++ GK  F  S  K+  N     +I    Y  P  IN     +I R L  DP  R ++ +L
Sbjct:  128 KRRKAVTEPEARYYMTQLLKGVHYLHSNKVIHRDLKLGNIFLNDDMEVKIGDFGLATKIEFDGERKKTLCGTPNYIAPEVLCKKGHSYEVDVWSLGCILYTLLVGKPPFETSCLKDTYN-----RIKKNNYTIPWQINPSASALIKRMLHADPAQRPTITDL 284          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Medaka
Match: stk25b (serine/threonine kinase 25 [Source:NCBI gene;Acc:101157729])

HSP 1 Score: 73.9442 bits (180), Expect = 2.089e-13
Identity = 44/152 (28.95%), Postives = 79/152 (51.97%), Query Frame = 3
Query: 1497 RQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIHGQ--KRNEI--NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKIDY-----TKYIFPRSINERFKGVIDRCLVEDPNYRISVHELL 1925
            R+IL+GL  LH    ++ ++  +++LL  +GD+KLA   +A  +     KRN       ++APE++   A++ KAD+WS GI  +E+  G+  N        +D +  ++ +     T        ++ FK  ++ CL +DP +R +  ELL
Sbjct:  122 REILKGLEYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPN--------SDLHPMRVLFLIPKNTPPTLEGPYSKPFKEFVEACLNKDPRFRPTAKELL 265          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Medaka
Match: stk25b (serine/threonine kinase 25 [Source:NCBI gene;Acc:101157729])

HSP 1 Score: 73.9442 bits (180), Expect = 2.349e-13
Identity = 44/152 (28.95%), Postives = 79/152 (51.97%), Query Frame = 3
Query: 1497 RQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIHGQ--KRNEI--NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKIDY-----TKYIFPRSINERFKGVIDRCLVEDPNYRISVHELL 1925
            R+IL+GL  LH    ++ ++  +++LL  +GD+KLA   +A  +     KRN       ++APE++   A++ KAD+WS GI  +E+  G+  N        +D +  ++ +     T        ++ FK  ++ CL +DP +R +  ELL
Sbjct:  122 REILKGLEYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPN--------SDLHPMRVLFLIPKNTPPTLEGPYSKPFKEFVEACLNKDPRFRPTAKELL 265          
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Medaka
Match: prkcda (protein kinase C delta [Source:NCBI gene;Acc:101174016])

HSP 1 Score: 73.9442 bits (180), Expect = 3.808e-13
Identity = 43/142 (30.28%), Postives = 78/142 (54.93%), Query Frame = 3
Query: 1500 QILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATA-IHGQKRNEI---NKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISV 1913
            +I+ GL  LH  GI+Y +L + +++L+ +G IK+A   +    + G  R        DY+APEIL  + ++   D WSFG++L E++ G+       ++ L +S   ++D   Y  PR IN+  K ++++    +P +R+ V
Sbjct:  426 EIVCGLEFLHSKGIIYRDLKLDNVMLNHEGHIKIADFGMCKEDVFGDNRATTFCGTPDYIAPEILLGQKYSFSVDWWSFGVLLYEMLVGQSPFHGDDEDELFES--IRMDTPHY--PRWINKEAKDLLEQLFDREPTHRLGV 563          
BLAST of Serine/threonine protein kinase, putative vs. Planmine SMEST
Match: SMESG000003862.1 (SMESG000003862.1)

HSP 1 Score: 1083.55 bits (2801), Expect = 0.000e+0
Identity = 544/606 (89.77%), Postives = 558/606 (92.08%), Query Frame = 3
Query:  111 DLECKQLQSACKECPASNMTEIMLDEILKVANYRLDYFLKAILFFNIAIVLLLVLENRFKLISKLCFSIIKTKN-NSYQLIHSRKGKIEFSNFIGDSGTKLKFRLPTENKVIELHVYGNENVVKIKKRVCKKWPKAKSDSYKIMKLIYKGKCLDDNENILSLIGSHRGEILCQMDYSVNASDILVLRVAGIRRDTELVQINKGKKISDLNQILCKLLDQSDLVIYVKPSDAANYSDLNNPDLTLVKAGVKDNDQIVAITKKPVKIMFSSILSNDENFNSELSNVERVSSILNIVEQKFKSEDVLIIGERDMISEQFLFQYNIDDESQIKYCRFNEMDAQDQEVKPLKESVGRLRFSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINNSSLIKELRKLTVMNASERFVRIFAIYKGEGLVSVSMELMAISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIHGQKRNEINKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELL 1925
            D +C QLQ+ACK+CP S MT IML EIL++  YRL  FL AIL  N+    LLV ENRFK+I+K C  + K K  N Y L+ SRKGK  ++N IGD GTKLK RLPTENKVIELHVYGNENVVKIKKRVCKKWPKAKSDSYKIMKLIYKGKCLDDNENILSLIGSHRGEILCQMDYSVNASDILVLRVAGIRRDTELVQINKGKKISDLNQILCKLLDQSDLVIYVKPSDAANYSDLNNPDLTLVKAGVKDNDQIVAITKKPVKIMFSSILSNDENFNSELSNVERVSSILNIVEQKFKSEDVLIIGERDMISEQFLFQYNIDDESQIKYCRFNEMDAQDQEVKPLKESVGRLRFSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINNSSLIKELRKLTVMNASERFVRIFAIYKGEGLVSVSMELMAISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINI   I GQKRNEINKDYLAPEILDNK WNIKADVWSFGIILLEIITGKCFNFSAK EA N+S+FFKIDY KYIFP SINERFKGVI  CL EDPN RISV  LL
Sbjct:   50 DDQCNQLQNACKQCPPSEMTVIMLQEILRIVKYRLVNFLIAILIVNVVAFFLLVFENRFKIITKFCSLLCKKKQVNVYHLLQSRKGKTYYANCIGDFGTKLKLRLPTENKVIELHVYGNENVVKIKKRVCKKWPKAKSDSYKIMKLIYKGKCLDDNENILSLIGSHRGEILCQMDYSVNASDILVLRVAGIRRDTELVQINKGKKISDLNQILCKLLDQSDLVIYVKPSDAANYSDLNNPDLTLVKAGVKDNDQIVAITKKPVKIMFSSILSNDENFNSELSNVERVSSILNIVEQKFKSEDVLIIGERDMISEQFLFQYNIDDESQIKYCRFNEMDAQDQEVKPLKESVGRLRFSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINNSSLIKELRKLTVMNASERFVRIFAIYKGEGLVSVSMELMAISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIGKIIPGQKRNEINKDYLAPEILDNKPWNIKADVWSFGIILLEIITGKCFNFSAKTEAKNESHFFKIDYKKYIFPVSINERFKGVIHSCLNEDPNNRISVRVLL 655          
BLAST of Serine/threonine protein kinase, putative vs. Planmine SMEST
Match: SMESG000003878.1 (SMESG000003878.1)

HSP 1 Score: 778.089 bits (2008), Expect = 0.000e+0
Identity = 401/609 (65.85%), Postives = 471/609 (77.34%), Query Frame = 3
Query:  111 DLECKQLQSACKECPASNMTEIMLDEILKVANYRLDYFLKAILFFNIAIVLLLVLENRFKLISKLCFSIIKTKNNSYQLIHSRKGKIEFSNFIGDSGTKLKFRLPTENKVIELHVYGNENVVKIKKRVCKKWPKAKSDSYKIMKLIYKGKCLDDNENILSLIGSHRGEILCQMDYSVNASDILVLRVAGIRRDTELVQINKGKKISDLNQILCKLLDQSDLVIYVKPSDAANYSDLNNPDLTLVKAGVKDNDQIVAITKKPVKIMFSSILSNDENFNSELSNVERVSSILNIVEQKFKSED-VLIIGERDMISEQFLFQYNIDDESQIKYCRFNEMDAQDQEVKPLKESVGRLRFSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINNSSLIKELRKLTVMNASERFVRIFAIYKGEGLVSVSMELMAISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIHGQKRNEINKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELLSID 1934
            D EC QLQ++CK+CP S +T            Y+L   +  IL FNI I +LL++ENRFKLI K          N+YQ+IHSRK +IEFSNFIGD GTKLKFRLPTENKVIELHVYGN+NVV IKK +CKKWPKA+SDSYKIMKLIYKGKCLDDN+NILS IGSHRGEILCQMDYSVNA+DILVLRVAGIRRDTELVQINKGK ISDL QILCKL +   + ++VKPS    YS L + D+T   A + D  +IV + +KPV+I F SIL++++ F  E S  E VS+I   ++QKFKSE+ VL++    M S++FLFQYNID+E+Q  YCRF E           +E   R   S   +F KQE S++ KATDN  N+EVA+M+Y+LSDWKAF+N+S LI ELRKL   N +ERFV+I AIYKG   V+VSMELM++S+KE F  +DGK + ASN++VIKW RQILEGL CLHD+GI YDELTMS+ILLD+K DIKLA+INI TAIHG K ++ N  +LAPEI   K WNIKADVWSFG+ILLEIITGKCFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELLSID
Sbjct:   39 DYECDQLQASCKQCPPSKIT----------VKYQLMNIMIQILTFNIVIFVLLIIENRFKLIKKF---------NTYQIIHSRKREIEFSNFIGDFGTKLKFRLPTENKVIELHVYGNDNVVNIKKHICKKWPKAQSDSYKIMKLIYKGKCLDDNQNILSFIGSHRGEILCQMDYSVNANDILVLRVAGIRRDTELVQINKGKNISDLKQILCKLFNCKGISMFVKPSKDEKYSPLKDLDMTFEAAKLCDKVRIVVVKEKPVRIKFQSILNDEDPFVIEQSRTESVSAIFARLKQKFKSENFVLMMNNCIMKSDRFLFQYNIDEETQTTYCRFYE-----------REERKRGFHSFKSLFIKQEFSKLGKATDNITNREVAVMEYKLSDWKAFMNSSGLINELRKLDAANGNERFVQIIAIYKGLESVTVSMELMSMSVKERFATIDGKVKKASNEQVIKWSRQILEGLVCLHDNGIAYDELTMSNILLDNKDDIKLATINIDTAIHGLKFDDNNGMHLAPEIRKGKLWNIKADVWSFGVILLEIITGKCFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELLSID 617          
BLAST of Serine/threonine protein kinase, putative vs. Planmine SMEST
Match: SMESG000003878.1 (SMESG000003878.1)

HSP 1 Score: 735.717 bits (1898), Expect = 0.000e+0
Identity = 373/545 (68.44%), Postives = 435/545 (79.82%), Query Frame = 3
Query:  303 LCFSIIKTKNNSYQLIHSRKGKIEFSNFIGDSGTKLKFRLPTENKVIELHVYGNENVVKIKKRVCKKWPKAKSDSYKIMKLIYKGKCLDDNENILSLIGSHRGEILCQMDYSVNASDILVLRVAGIRRDTELVQINKGKKISDLNQILCKLLDQSDLVIYVKPSDAANYSDLNNPDLTLVKAGVKDNDQIVAITKKPVKIMFSSILSNDENFNSELSNVERVSSILNIVEQKFKSED-VLIIGERDMISEQFLFQYNIDDESQIKYCRFNEMDAQDQEVKPLKESVGRLRFSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINNSSLIKELRKLTVMNASERFVRIFAIYKGEGLVSVSMELMAISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIHGQKRNEINKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELLSID 1934
            + F     K N+YQ+IHSRK +IEFSNFIGD GTKLKFRLPTENKVIELHVYGN+NVV IKK +CKKWPKA+SDSYKIMKLIYKGKCLDDN+NILS IGSHRGEILCQMDYSVNA+DILVLRVAGIRRDTELVQINKGK ISDL QILCKL +   + ++VKPS    YS L + D+T   A + D  +IV + +KPV+I F SIL++++ F  E S  E VS+I   ++QKFKSE+ VL++    M S++FLFQYNID+E+Q  YCRF E           +E   R   S   +F KQE S++ KATDN  N+EVA+M+Y+LSDWKAF+N+S LI ELRKL   N +ERFV+I AIYKG   V+VSMELM++S+KE F  +DGK + ASN++VIKW RQILEGL CLHD+GI YDELTMS+ILLD+K DIKLA+INI TAIHG K ++ N  +LAPEI   K WNIKADVWSFG+ILLEIITGKCFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELLSID
Sbjct:   46 MSFKASNEKFNTYQIIHSRKREIEFSNFIGDFGTKLKFRLPTENKVIELHVYGNDNVVNIKKHICKKWPKAQSDSYKIMKLIYKGKCLDDNQNILSFIGSHRGEILCQMDYSVNANDILVLRVAGIRRDTELVQINKGKNISDLKQILCKLFNCKGISMFVKPSKDEKYSPLKDLDMTFEAAKLCDKVRIVVVKEKPVRIKFQSILNDEDPFVIEQSRTESVSAIFARLKQKFKSENFVLMMNNCIMKSDRFLFQYNIDEETQTTYCRFYE-----------REERKRGFHSFKSLFIKQEFSKLGKATDNITNREVAVMEYKLSDWKAFMNSSGLINELRKLDAANGNERFVQIIAIYKGLESVTVSMELMSMSVKERFATIDGKVKKASNEQVIKWSRQILEGLVCLHDNGIAYDELTMSNILLDNKDDIKLATINIDTAIHGLKFDDNNGMHLAPEIRKGKLWNIKADVWSFGVILLEIITGKCFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELLSID 579          
BLAST of Serine/threonine protein kinase, putative vs. Planmine SMEST
Match: SMESG000003878.1 (SMESG000003878.1)

HSP 1 Score: 735.717 bits (1898), Expect = 0.000e+0
Identity = 373/545 (68.44%), Postives = 435/545 (79.82%), Query Frame = 3
Query:  303 LCFSIIKTKNNSYQLIHSRKGKIEFSNFIGDSGTKLKFRLPTENKVIELHVYGNENVVKIKKRVCKKWPKAKSDSYKIMKLIYKGKCLDDNENILSLIGSHRGEILCQMDYSVNASDILVLRVAGIRRDTELVQINKGKKISDLNQILCKLLDQSDLVIYVKPSDAANYSDLNNPDLTLVKAGVKDNDQIVAITKKPVKIMFSSILSNDENFNSELSNVERVSSILNIVEQKFKSED-VLIIGERDMISEQFLFQYNIDDESQIKYCRFNEMDAQDQEVKPLKESVGRLRFSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINNSSLIKELRKLTVMNASERFVRIFAIYKGEGLVSVSMELMAISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIHGQKRNEINKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELLSID 1934
            + F     K N+YQ+IHSRK +IEFSNFIGD GTKLKFRLPTENKVIELHVYGN+NVV IKK +CKKWPKA+SDSYKIMKLIYKGKCLDDN+NILS IGSHRGEILCQMDYSVNA+DILVLRVAGIRRDTELVQINKGK ISDL QILCKL +   + ++VKPS    YS L + D+T   A + D  +IV + +KPV+I F SIL++++ F  E S  E VS+I   ++QKFKSE+ VL++    M S++FLFQYNID+E+Q  YCRF E           +E   R   S   +F KQE S++ KATDN  N+EVA+M+Y+LSDWKAF+N+S LI ELRKL   N +ERFV+I AIYKG   V+VSMELM++S+KE F  +DGK + ASN++VIKW RQILEGL CLHD+GI YDELTMS+ILLD+K DIKLA+INI TAIHG K ++ N  +LAPEI   K WNIKADVWSFG+ILLEIITGKCFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELLSID
Sbjct:   62 MSFKASNEKFNTYQIIHSRKREIEFSNFIGDFGTKLKFRLPTENKVIELHVYGNDNVVNIKKHICKKWPKAQSDSYKIMKLIYKGKCLDDNQNILSFIGSHRGEILCQMDYSVNANDILVLRVAGIRRDTELVQINKGKNISDLKQILCKLFNCKGISMFVKPSKDEKYSPLKDLDMTFEAAKLCDKVRIVVVKEKPVRIKFQSILNDEDPFVIEQSRTESVSAIFARLKQKFKSENFVLMMNNCIMKSDRFLFQYNIDEETQTTYCRFYE-----------REERKRGFHSFKSLFIKQEFSKLGKATDNITNREVAVMEYKLSDWKAFMNSSGLINELRKLDAANGNERFVQIIAIYKGLESVTVSMELMSMSVKERFATIDGKVKKASNEQVIKWSRQILEGLVCLHDNGIAYDELTMSNILLDNKDDIKLATINIDTAIHGLKFDDNNGMHLAPEIRKGKLWNIKADVWSFGVILLEIITGKCFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELLSID 595          
BLAST of Serine/threonine protein kinase, putative vs. Planmine SMEST
Match: SMESG000003867.1 (SMESG000003867.1)

HSP 1 Score: 660.603 bits (1703), Expect = 0.000e+0
Identity = 337/500 (67.40%), Postives = 391/500 (78.20%), Query Frame = 3
Query:  438 VIELHVYGNENVVKIKKRVCKKWPKAKSDSYKIMKLIYKGKCLDDNENILSLIGSHRGEILCQMDYSVNASDILVLRVAGIRRDTELVQINKGKKISDLNQILCKLLDQSDLVIYVKPSDAANYSDLNNPDLTLVKAGVKDNDQIVAITKKPVKIMFSSILSNDENFNSELSNVERVSSILNIVEQKFKSED-VLIIGERDMISEQFLFQYNIDDESQIKYCRFNEMDAQDQEVKPLKESVGRLRFSIIGIFKKQELSQIYKATDNFNNKEVALMQYRLSDWKAFINNSSLIKELRKLTVMNASERFVRIFAIYKGEGLVSVSMELMAISLKEHFKAVDGKTRIASNDEVIKWYRQILEGLACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIHGQKRNEINKDYLAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELLSID 1934
            +IELH YGN+NVV IKK +CKKWPKA+SDSYKIMKLIYKGKCLDDN+NI+SLIGSHRGEILCQMDYSVNA+DILVLRVAGIRRDTELVQINKGKKI DL QILCKL +   + ++VKPS    YS L + D+    A + D  +IV  T                 F  E S  E VS+I   ++QKFKSE+ VL++    M S++FLFQYNID+E+Q  YCRF E           +E   R   S   +F KQE S++ KATDN  N+EVA+M+Y+LSDWKAF+N+S LI ELRKL   N ++RFV+IFA+YKG   V+VSMELM++S+K+ F A+DGK +IASN++VIKW RQILEGLACLHD+GI YDELTMSHILLD+KGDIKL+ INIATAIHG+K + IN  YLAPEIL  K WNIKADVWSFG+ILLEIITGKCFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELLSID
Sbjct:    1 MIELHAYGNDNVVNIKKHICKKWPKAQSDSYKIMKLIYKGKCLDDNQNIISLIGSHRGEILCQMDYSVNANDILVLRVAGIRRDTELVQINKGKKIFDLKQILCKLFNCEGISMFVKPSKDEKYSPLKDLDMAFEAAKLCDKARIVVET---------------HPFVIEQSRTESVSAIFARLKQKFKSENFVLMMNNCIMKSDRFLFQYNIDEETQTTYCRFYE-----------REERKRGFHSFKSLFIKQEFSKLGKATDNITNREVAVMEYKLSDWKAFMNSSGLINELRKLDAANGNDRFVQIFALYKGLESVTVSMELMSMSMKKRFAAIDGKVKIASNEQVIKWSRQILEGLACLHDNGIAYDELTMSHILLDNKGDIKLSPINIATAIHGRKFDYINGKYLAPEILKGKPWNIKADVWSFGVILLEIITGKCFNFSAKKEALNDSNFFKIDYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELLSID 474          
The following BLAST results are available for this feature:
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLK11.646e-1428.83polo like kinase 1 [Source:HGNC Symbol;Acc:HGNC:90... [more]
STK264.850e-1429.56serine/threonine kinase 26 [Source:HGNC Symbol;Acc... [more]
STK269.108e-1429.56serine/threonine kinase 26 [Source:HGNC Symbol;Acc... [more]
STK269.806e-1429.56serine/threonine kinase 26 [Source:HGNC Symbol;Acc... [more]
STK261.229e-1329.56serine/threonine kinase 26 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
max-22.451e-1431.08Serine/threonine-protein kinase max-2 [Source:Uni... [more]
max-21.039e-1331.08Serine/threonine-protein kinase max-2 [Source:Uni... [more]
max-22.379e-1331.08Serine/threonine-protein kinase max-2 [Source:Uni... [more]
max-22.813e-1331.08Serine/threonine-protein kinase max-2 [Source:Uni... [more]
max-22.862e-1331.08Serine/threonine-protein kinase max-2 [Source:Uni... [more]
back to top
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SAK2.228e-1321.54gene:FBgn0026371 transcript:FBtr0078387[more]
Akt12.286e-1328.57gene:FBgn0010379 transcript:FBtr0083226[more]
Akt12.286e-1328.57gene:FBgn0010379 transcript:FBtr0344470[more]
Akt12.286e-1328.57gene:FBgn0010379 transcript:FBtr0344717[more]
Akt12.286e-1328.57gene:FBgn0010379 transcript:FBtr0083227[more]
back to top
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plk18.961e-1731.10polo-like kinase 1 (Drosophila) [Source:ZFIN;Acc:Z... [more]
plk18.961e-1731.10polo-like kinase 1 (Drosophila) [Source:ZFIN;Acc:Z... [more]
map3k31.359e-1426.48mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k32.126e-1426.48mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k32.479e-1426.48mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000045672.13.613e-1627.36protein kinase C delta type-like [Source:NCBI gene... [more]
cpvl6.224e-1428.74carboxypeptidase, vitellogenic-like [Source:Xenbas... [more]
cpvl7.692e-1428.74carboxypeptidase, vitellogenic-like [Source:Xenbas... [more]
cpvl7.934e-1428.74carboxypeptidase, vitellogenic-like [Source:Xenbas... [more]
cpvl9.555e-1428.74carboxypeptidase, vitellogenic-like [Source:Xenbas... [more]
back to top
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Plk19.659e-1629.45polo like kinase 1 [Source:MGI Symbol;Acc:MGI:9762... [more]
Stk267.822e-1430.72serine/threonine kinase 26 [Source:MGI Symbol;Acc:... [more]
Stk268.261e-1429.56serine/threonine kinase 26 [Source:MGI Symbol;Acc:... [more]
Prkcd8.453e-1431.69protein kinase C, delta [Source:MGI Symbol;Acc:MGI... [more]
Prkcd9.142e-1431.69protein kinase C, delta [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Serine/threonine protein kinase, putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q07832|PLK1_MOUSE6.757e-1529.45Serine/threonine-protein kinase PLK1 OS=Mus muscul... [more]
sp|Q2TA25|PLK1_BOVIN7.040e-1529.45Serine/threonine-protein kinase PLK1 OS=Bos taurus... [more]
sp|Q62673|PLK1_RAT7.368e-1529.27Serine/threonine-protein kinase PLK1 OS=Rattus nor... [more]
sp|Q0PKV7|MKK5_LEIME7.934e-1524.90Mitogen-activated protein kinase kinase 5 OS=Leish... [more]
sp|B4KYX8|PLK4_DROMO2.651e-1426.88Serine/threonine-protein kinase PLK4 OS=Drosophila... [more]
back to top
BLAST of Serine/threonine protein kinase, putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2V8LVA02.730e-1727.48Protein kinase domain-containing protein OS=Acidob... [more]
A0A2V8ZLD86.796e-1626.88Protein kinase domain-containing protein OS=Acidob... [more]
A0A2V8R1J59.318e-1625.87Uncharacterized protein (Fragment) OS=Acidobacteri... [more]
A0A4P9XQV21.803e-1526.79Kinase-like domain-containing protein (Fragment) O... [more]
C4M8G82.569e-1525.38Serine/threonine protein kinase, putative OS=Entam... [more]
back to top
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plk18.145e-1630.49polo like kinase 1 [Source:NCBI gene;Acc:103034005... [more]
plk11.001e-1530.49polo like kinase 1 [Source:NCBI gene;Acc:103034005... [more]
stk17b4.091e-1529.32serine/threonine kinase 17b [Source:NCBI gene;Acc:... [more]
map3k31.412e-1426.83mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k31.412e-1426.83mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRKCD2.382e-1532.39protein kinase C delta [Source:HGNC Symbol;Acc:HGN... [more]
cdk24.608e-1528.31cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
plk31.130e-1325.00polo-like kinase 3 (Drosophila) [Source:ZFIN;Acc:Z... [more]
stk393.146e-1327.67serine threonine kinase 39 [Source:ZFIN;Acc:ZDB-GE... [more]
stk25a3.539e-1329.68serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC151.808e-1326.62Protein kinase of the Mitotic Exit Network; locali... [more]
SNF12.657e-1328.65AMP-activated S/T protein kinase; forms a complex ... [more]
PHO854.589e-1327.04Cyclin-dependent kinase; has ten cyclin partners; ... [more]
MKK18.878e-1325.94MAPKK involved in the protein kinase C signaling p... [more]
MKK28.911e-1325.94MAPKK involved in the protein kinase C signaling p... [more]
back to top
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO498221.416e-1531.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458467.932e-1526.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361506.113e-1431.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354371.541e-1328.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383993.122e-1330.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine/threonine protein kinase, putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLK18.315e-1429.63polo like kinase 1 [Source:NCBI gene;Acc:101170155... [more]
PLK19.979e-1429.63polo like kinase 1 [Source:NCBI gene;Acc:101170155... [more]
stk25b2.089e-1328.95serine/threonine kinase 25 [Source:NCBI gene;Acc:1... [more]
stk25b2.349e-1328.95serine/threonine kinase 25 [Source:NCBI gene;Acc:1... [more]
prkcda3.808e-1330.28protein kinase C delta [Source:NCBI gene;Acc:10117... [more]
back to top
BLAST of Serine/threonine protein kinase, putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003862.10.000e+089.77SMESG000003862.1[more]
SMESG000003878.10.000e+065.85SMESG000003878.1[more]
SMESG000003878.10.000e+068.44SMESG000003878.1[more]
SMESG000003878.10.000e+068.44SMESG000003878.1[more]
SMESG000003867.10.000e+067.40SMESG000003867.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022813 ID=SMED30022813|Name=Serine/threonine protein kinase, putative|organism=Schmidtea mediterranea sexual|type=transcript|length=2650bp
AAATATTTTCAATATAAAAATTATCTAATTTGATAAATCACAATTTCGGT
AAGTGATTCTGATATTTCACAGTGATCTCGAATCCGATTGGAGGATGACA
AATATTCCATGATTTAGAGTGCAAACAATTACAGAGTGCCTGCAAAGAAT
GCCCTGCAAGCAACATGACAGAAATAATGCTAGATGAAATATTGAAAGTC
GCTAATTATCGACTGGATTATTTTCTGAAAGCTATTTTGTTTTTCAATAT
TGCCATCGTTCTTTTGCTGGTGCTGGAGAATCGGTTCAAACTTATCTCAA
AGCTTTGTTTCAGTATAATTAAAACAAAAAATAATTCCTACCAATTAATA
CACAGCAGAAAAGGGAAAATTGAGTTTTCGAATTTTATAGGAGATTCAGG
AACAAAATTGAAGTTCCGATTACCTACAGAAAACAAGGTGATAGAGCTGC
ATGTTTATGGCAATGAGAATGTTGTCAAAATAAAGAAACGTGTTTGCAAG
AAGTGGCCCAAAGCTAAATCAGATAGTTACAAAATAATGAAATTGATATA
TAAAGGGAAATGCCTTGATGACAATGAGAATATTTTGTCACTCATTGGGT
CACACAGGGGTGAAATATTGTGCCAGATGGATTACTCTGTGAATGCCAGT
GACATTCTCGTTCTCCGAGTGGCTGGCATCAGGCGAGACACTGAGCTCGT
TCAAATTAATAAAGGGAAAAAGATTTCTGATCTAAATCAGATCTTGTGCA
AATTACTTGACCAGTCAGATCTTGTTATATATGTGAAACCTAGCGACGCA
GCCAATTATTCAGATTTAAATAATCCCGATTTGACCTTGGTGAAGGCCGG
TGTCAAGGACAATGATCAAATTGTTGCAATCACAAAAAAACCCGTAAAAA
TTATGTTTTCATCAATCCTTAGTAATGACGAAAATTTCAATAGTGAGTTA
TCGAATGTTGAAAGGGTTTCGTCGATTTTGAATATAGTTGAACAAAAATT
TAAATCTGAAGATGTTTTAATAATTGGTGAACGTGACATGATATCAGAGC
AATTTCTGTTCCAGTATAATATTGATGACGAGAGCCAGATCAAATATTGC
AGATTTAATGAGATGGACGCACAGGATCAAGAAGTGAAGCCTCTTAAAGA
ATCAGTGGGAAGATTGAGGTTTAGCATTATTGGCATATTTAAAAAGCAAG
AGTTATCACAAATATACAAAGCAACGGATAATTTCAACAATAAAGAGGTT
GCTTTGATGCAGTATAGACTATCCGATTGGAAGGCTTTTATAAACAATTC
TAGTTTGATAAAGGAGCTGAGAAAACTCACAGTAATGAATGCAAGTGAAA
GATTTGTGCGGATATTTGCCATATATAAAGGCGAGGGGTTGGTATCTGTG
TCCATGGAATTGATGGCGATATCATTGAAAGAACATTTTAAAGCTGTTGA
TGGCAAAACCAGAATAGCCTCAAATGATGAAGTTATTAAATGGTATCGAC
AAATTCTTGAAGGCCTCGCCTGTCTTCATGATCACGGCATTGTATATGAT
GAGCTGACAATGTCTCACATTCTTCTGGATAGCAAAGGGGACATCAAGCT
AGCCAGCATCAATATTGCTACAGCAATTCATGGACAAAAAAGAAATGAAA
TAAATAAAGATTATCTTGCTCCTGAGATTTTGGACAATAAAGCATGGAAC
ATAAAGGCCGACGTGTGGTCATTTGGAATCATTCTGCTGGAGATTATTAC
CGGGAAATGTTTCAATTTCAGTGCAAAAAAAGAAGCCTTAAATGATTCTA
ATTTCTTCAAAATTGATTATACGAAATATATTTTCCCGAGATCAATAAAT
GAAAGGTTCAAGGGCGTCATTGACAGGTGCTTGGTTGAGGATCCGAATTA
TAGGATATCTGTGCACGAGCTACTGAGCATTGATTTACTGAGATCCTTTT
GAAGGCTCTCGCAATTCCTGTTTGCCGACTGGTTACATTTATTATTGCCG
CAATATTTATTATTTGCCATTATTAATTTTGCTACTTTATCATTTTTTAA
AGGTGCTGATTTTTGGATAATTTATTTTCTTCAATTGATCTTTTCAAAAA
CACCAGATAATTTCCAAATGCACTTGTAGTAGCCTTGGTGACGAGGACCT
TCCTTTTACCCTTCATATGGATGATCAGATGGAGTATTCCCATCAAAAGA
GTGCGTTGACTTTAAAGCTCGTGTGAAAAAGAAATTAATTATTTTTCTTT
ATTATTAATTATTATCATTAACTTATTGATCCGCTTTGAATAGTTTTTGG
GTAAGGAAAATCATTACCGAATGAGATTATCTTTTTCCTACATAAATTAA
ATTTTGACTCAAATGGAAACAGATTAATATCAAAGTATAGATAACCTCCC
AACAACCTGAAATGAATCAAATACAATAAGCAGAACATGGGAAAATAACA
ATGATATAATACGTAGAGCATTTTATTTGCCAATAATGAACTATCACCAA
GGCGTAAGCATGAATGACAACCAGCCGAATAGCAGAGCAATGCATAAACT
GAAATCAATTAGCGGCATTAACTACGCTAAATTGTTCTGATTTATATTGA
TATTTATTAATTAATTTACAAATGTATCCCAAATTCAAATTGGTTATTAA
back to top

protein sequence of SMED30022813-orf-1

>SMED30022813-orf-1 ID=SMED30022813-orf-1|Name=SMED30022813-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=596bp
MTEIMLDEILKVANYRLDYFLKAILFFNIAIVLLLVLENRFKLISKLCFS
IIKTKNNSYQLIHSRKGKIEFSNFIGDSGTKLKFRLPTENKVIELHVYGN
ENVVKIKKRVCKKWPKAKSDSYKIMKLIYKGKCLDDNENILSLIGSHRGE
ILCQMDYSVNASDILVLRVAGIRRDTELVQINKGKKISDLNQILCKLLDQ
SDLVIYVKPSDAANYSDLNNPDLTLVKAGVKDNDQIVAITKKPVKIMFSS
ILSNDENFNSELSNVERVSSILNIVEQKFKSEDVLIIGERDMISEQFLFQ
YNIDDESQIKYCRFNEMDAQDQEVKPLKESVGRLRFSIIGIFKKQELSQI
YKATDNFNNKEVALMQYRLSDWKAFINNSSLIKELRKLTVMNASERFVRI
FAIYKGEGLVSVSMELMAISLKEHFKAVDGKTRIASNDEVIKWYRQILEG
LACLHDHGIVYDELTMSHILLDSKGDIKLASINIATAIHGQKRNEINKDY
LAPEILDNKAWNIKADVWSFGIILLEIITGKCFNFSAKKEALNDSNFFKI
DYTKYIFPRSINERFKGVIDRCLVEDPNYRISVHELLSIDLLRSF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR000626Ubiquitin-like_dom
IPR011009Kinase-like_dom_sf
IPR029071Ubiquitin-like_domsf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
GO:0023014signal transduction by protein phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0005515protein binding
GO:0004674protein serine/threonine kinase activity
GO:0004702signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0016301kinase activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm