Receptor-type tyrosine-protein phosphatase S

Overview
NameReceptor-type tyrosine-protein phosphatase S
Smed IDSMED30022812
Length (bp)7004
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Receptor-type tyrosine-protein phosphatase S (SMED30022812) t-SNE clustered cells

Violin plots show distribution of expression levels for Receptor-type tyrosine-protein phosphatase S (SMED30022812) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Receptor-type tyrosine-protein phosphatase S (SMED30022812) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Receptor-type tyrosine-protein phosphatase S (SMED30022812) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022812

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30022812SMESG000068618.1 SmedASXL_018258SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30022812SMESG000068618.1 dd_Smed_v4_12771_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022812SMESG000068618.1 dd_Smed_v4_12771_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30022812SMESG000068618.1 dd_Smed_v4_12771_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30022812SMESG000068618.1 dd_Smed_v4_12771_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022812SMESG000068618.1 dd_Smed_v4_12771_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30022812SMESG000068618.1 dd_12771dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
musculature systemSMED30022812SMESG000068618.1 dd_12771dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
nervous systemSMED30022812SMESG000068618.1 dd_Smed_v4_9734_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022812SMESG000068618.1 dd_Smed_v4_9734_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30022812SMESG000068618.1 dd_Smed_v4_9734_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30022812SMESG000068618.1 dd_Smed_v4_9734_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30022812SMESG000068618.1 dd_Smed_v6_12771_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30022812SMESG000068618.1 dd_Smed_v6_9734_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30022812SMESG000068618.1 SMED30022812smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
enteric muscle cellSMED30022812SMESG000068618.1 dd_Smed_v4_12771_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30022812SMESG000068618.1 dd_Smed_v4_9734_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Human
Match: PTPRD (protein tyrosine phosphatase receptor type D [Source:HGNC Symbol;Acc:HGNC:9668])

HSP 1 Score: 881.322 bits (2276), Expect = 0.000e+0
Identity = 405/617 (65.64%), Postives = 499/617 (80.88%), Query Frame = 2
Query: 4880 LELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            +EL+++ N Q P +  +         PPIP+  L   I  L+ANDN  FSQEYESIDPGQQFTWE+SNLE+N+ KNRYANVIAYDHSR+LL  I G+ GSDY+NANYIDGY++ NAYIATQG L  TFGDFWRM+WEQ +A++VMMTKLEER+R+KCDQYWP++GTE++  G + VT+ DT ELA Y +RTF +  N SS         +KRE+RQ+QFTAWPDHGVP++P P L FL+R++  NP  + P++VHCSAGVGRTG FIVID  LERI+HE TVDI+G V++MRAQRNYMVQTEDQY+F+H+ +L+AV   NTEV  +N+  ++QKL + +  TG +  TG+ELEF++L+  K + +R  SANLP N+ KNRLVNI+PYE  R+CLQPIRG EGSDYINAS+IDGY+  KAYIATQ PL ET EDFWRM+WEHNSTI+VMLTKLREMGREKCH+YWP ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRTVRQFQFT+WPEQGVP ++ E FI+FIGQVHKTKEQFGQ+GPI+VHCSAGVGRTGVF+ LSI LER++ EGV+D+FQ V+ LR QR  MVQ+E+QY+F Y AA +Y+ SFD +
Sbjct: 1319 VELRRL-NFQTPGMASH---------PPIPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTETH--GLVQVTLLDTVELATYCVRTFALYKNGSS---------EKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIE--TG-ENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFSYRAALEYLGSFDHY 1910          

HSP 2 Score: 375.555 bits (963), Expect = 2.365e-104
Identity = 324/1114 (29.08%), Postives = 517/1114 (46.41%), Query Frame = 2
Query:  203 GQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNE------RFQVVG----TGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNP-PIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPY-YLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVS-AQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESK--IALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDK-PEAVSIKVINSTSSKISWKGPM--KTLDQVKYYIIEWRELSNKSKNSK--VFNVTVDINKSNPNNVYEH--ILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKT-VTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKAN 3472
             ++P   T  P+D T  +G     IC+A G+P+P + +   GK  SN     I      G+ LR Q ++   +  + +C+A N++G  + S  +TV+  + ++P GFP I  GP   + +  + A + C  S +P  ++TW K+      SNN       R + +G     G+L I+   E+D G YEC+ATN  GT  S    L +R         ++E    + P+     +  E+  G   N+TC A GSP+P V W   +G  +    ++ P+G      + + L D+ +S +Y C A + +G+I+  AQI VK  P  P     ++  ATS  + W     NP P+  Y +  K  ++++ +  +  +A                 + +  L  Y++YE +VVAV NNIG   PS P+  QT E  PSS P D+ A+ +S  +I V WK P + NG+I+GYR+YYT      ++NW    V D+    + NL+   TY VKV A+   GDGP+S    ++   G          VP  P N +    S TSI + WT P       +  YEL Y+ DG E G+  +  IEP  T Y +  LKP   Y+  LA ++  G+G S A+++  T          ++    T+ S  S  + W+    E +  I   + I Y  + D  + K        + +DT    ++L  L   + Y + V    +TD      V     S  + I T  N+ VP   P  V ++ +NSTS K+SW+ P+  K   Q++ Y + +  + N     +  + +V +   +   ++  EH  I++ L P   Y + V A + KG G+  K +++ T G   VP  PR +              +     + W+PP  + G + GYR+           K+++P+        E + +  +  I  G +Y+F + A N V FGE      +IPEE P+  P  L  +G   T V L W PP +  RNGIITKY + Y D+  P+L +++    + TT  +T L+ +T Y  K+RA   +G GP+SP   +          +N   KA+    + +SW  PE  N
Sbjct:   20 AETPPRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLRED-QIPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRSESIGGTPIRGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRE--------LREVRR-VPPRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKW--MLGAEDLTPEDDMPIG-----RNVLELNDVRQSANYTCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTW--DSGNPEPVSYYIIQHKPKNSEELYKEIDGVAT--------------TRYSVAGLSPYSDYEFRVVAV-NNIGRGPPSEPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTG----------VPGQPLNFKAEPESETSILLSWTPPR---SDTIANYELVYK-DG-EHGEEQRITIEP-GTSYRLQGLKPNSLYYFRLAARSPQGLGASTAEISARTMQSKPSAPPQDISC--TSPSSTSILVSWQPPPVEKQNGIITEYSIKYTAV-DGEDDK--PHEILGIPSDT--TKYLLEQLEKWTEYRITV--TAHTD------VGPGPESLSVLIRT--NEDVPSGPPRKVEVEAVNSTSVKVSWRSPVPNKQHGQIRGYQVHYVRMENGEPKGQPMLKDVMLADAQWEFDDTTEHDMIISGLQPETSYSLTVTAYTTKGDGARSKPKLVSTTG--AVPGKPRLV----------INHTQMNTALIQWHPPVDTFGPLQGYRLKFGR-------KDMEPLTTLEFSEKEDHFTATD--IHKGASYVFRLSARNKVGFGEEMVKEISIPEEVPTGFPQNLHSEGTTSTSVQLSWQPPVLAERNGIITKYTLLYRDINIPLLPMEQLIVPADTTMTLTGLKPDTTYDVKVRAHTSKGPGPYSPSVQFRTLPVDQVFAKNFHVKAVMKTSVLLSWEIPENYN 1045          

HSP 3 Score: 83.1889 bits (204), Expect = 6.007e-15
Identity = 93/389 (23.91%), Postives = 158/389 (40.62%), Query Frame = 2
Query: 2438 PEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEH---ILNNLLPNKYYKIEVLAASRKGKGS-PEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFG-ETARINYTIPEERPSAPPNKLEIQGEKKT-VTLKWHPPPIDYRNGIITKYKIQY--FDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPA--PENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQ-VSTNRDFPDGKITFKKIV 3571
            P  V  ++++ST+  + WK P +   Q++ Y + +             + T  +N    +NV +     + NL+P K Y ++VLA +  G G      ++I   G   VP  P   +     +          ++ L+W PP+     I  Y          E V +       + ++ E   S     + P   Y F + A +    G  TA I+    + +PSAPP  +       T + + W PPP++ +NGIIT+Y I+Y   D ++             T  ++  L++ T Y   + A    G GP S       ++E  P+  P  +E +A+N   +KVSW  P    Q      Q+ G+ V  V      P G+   K ++
Sbjct:  421 PRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYY-----------TMDPTQHVNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTG---VPGQPLNFKAEPESET---------SILLSWTPPR--SDTIANY----------ELVYKDGEHGEEQRITIEPGTSYRLQGLKPNSLYYFRLAARSPQGLGASTAEISARTMQSKPSAPPQDISCTSPSSTSILVSWQPPPVEKQNGIITEYSIKYTAVDGEDDKPHEILGIPSDTTKYLLEQLEKWTEYRITVTAHTDVGPGPESLSV-LIRTNEDVPSGPPRKVEVEAVNSTSVKVSWRSPVPNKQ----HGQIRGYQVHYVRMENGEPKGQPMLKDVM 769          

HSP 4 Score: 62.003 bits (149), Expect = 1.750e-8
Identity = 87/357 (24.37%), Postives = 153/357 (42.86%), Query Frame = 2
Query: 1010 QPSSS-TIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPL--QQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGY--ELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETT 2065
            QP +S ++ +T  T  G     A++K  L+     +     P  P LV  +  +  +A+I+W     +PP+D++  L           G + +     P   L    K+  F  T++    +Y  ++ A  N +G  +  +       E  P+  P +L ++  +  S++++W+PP+  ++NG I  Y L Y +     +    +    DT   L  L  + TY VKV A+   G GP S +            +TLP       +N    ++  TS+ + W  P        E Y   + +++  D+ GKM +E ++   TQ LI NLKP K+Y   L  +     G+  ++T  T
Sbjct:  791 QPETSYSLTVTAYTTKGD---GARSKPKLVSTTGAV-----PGKPRLV-INHTQMNTALIQW-----HPPVDTFGPL----QGYRLKFGRKDME----PLTTLEFSEKEDHFTATDIHKGASYVFRLSA-RNKVGFGE-EMVKEISIPEEVPTGFPQNLHSEGTTSTSVQLSWQPPVLAERNGIITKYTLLYRDINIPLLPMEQLIVPADTTMTLTGLKPDTTYDVKVRAHTSKGPGPYSPSVQF---------RTLPVD-QVFAKNFHVKAVMKTSVLLSWEIP--------ENYNSAMPFKILYDD-GKMVEE-VDGRATQKLIVNLKPEKSYSFVLTNRGNSAGGLQHRVTAKT 1103          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Human
Match: PTPRD (protein tyrosine phosphatase receptor type D [Source:HGNC Symbol;Acc:HGNC:9668])

HSP 1 Score: 881.322 bits (2276), Expect = 0.000e+0
Identity = 403/601 (67.05%), Postives = 492/601 (81.86%), Query Frame = 2
Query: 4928 NALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            N  S S +  PPIP+  L   I  L+ANDN  FSQEYESIDPGQQFTWE+SNLE+N+ KNRYANVIAYDHSR+LL  I G+ GSDY+NANYIDGY++ NAYIATQG L  TFGDFWRM+WEQ +A++VMMTKLEER+R+KCDQYWP++GTE++  G + VT+ DT ELA Y +RTF +  N SS         +KRE+RQ+QFTAWPDHGVP++P P L FL+R++  NP  + P++VHCSAGVGRTG FIVID  LERI+HE TVDI+G V++MRAQRNYMVQTEDQY+F+H+ +L+AV   NTEV  +N+  ++QKL + +  TG +  TG+ELEF++L+  K + +R  SANLP N+ KNRLVNI+PYE  R+CLQPIRG EGSDYINAS+IDGY+  KAYIATQ PL ET EDFWRM+WEHNSTI+VMLTKLREMGREKCH+YWP ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRTVRQFQFT+WPEQGVP ++ E FI+FIGQVHKTKEQFGQ+GPI+VHCSAGVGRTGVF+ LSI LER++ EGV+D+FQ V+ LR QR  MVQ+E+QY+F Y AA +Y+ SFD +
Sbjct:  918 NLHSSSMASHPPIPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTETH--GLVQVTLLDTVELATYCVRTFALYKNGSS---------EKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIE--TG-ENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFSYRAALEYLGSFDHY 1503          

HSP 2 Score: 270.011 bits (689), Expect = 4.595e-72
Identity = 199/658 (30.24%), Postives = 316/658 (48.02%), Query Frame = 2
Query:  203 GQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNN----ERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNP-PIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPY-YLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKM 2155
             ++P   T  P+D T  +G     IC+A G+P+P + +   GK  SN     I      G+ LR Q ++   +  + +C+A N++G  + S  +TV+  + ++P GFP I  GP   + +  + A + C  S +P  ++TW K+      SNN    ++ + V  G+L I+   E+D G YEC+ATN  GT  S    L           Y++ +  P  P+     +  E+  G   N+TC A GSP+P V W   +G  +    ++ P+G      + + L D+ +S +Y C A + +G+I+  AQI VK  P  P     ++  ATS  + W     NP P+  Y +  K  ++++ +  +  +A                 + +  L  Y++YE +VVAV NNIG   PS P+  QT E  PSS P D+ A+ +S  +I V WK P + NG+I+GYR+YYT      ++NW    V D+    + NL+   TY VKV A+   GDGP+S    ++   G          VP  P N +    S TSI + WT P       +  YEL Y+ DG E G+  +  IEP  T Y +  LKP   Y+  LA ++  G+G S         +++  +  ++K     + K S  + W++
Sbjct:   20 AETPPRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLRED-QIPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRSVSIGALQIEQSEESDQGKYECVATNSAGTRYSAPANL-----------YVRVRRVP--PRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKW--MLGAEDLTPEDDMPIG-----RNVLELNDVRQSANYTCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTW--DSGNPEPVSYYIIQHKPKNSEELYKEIDGVAT--------------TRYSVAGLSPYSDYEFRVVAV-NNIGRGPPSEPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTG----------VPGQPLNFKAEPESETSILLSWTPPR---SDTIANYELVYK-DG-EHGEEQRITIEP-GTSYRLQGLKPNSLYYFRLAARSPQGLGASTAEISARTMQSMFAKNFHVKA----VMKTSVLLSWEI 619          

HSP 3 Score: 56.6102 bits (135), Expect = 6.814e-7
Identity = 85/364 (23.35%), Postives = 143/364 (39.29%), Query Frame = 2
Query: 2402 ISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPS-MPREL--RMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIG---PGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKT-VTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKAN 3472
            I+ +   ++P  P    +    +TS  ++W       + V YYII+     +K KNS+     +D   +       + +  L P   Y+  V+A +  G+G P   E + T  + + PS  PR++  RM  S  I            + W  P+  +G I GYRV  ++           P +   N         +   IG   P KTY  +V A  S+  G  +     I +      P   + + E +T + L W PP    R+  I  Y++ Y D +      +    E  T+  +  L+ N+ Y F++ A + +G G  +           F   +N   KA+    + +SW  PE  N
Sbjct:  304 IAQITVKALPKPPGTPVVTESTATSITLTWDS--GNPEPVSYYIIQ-----HKPKNSEELYKEIDGVATT-----RYSVAGLSPYSDYEFRVVAVNNIGRGPPS--EPVLTQTSEQAPSSAPRDVQARMLSSTTI-----------LVQWKEPEEPNGQIQGYRVYYTM----------DPTQHVNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGVPGQPLNFKAEPESETSILLSWTPP----RSDTIANYELVYKDGEH--GEEQRITIEPGTSYRLQGLKPNSLYYFRLAARSPQGLGASTAEISARTMQSMFA--KNFHVKAVMKTSVLLSWEIPENYN 624          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Human
Match: PTPRD (protein tyrosine phosphatase receptor type D [Source:HGNC Symbol;Acc:HGNC:9668])

HSP 1 Score: 881.322 bits (2276), Expect = 0.000e+0
Identity = 405/617 (65.64%), Postives = 499/617 (80.88%), Query Frame = 2
Query: 4880 LELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            +EL+++ N Q P +  +         PPIP+  L   I  L+ANDN  FSQEYESIDPGQQFTWE+SNLE+N+ KNRYANVIAYDHSR+LL  I G+ GSDY+NANYIDGY++ NAYIATQG L  TFGDFWRM+WEQ +A++VMMTKLEER+R+KCDQYWP++GTE++  G + VT+ DT ELA Y +RTF +  N SS         +KRE+RQ+QFTAWPDHGVP++P P L FL+R++  NP  + P++VHCSAGVGRTG FIVID  LERI+HE TVDI+G V++MRAQRNYMVQTEDQY+F+H+ +L+AV   NTEV  +N+  ++QKL + +  TG +  TG+ELEF++L+  K + +R  SANLP N+ KNRLVNI+PYE  R+CLQPIRG EGSDYINAS+IDGY+  KAYIATQ PL ET EDFWRM+WEHNSTI+VMLTKLREMGREKCH+YWP ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRTVRQFQFT+WPEQGVP ++ E FI+FIGQVHKTKEQFGQ+GPI+VHCSAGVGRTGVF+ LSI LER++ EGV+D+FQ V+ LR QR  MVQ+E+QY+F Y AA +Y+ SFD +
Sbjct: 1319 VELRRL-NFQTPGMASH---------PPIPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTETH--GLVQVTLLDTVELATYCVRTFALYKNGSS---------EKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIE--TG-ENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFSYRAALEYLGSFDHY 1910          

HSP 2 Score: 375.555 bits (963), Expect = 2.365e-104
Identity = 324/1114 (29.08%), Postives = 517/1114 (46.41%), Query Frame = 2
Query:  203 GQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNE------RFQVVG----TGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNP-PIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPY-YLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVS-AQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESK--IALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDK-PEAVSIKVINSTSSKISWKGPM--KTLDQVKYYIIEWRELSNKSKNSK--VFNVTVDINKSNPNNVYEH--ILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKT-VTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKAN 3472
             ++P   T  P+D T  +G     IC+A G+P+P + +   GK  SN     I      G+ LR Q ++   +  + +C+A N++G  + S  +TV+  + ++P GFP I  GP   + +  + A + C  S +P  ++TW K+      SNN       R + +G     G+L I+   E+D G YEC+ATN  GT  S    L +R         ++E    + P+     +  E+  G   N+TC A GSP+P V W   +G  +    ++ P+G      + + L D+ +S +Y C A + +G+I+  AQI VK  P  P     ++  ATS  + W     NP P+  Y +  K  ++++ +  +  +A                 + +  L  Y++YE +VVAV NNIG   PS P+  QT E  PSS P D+ A+ +S  +I V WK P + NG+I+GYR+YYT      ++NW    V D+    + NL+   TY VKV A+   GDGP+S    ++   G          VP  P N +    S TSI + WT P       +  YEL Y+ DG E G+  +  IEP  T Y +  LKP   Y+  LA ++  G+G S A+++  T          ++    T+ S  S  + W+    E +  I   + I Y  + D  + K        + +DT    ++L  L   + Y + V    +TD      V     S  + I T  N+ VP   P  V ++ +NSTS K+SW+ P+  K   Q++ Y + +  + N     +  + +V +   +   ++  EH  I++ L P   Y + V A + KG G+  K +++ T G   VP  PR +              +     + W+PP  + G + GYR+           K+++P+        E + +  +  I  G +Y+F + A N V FGE      +IPEE P+  P  L  +G   T V L W PP +  RNGIITKY + Y D+  P+L +++    + TT  +T L+ +T Y  K+RA   +G GP+SP   +          +N   KA+    + +SW  PE  N
Sbjct:   20 AETPPRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLRED-QIPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRSESIGGTPIRGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRE--------LREVRR-VPPRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKW--MLGAEDLTPEDDMPIG-----RNVLELNDVRQSANYTCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTW--DSGNPEPVSYYIIQHKPKNSEELYKEIDGVAT--------------TRYSVAGLSPYSDYEFRVVAV-NNIGRGPPSEPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTG----------VPGQPLNFKAEPESETSILLSWTPPR---SDTIANYELVYK-DG-EHGEEQRITIEP-GTSYRLQGLKPNSLYYFRLAARSPQGLGASTAEISARTMQSKPSAPPQDISC--TSPSSTSILVSWQPPPVEKQNGIITEYSIKYTAV-DGEDDK--PHEILGIPSDT--TKYLLEQLEKWTEYRITV--TAHTD------VGPGPESLSVLIRT--NEDVPSGPPRKVEVEAVNSTSVKVSWRSPVPNKQHGQIRGYQVHYVRMENGEPKGQPMLKDVMLADAQWEFDDTTEHDMIISGLQPETSYSLTVTAYTTKGDGARSKPKLVSTTG--AVPGKPRLV----------INHTQMNTALIQWHPPVDTFGPLQGYRLKFGR-------KDMEPLTTLEFSEKEDHFTATD--IHKGASYVFRLSARNKVGFGEEMVKEISIPEEVPTGFPQNLHSEGTTSTSVQLSWQPPVLAERNGIITKYTLLYRDINIPLLPMEQLIVPADTTMTLTGLKPDTTYDVKVRAHTSKGPGPYSPSVQFRTLPVDQVFAKNFHVKAVMKTSVLLSWEIPENYN 1045          

HSP 3 Score: 83.1889 bits (204), Expect = 6.007e-15
Identity = 93/389 (23.91%), Postives = 158/389 (40.62%), Query Frame = 2
Query: 2438 PEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEH---ILNNLLPNKYYKIEVLAASRKGKGS-PEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFG-ETARINYTIPEERPSAPPNKLEIQGEKKT-VTLKWHPPPIDYRNGIITKYKIQY--FDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPA--PENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQ-VSTNRDFPDGKITFKKIV 3571
            P  V  ++++ST+  + WK P +   Q++ Y + +             + T  +N    +NV +     + NL+P K Y ++VLA +  G G      ++I   G   VP  P   +     +          ++ L+W PP+     I  Y          E V +       + ++ E   S     + P   Y F + A +    G  TA I+    + +PSAPP  +       T + + W PPP++ +NGIIT+Y I+Y   D ++             T  ++  L++ T Y   + A    G GP S       ++E  P+  P  +E +A+N   +KVSW  P    Q      Q+ G+ V  V      P G+   K ++
Sbjct:  421 PRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYY-----------TMDPTQHVNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTG---VPGQPLNFKAEPESET---------SILLSWTPPR--SDTIANY----------ELVYKDGEHGEEQRITIEPGTSYRLQGLKPNSLYYFRLAARSPQGLGASTAEISARTMQSKPSAPPQDISCTSPSSTSILVSWQPPPVEKQNGIITEYSIKYTAVDGEDDKPHEILGIPSDTTKYLLEQLEKWTEYRITVTAHTDVGPGPESLSV-LIRTNEDVPSGPPRKVEVEAVNSTSVKVSWRSPVPNKQ----HGQIRGYQVHYVRMENGEPKGQPMLKDVM 769          

HSP 4 Score: 62.003 bits (149), Expect = 1.750e-8
Identity = 87/357 (24.37%), Postives = 153/357 (42.86%), Query Frame = 2
Query: 1010 QPSSS-TIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPL--QQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGY--ELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETT 2065
            QP +S ++ +T  T  G     A++K  L+     +     P  P LV  +  +  +A+I+W     +PP+D++  L           G + +     P   L    K+  F  T++    +Y  ++ A  N +G  +  +       E  P+  P +L ++  +  S++++W+PP+  ++NG I  Y L Y +     +    +    DT   L  L  + TY VKV A+   G GP S +            +TLP       +N    ++  TS+ + W  P        E Y   + +++  D+ GKM +E ++   TQ LI NLKP K+Y   L  +     G+  ++T  T
Sbjct:  791 QPETSYSLTVTAYTTKGD---GARSKPKLVSTTGAV-----PGKPRLV-INHTQMNTALIQW-----HPPVDTFGPL----QGYRLKFGRKDME----PLTTLEFSEKEDHFTATDIHKGASYVFRLSA-RNKVGFGE-EMVKEISIPEEVPTGFPQNLHSEGTTSTSVQLSWQPPVLAERNGIITKYTLLYRDINIPLLPMEQLIVPADTTMTLTGLKPDTTYDVKVRAHTSKGPGPYSPSVQF---------RTLPVD-QVFAKNFHVKAVMKTSVLLSWEIP--------ENYNSAMPFKILYDD-GKMVEE-VDGRATQKLIVNLKPEKSYSFVLTNRGNSAGGLQHRVTAKT 1103          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Human
Match: PTPRD (protein tyrosine phosphatase receptor type D [Source:HGNC Symbol;Acc:HGNC:9668])

HSP 1 Score: 881.322 bits (2276), Expect = 0.000e+0
Identity = 405/617 (65.64%), Postives = 499/617 (80.88%), Query Frame = 2
Query: 4880 LELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            +EL+++ N Q P +  +         PPIP+  L   I  L+ANDN  FSQEYESIDPGQQFTWE+SNLE+N+ KNRYANVIAYDHSR+LL  I G+ GSDY+NANYIDGY++ NAYIATQG L  TFGDFWRM+WEQ +A++VMMTKLEER+R+KCDQYWP++GTE++  G + VT+ DT ELA Y +RTF +  N SS         +KRE+RQ+QFTAWPDHGVP++P P L FL+R++  NP  + P++VHCSAGVGRTG FIVID  LERI+HE TVDI+G V++MRAQRNYMVQTEDQY+F+H+ +L+AV   NTEV  +N+  ++QKL + +  TG +  TG+ELEF++L+  K + +R  SANLP N+ KNRLVNI+PYE  R+CLQPIRG EGSDYINAS+IDGY+  KAYIATQ PL ET EDFWRM+WEHNSTI+VMLTKLREMGREKCH+YWP ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRTVRQFQFT+WPEQGVP ++ E FI+FIGQVHKTKEQFGQ+GPI+VHCSAGVGRTGVF+ LSI LER++ EGV+D+FQ V+ LR QR  MVQ+E+QY+F Y AA +Y+ SFD +
Sbjct: 1319 VELRRL-NFQTPGMASH---------PPIPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTETH--GLVQVTLLDTVELATYCVRTFALYKNGSS---------EKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIE--TG-ENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFSYRAALEYLGSFDHY 1910          

HSP 2 Score: 375.555 bits (963), Expect = 2.365e-104
Identity = 324/1114 (29.08%), Postives = 517/1114 (46.41%), Query Frame = 2
Query:  203 GQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNE------RFQVVG----TGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNP-PIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPY-YLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVS-AQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESK--IALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDK-PEAVSIKVINSTSSKISWKGPM--KTLDQVKYYIIEWRELSNKSKNSK--VFNVTVDINKSNPNNVYEH--ILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKT-VTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKAN 3472
             ++P   T  P+D T  +G     IC+A G+P+P + +   GK  SN     I      G+ LR Q ++   +  + +C+A N++G  + S  +TV+  + ++P GFP I  GP   + +  + A + C  S +P  ++TW K+      SNN       R + +G     G+L I+   E+D G YEC+ATN  GT  S    L +R         ++E    + P+     +  E+  G   N+TC A GSP+P V W   +G  +    ++ P+G      + + L D+ +S +Y C A + +G+I+  AQI VK  P  P     ++  ATS  + W     NP P+  Y +  K  ++++ +  +  +A                 + +  L  Y++YE +VVAV NNIG   PS P+  QT E  PSS P D+ A+ +S  +I V WK P + NG+I+GYR+YYT      ++NW    V D+    + NL+   TY VKV A+   GDGP+S    ++   G          VP  P N +    S TSI + WT P       +  YEL Y+ DG E G+  +  IEP  T Y +  LKP   Y+  LA ++  G+G S A+++  T          ++    T+ S  S  + W+    E +  I   + I Y  + D  + K        + +DT    ++L  L   + Y + V    +TD      V     S  + I T  N+ VP   P  V ++ +NSTS K+SW+ P+  K   Q++ Y + +  + N     +  + +V +   +   ++  EH  I++ L P   Y + V A + KG G+  K +++ T G   VP  PR +              +     + W+PP  + G + GYR+           K+++P+        E + +  +  I  G +Y+F + A N V FGE      +IPEE P+  P  L  +G   T V L W PP +  RNGIITKY + Y D+  P+L +++    + TT  +T L+ +T Y  K+RA   +G GP+SP   +          +N   KA+    + +SW  PE  N
Sbjct:   20 AETPPRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLRED-QIPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRSESIGGTPIRGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRE--------LREVRR-VPPRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKW--MLGAEDLTPEDDMPIG-----RNVLELNDVRQSANYTCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTW--DSGNPEPVSYYIIQHKPKNSEELYKEIDGVAT--------------TRYSVAGLSPYSDYEFRVVAV-NNIGRGPPSEPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTG----------VPGQPLNFKAEPESETSILLSWTPPR---SDTIANYELVYK-DG-EHGEEQRITIEP-GTSYRLQGLKPNSLYYFRLAARSPQGLGASTAEISARTMQSKPSAPPQDISC--TSPSSTSILVSWQPPPVEKQNGIITEYSIKYTAV-DGEDDK--PHEILGIPSDT--TKYLLEQLEKWTEYRITV--TAHTD------VGPGPESLSVLIRT--NEDVPSGPPRKVEVEAVNSTSVKVSWRSPVPNKQHGQIRGYQVHYVRMENGEPKGQPMLKDVMLADAQWEFDDTTEHDMIISGLQPETSYSLTVTAYTTKGDGARSKPKLVSTTG--AVPGKPRLV----------INHTQMNTALIQWHPPVDTFGPLQGYRLKFGR-------KDMEPLTTLEFSEKEDHFTATD--IHKGASYVFRLSARNKVGFGEEMVKEISIPEEVPTGFPQNLHSEGTTSTSVQLSWQPPVLAERNGIITKYTLLYRDINIPLLPMEQLIVPADTTMTLTGLKPDTTYDVKVRAHTSKGPGPYSPSVQFRTLPVDQVFAKNFHVKAVMKTSVLLSWEIPENYN 1045          

HSP 3 Score: 83.1889 bits (204), Expect = 6.007e-15
Identity = 93/389 (23.91%), Postives = 158/389 (40.62%), Query Frame = 2
Query: 2438 PEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEH---ILNNLLPNKYYKIEVLAASRKGKGS-PEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFG-ETARINYTIPEERPSAPPNKLEIQGEKKT-VTLKWHPPPIDYRNGIITKYKIQY--FDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPA--PENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQ-VSTNRDFPDGKITFKKIV 3571
            P  V  ++++ST+  + WK P +   Q++ Y + +             + T  +N    +NV +     + NL+P K Y ++VLA +  G G      ++I   G   VP  P   +     +          ++ L+W PP+     I  Y          E V +       + ++ E   S     + P   Y F + A +    G  TA I+    + +PSAPP  +       T + + W PPP++ +NGIIT+Y I+Y   D ++             T  ++  L++ T Y   + A    G GP S       ++E  P+  P  +E +A+N   +KVSW  P    Q      Q+ G+ V  V      P G+   K ++
Sbjct:  421 PRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYY-----------TMDPTQHVNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTG---VPGQPLNFKAEPESET---------SILLSWTPPR--SDTIANY----------ELVYKDGEHGEEQRITIEPGTSYRLQGLKPNSLYYFRLAARSPQGLGASTAEISARTMQSKPSAPPQDISCTSPSSTSILVSWQPPPVEKQNGIITEYSIKYTAVDGEDDKPHEILGIPSDTTKYLLEQLEKWTEYRITVTAHTDVGPGPESLSV-LIRTNEDVPSGPPRKVEVEAVNSTSVKVSWRSPVPNKQ----HGQIRGYQVHYVRMENGEPKGQPMLKDVM 769          

HSP 4 Score: 62.003 bits (149), Expect = 1.750e-8
Identity = 87/357 (24.37%), Postives = 153/357 (42.86%), Query Frame = 2
Query: 1010 QPSSS-TIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPL--QQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGY--ELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETT 2065
            QP +S ++ +T  T  G     A++K  L+     +     P  P LV  +  +  +A+I+W     +PP+D++  L           G + +     P   L    K+  F  T++    +Y  ++ A  N +G  +  +       E  P+  P +L ++  +  S++++W+PP+  ++NG I  Y L Y +     +    +    DT   L  L  + TY VKV A+   G GP S +            +TLP       +N    ++  TS+ + W  P        E Y   + +++  D+ GKM +E ++   TQ LI NLKP K+Y   L  +     G+  ++T  T
Sbjct:  791 QPETSYSLTVTAYTTKGD---GARSKPKLVSTTGAV-----PGKPRLV-INHTQMNTALIQW-----HPPVDTFGPL----QGYRLKFGRKDME----PLTTLEFSEKEDHFTATDIHKGASYVFRLSA-RNKVGFGE-EMVKEISIPEEVPTGFPQNLHSEGTTSTSVQLSWQPPVLAERNGIITKYTLLYRDINIPLLPMEQLIVPADTTMTLTGLKPDTTYDVKVRAHTSKGPGPYSPSVQF---------RTLPVD-QVFAKNFHVKAVMKTSVLLSWEIP--------ENYNSAMPFKILYDD-GKMVEE-VDGRATQKLIVNLKPEKSYSFVLTNRGNSAGGLQHRVTAKT 1103          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Human
Match: PTPRD (protein tyrosine phosphatase receptor type D [Source:HGNC Symbol;Acc:HGNC:9668])

HSP 1 Score: 881.322 bits (2276), Expect = 0.000e+0
Identity = 403/601 (67.05%), Postives = 492/601 (81.86%), Query Frame = 2
Query: 4928 NALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            N  S S +  PPIP+  L   I  L+ANDN  FSQEYESIDPGQQFTWE+SNLE+N+ KNRYANVIAYDHSR+LL  I G+ GSDY+NANYIDGY++ NAYIATQG L  TFGDFWRM+WEQ +A++VMMTKLEER+R+KCDQYWP++GTE++  G + VT+ DT ELA Y +RTF +  N SS         +KRE+RQ+QFTAWPDHGVP++P P L FL+R++  NP  + P++VHCSAGVGRTG FIVID  LERI+HE TVDI+G V++MRAQRNYMVQTEDQY+F+H+ +L+AV   NTEV  +N+  ++QKL + +  TG +  TG+ELEF++L+  K + +R  SANLP N+ KNRLVNI+PYE  R+CLQPIRG EGSDYINAS+IDGY+  KAYIATQ PL ET EDFWRM+WEHNSTI+VMLTKLREMGREKCH+YWP ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRTVRQFQFT+WPEQGVP ++ E FI+FIGQVHKTKEQFGQ+GPI+VHCSAGVGRTGVF+ LSI LER++ EGV+D+FQ V+ LR QR  MVQ+E+QY+F Y AA +Y+ SFD +
Sbjct:  918 NLHSSSMASHPPIPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTETH--GLVQVTLLDTVELATYCVRTFALYKNGSS---------EKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIE--TG-ENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFSYRAALEYLGSFDHY 1503          

HSP 2 Score: 270.011 bits (689), Expect = 4.595e-72
Identity = 199/658 (30.24%), Postives = 316/658 (48.02%), Query Frame = 2
Query:  203 GQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNN----ERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNP-PIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPY-YLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKM 2155
             ++P   T  P+D T  +G     IC+A G+P+P + +   GK  SN     I      G+ LR Q ++   +  + +C+A N++G  + S  +TV+  + ++P GFP I  GP   + +  + A + C  S +P  ++TW K+      SNN    ++ + V  G+L I+   E+D G YEC+ATN  GT  S    L           Y++ +  P  P+     +  E+  G   N+TC A GSP+P V W   +G  +    ++ P+G      + + L D+ +S +Y C A + +G+I+  AQI VK  P  P     ++  ATS  + W     NP P+  Y +  K  ++++ +  +  +A                 + +  L  Y++YE +VVAV NNIG   PS P+  QT E  PSS P D+ A+ +S  +I V WK P + NG+I+GYR+YYT      ++NW    V D+    + NL+   TY VKV A+   GDGP+S    ++   G          VP  P N +    S TSI + WT P       +  YEL Y+ DG E G+  +  IEP  T Y +  LKP   Y+  LA ++  G+G S         +++  +  ++K     + K S  + W++
Sbjct:   20 AETPPRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLRED-QIPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRSVSIGALQIEQSEESDQGKYECVATNSAGTRYSAPANL-----------YVRVRRVP--PRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKW--MLGAEDLTPEDDMPIG-----RNVLELNDVRQSANYTCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTW--DSGNPEPVSYYIIQHKPKNSEELYKEIDGVAT--------------TRYSVAGLSPYSDYEFRVVAV-NNIGRGPPSEPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTG----------VPGQPLNFKAEPESETSILLSWTPPR---SDTIANYELVYK-DG-EHGEEQRITIEP-GTSYRLQGLKPNSLYYFRLAARSPQGLGASTAEISARTMQSMFAKNFHVKA----VMKTSVLLSWEI 619          

HSP 3 Score: 56.6102 bits (135), Expect = 6.814e-7
Identity = 85/364 (23.35%), Postives = 143/364 (39.29%), Query Frame = 2
Query: 2402 ISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPS-MPREL--RMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIG---PGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKT-VTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKAN 3472
            I+ +   ++P  P    +    +TS  ++W       + V YYII+     +K KNS+     +D   +       + +  L P   Y+  V+A +  G+G P   E + T  + + PS  PR++  RM  S  I            + W  P+  +G I GYRV  ++           P +   N         +   IG   P KTY  +V A  S+  G  +     I +      P   + + E +T + L W PP    R+  I  Y++ Y D +      +    E  T+  +  L+ N+ Y F++ A + +G G  +           F   +N   KA+    + +SW  PE  N
Sbjct:  304 IAQITVKALPKPPGTPVVTESTATSITLTWDS--GNPEPVSYYIIQ-----HKPKNSEELYKEIDGVATT-----RYSVAGLSPYSDYEFRVVAVNNIGRGPPS--EPVLTQTSEQAPSSAPRDVQARMLSSTTI-----------LVQWKEPEEPNGQIQGYRVYYTM----------DPTQHVNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGVPGQPLNFKAEPESETSILLSWTPP----RSDTIANYELVYKDGEH--GEEQRITIEPGTSYRLQGLKPNSLYYFRLAARSPQGLGASTAEISARTMQSMFA--KNFHVKAVMKTSVLLSWEIPENYN 624          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 689.108 bits (1777), Expect = 0.000e+0
Identity = 315/606 (51.98%), Postives = 429/606 (70.79%), Query Frame = 2
Query: 4913 PDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            P L  N  +++    P +P+  L + I  LR N+N  F  E+ESI+ GQ FTWE+S+ ++N+ KNRYANV AYDHSR++L  + G  G DYINANY+DGY +P +YIATQGPL  TF DFWRMVWE+ + +IVM+T LEER+R+KCDQYWP++GT +Y D  I VT+ ++  LA+YT+RT  +         +     + REI+  Q+TAWPDHGVPD+P P L+FLKR++  NP  + PII HCSAG+GRTGAFIVID  LER+R++ TVDI+G V+ +RAQR+YMVQTE+QY+F+H+ VLDAV + +TEV    +  H+  L +        + +GI++EF+ L+  K  + RCT ANLPVNR KNR+++ +PY+ NR+ ++ + G +GSDYINAS+IDGY+   AYIATQAP  ET  DFWR IWEHNS II ML +  E G+E+C  YWP E   +    VV+PM EY+M ++ L+EF+++D    + RTVRQF F EWP+ G P+ A + F++F+ QVH T  QFG  GPITVHC +G GRT VF+ALSI L+R++ E V+D+F  V+ LR +R NM+Q  EQY F YLAA +Y+ ++D+F
Sbjct: 1614 PSLPNNGNNMTTVSHPAVPIAELANHIERLRMNNNAGFQSEFESIETGQHFTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTATYGD--IEVTLLESVHLAHYTMRTMRL---------KMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQPSA----DQLSGIDMEFRHLTTLKWTSNRCTVANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYHLREFRISDINTREVRTVRQFHFMEWPDVGKPHTA-DHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYLAAYDNF 2203          

HSP 2 Score: 251.521 bits (641), Expect = 2.024e-66
Identity = 349/1447 (24.12%), Postives = 602/1447 (41.60%), Query Frame = 2
Query:  212 PAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGAS-LR-QQVQMDNNNDVVQCIAENHLGVDT-KSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQV--VGT-GSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIR-RNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHW---EVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSY--------------TLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSA-IDNWHIREVQDTPYY--LNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRL-DGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENI--LNEISNLKIWGTNISKDSATICWK------------------MNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLDQ-VKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQI--SHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPG-TPYYISSEFFPAPENIETKALNDYQIKVSWNF-PEKANQVTDLLSQVNGFHVQVSTNRDFPDGKITFKKIVGPFTSTVMEKIYPNHYFIRVQAIIRDKRIAEWSNIHTLTVFKSKYTERNIKGLNCIGQT-NSIKVTWEKPDDYTEIKS--FLIELSGYRKFRNIYGAYKIEKIKARTSRIEFFGE--EQSTYNYSIPNLEPNTNYDXXXXXXXXXXXXXXXXXXXXXCVT------LMEQPKSILSPMPVPLRKVSNEIILRLSRTNEILGMISHYYLIVSPIKETHVTPHDVNID--ETFTQTKNLKAMNSRYVAAQFTPALFRSKSYVDFVLGSNSPIESFH 4354
            PA +   P  +T      I   C+A GNP P+V +++NGK    D +R  I+S   G S LR ++V +D+N  VV C A+N +       A++TV+  + +VP GFP I   P     + GK A + C V  DP AKV W+++        + R+ V  +G  G+L I++ RE D G YEC+A N +G   S++  L ++ R +     Y  E++               V  G   NLTC A G P+P V W   ++ + +    +P   P+G      + + LT +  + ++ C A + +G I+    +I K+ P  P  +  S V + S VI W P K N  I+ Y               L  KD+  +D     R         +  + E+ + S  I  L A+  YE  V + +  +G    SLP+  QT    P++ P    A++++ DSI V W P  Q NG I GY++YYT  L +  I  W   + +   +   +N L  ++ Y+V+V A N  GD P+S    +    G          +P  P  L   +L +  +Q+ W  P  +    + GY ++Y   DG+++  +   H      ++++  L P K Y+  +A  +  G G   + TE    + I  +   S   +     S  S  I WK                    L++SK A    + Y    D S   S+  +  +++  +    +VL+ L P S Y++ V    +T D           SS   + T+++  VP  P   + ++ ++TS K++W  P       + YY+   R ++ +    K     + + + +    +E  L++L PN  Y   + A +R G G   + + I T G      +P E     SV +   + P  +   + W  P++  +   I  Y + +   G P+   + K V         T  S   + +  G  Y   + A N     + A      P   P   P  ++ +  K  + + W PP  + RNG IT YK     M       ++      T+     +     Y+FK+ A   +G GP+SP  T     +     P N+  +A ++    V W+F  +KA+          G  +     +  P   I  +    P    V+  +  +  +      +++ R    S+    TV +S      ++ L  + +T NS+++TWE    Y   ++  F +  +G + + N        +++ +T     FG+  ++    Y   NL P+  Y + + +        +   +    +T       ++ PK + S    P ++     ++RL+   E  G ISHY++I+ P    + T   VN+D  E    T   +A  +R ++   +  L R  S V    G +S   S+H
Sbjct:   47 PARLVVRPDSSTVVDESKISFFCRADGNPLPSVIWRVNGK-SITDHNRISIKSLATGLSTLRFERVSLDDNATVVSCSADNGVANPVVAEASLTVVPRD-KVPIGFPQIELHPSLKSVEQGKTAYVSCRVRGDPRAKVLWLRDLIPLDIRADGRYSVSTIGNPGALMIQHAREEDQGKYECIARNTLGVAHSKAANLYVKVRRVPPYFSYKLERQ-------------YVVGVGGNINLTCVAVGYPMPRVFWKKTDLMVLD----DPSTAPIG-----KNVLTLTHVESTENFTCVAVSALGNIEATTTVIAKELPPPPVNIVVSSVTSESVVITWKPPKYNEAINKYVVNYRLKSENKDDAALFAKDSRAEDESDSERYSEGR--SSRGKTMETLENSLVIDGLVAFQTYEFTVRS-AGPVGVGLESLPVEAQTKPSKPATAPVSPQARSLNRDSILVKWGPCEQPNGLITGYKVYYTNDLVTTPIREWKQHDAKSDEFMTTINGLEPDSRYFVRVIAQNSEGDSPLSTLVTVATRQG----------IPGQPPMLTVKALDSRRMQLTWDKP--LYSSPVVGYTVRYNTSDGEKELTLTSPH-----EKHVVTGLHPDKYYYFRVAAYSDRGQG---EFTEPMISKTIASIPLSSPTIVSAAATSSKSVEIRWKGPEQKKLNGVLTAYRINYFRLEDSKTANLESVEYDEDMDDS---SSFLDRMSVVVPSDATSYVLSDLLPYSSYEITVA--ASTMDG------YGPESSIRVVKTLED--VPSAPRNFNAELTSATSVKLTWDAPAAANGALLGYYVYLDRMVNGEPVVEKGSKKRIVMIRDSSKRYFE--LDSLDPNTEYSFRLNAFNRNGDGEFSERKSIITQG------IPPEAPEIVSVSLDRDEPP--VVARIEWKMPKMKPNETPIEKYNLWLRAQGYPDSYVKAKTVD-------GTDLSTTISGLWMGVVYDVLLAAENREGRSQNATETIATPVGSPDGEPIDVQYEVMKGKIVVSWRPPSEEKRNGNITSYKAILSAMDATADRYEQPVPAPSTSSTF-EVNVRRAYLFKVAAATMKGIGPYSPVLTINPDPAALVGPPTNVRVEATSNSTAVVQWDFESQKADSFVVKYMHEPGNRMDTEKWKQLPVVSIDKEN---PKRFAVVSDLNAHKPYAFCVLAVKNNRQGPCSD--PPTVLESVTPTYMVQNLRVLWKTSNSVQLTWE----YNGPRNVGFYVNHTGRKDYVN-------HELQEKTMSTPGFGQDVDEKHREYLWTNLRPHMMYTIHVGVRTLPPGARKYWPQEVVTITDPTGPPFVDVPKLVDSSGTQPGQQ-----MIRLTPATEEYGPISHYWIILVPAN--YSTEDVVNLDPIELEKATAEKRAQLARSLSVSPSKKLKRKASEV----GDDSQSASYH 1388          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 688.723 bits (1776), Expect = 0.000e+0
Identity = 315/606 (51.98%), Postives = 429/606 (70.79%), Query Frame = 2
Query: 4913 PDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            P L  N  +++    P +P+  L + I  LR N+N  F  E+ESI+ GQ FTWE+S+ ++N+ KNRYANV AYDHSR++L  + G  G DYINANY+DGY +P +YIATQGPL  TF DFWRMVWE+ + +IVM+T LEER+R+KCDQYWP++GT +Y D  I VT+ ++  LA+YT+RT  +         +     + REI+  Q+TAWPDHGVPD+P P L+FLKR++  NP  + PII HCSAG+GRTGAFIVID  LER+R++ TVDI+G V+ +RAQR+YMVQTE+QY+F+H+ VLDAV + +TEV    +  H+  L +        + +GI++EF+ L+  K  + RCT ANLPVNR KNR+++ +PY+ NR+ ++ + G +GSDYINAS+IDGY+   AYIATQAP  ET  DFWR IWEHNS II ML +  E G+E+C  YWP E   +    VV+PM EY+M ++ L+EF+++D    + RTVRQF F EWP+ G P+ A + F++F+ QVH T  QFG  GPITVHC +G GRT VF+ALSI L+R++ E V+D+F  V+ LR +R NM+Q  EQY F YLAA +Y+ ++D+F
Sbjct: 1395 PSLPNNGNNMTTVSHPAVPIAELANHIERLRMNNNAGFQSEFESIETGQHFTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTATYGD--IEVTLLESVHLAHYTMRTMRL---------KMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQPSA----DQLSGIDMEFRHLTTLKWTSNRCTVANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYHLREFRISDINTREVRTVRQFHFMEWPDVGKPHTA-DHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYLAAYDNF 1984          

HSP 2 Score: 160.229 bits (404), Expect = 9.550e-39
Identity = 275/1215 (22.63%), Postives = 491/1215 (40.41%), Query Frame = 2
Query:  863 FKSKIE----VSTGQGANLTCNAEGSPIPLVHW---EVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTL--LIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSA-IDNWHIREVQDTPYY--LNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRL-DGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENI--LNEISNLKIWGTNISKDSATICWK------------------MNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLDQ-VKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQI--SHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPG-TPYYISSEFFPAPENIETKALNDYQIKVSWNF-PEKANQVTDLLSQVNGFHVQVSTNRDFPDGKITFKKIVGPFTSTVMEKIYPNHYFIRVQAIIRDKRIAEWSNIHTLTVFKSKYTERNIKGLNCIGQT-NSIKVTWEKPDDYTEIKS--FLIELSGYRKFRNIYGAYKIEKIKARTSRIEFFGE--EQSTYNYSIPNLEPNTNYDXXXXXXXXXXXXXXXXXXXXXCVT------LMEQPKSILSPMPVPLRKVSNEIILRLSRTNEILGMISHYYLIVSPIKETHVTPHDVNID--ETFTQTKNLKAMNSRYVAAQFTPALFRSKSYVDFVLGSNSPIESFH 4354
            F  K+E    V  G   NLTC A G P+P V W   ++ + +    +P   P+G      + + LT +  + ++ C A + +G I+    +I K+ P  P  +  S V + S VI W P K N  I+ Y +   +K +  +                +  + E+ + S  I  L A+  YE  V + +  +G    SLP+  QT    P++ P    A++++ DSI V W P  Q NG I GY++YYT  L +  I  W   + +   +   +N L  ++ Y+V+V A N  GD P+S    +    G          +P  P  L   +L +  +Q+ W  P  +    + GY ++Y   DG+++  +   H      ++++  L P K Y+  +A  +  G G   + TE    + I  +   S   +     S  S  I WK                    L++SK A    + Y    D S   S+  +  +++  +    +VL+ L P S Y++ V    +T D           SS   + T+++  VP  P   + ++ ++TS K++W  P       + YY+   R ++ +    K     + + + +    +E  L++L PN  Y   + A +R G G   + + I T G      +P E     SV +   + P  +   + W  P++  +   I  Y + +   G P+   + K V         T  S   + +  G  Y   + A N     + A      P   P   P  ++ +  K  + + W PP  + RNG IT YK     M       ++      T+     +     Y+FK+ A   +G GP+SP  T     +     P N+  +A ++    V W+F  +KA+          G  +     +  P   I  +    P    V+  +  +  +      +++ R    S+    TV +S      ++ L  + +T NS+++TWE    Y   ++  F +  +G + + N        +++ +T     FG+  ++    Y   NL P+  Y + + +        +   +    +T       ++ PK + S    P ++     ++RL+   E  G ISHY++I+ P    + T   VN+D  E    T   +A  +R ++   +  L R  S V    G +S   S+H
Sbjct:   57 FSYKLERQYVVGVGGNINLTCVAVGYPMPRVFWKKTDLMVLD----DPSTAPIG-----KNVLTLTHVESTENFTCVAVSALGNIEATTTVIAKELPPPPVNIVVSSVTSESVVITWKPPKYNEAINKYVVNYRLKYSEGRSS--------------RGKTMETLENSLVIDGLVAFQTYEFTVRS-AGPVGVGLESLPVEAQTKPSKPATAPVSPQARSLNRDSILVKWGPCEQPNGLITGYKVYYTNDLVTTPIREWKQHDAKSDEFMTTINGLEPDSRYFVRVIAQNSEGDSPLSTLVTVATRQG----------IPGQPPMLTVKALDSRRMQLTWDKP--LYSSPVVGYTVRYNTSDGEKELTLTSPH-----EKHVVTGLHPDKYYYFRVAAYSDRGQG---EFTEPMISKTIASIPLSSPTIVSAAATSSKSVEIRWKGPEQKKLNGVLTAYRINYFRLEDSKTANLESVEYDEDMDDS---SSFLDRMSVVVPSDATSYVLSDLLPYSSYEITVA--ASTMDG------YGPESSIRVVKTLED--VPSAPRNFNAELTSATSVKLTWDAPAAANGALLGYYVYLDRMVNGEPVVEKGSKKRIVMIRDSSKRYFE--LDSLDPNTEYSFRLNAFNRNGDGEFSERKSIITQG------IPPEAPEIVSVSLDRDEPP--VVARIEWKMPKMKPNETPIEKYNLWLRAQGYPDSYVKAKTVD-------GTDLSTTISGLWMGVVYDVLLAAENREGRSQNATETIATPVGSPDGEPIDVQYEVMKGKIVVSWRPPSEEKRNGNITSYKAILSAMDATADRYEQPVPAPSTSSTF-EVNVRRAYLFKVAAATMKGIGPYSPVLTINPDPAALVGPPTNVRVEATSNSTAVVQWDFESQKADSFVVKYMHEPGNRMDTEKWKQLPVVSIDKEN---PKRFAVVSDLNAHKPYAFCVLAVKNNRQGPCSD--PPTVLESVTPTYMVQNLRVLWKTSNSVQLTWE----YNGPRNVGFYVNHTGRKDYVN-------HELQEKTMSTPGFGQDVDEKHREYLWTNLRPHMMYTIHVGVRTLPPGARKYWPQEVVTITDPTGPPFVDVPKLVDSSGTQPGQQ-----MIRLTPATEEYGPISHYWIILVPAN--YSTEDVVNLDPIELEKATAEKRAQLARSLSVSPSKKLKRKASEV----GDDSQSASYH 1169          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 688.723 bits (1776), Expect = 0.000e+0
Identity = 315/606 (51.98%), Postives = 429/606 (70.79%), Query Frame = 2
Query: 4913 PDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            P L  N  +++    P +P+  L + I  LR N+N  F  E+ESI+ GQ FTWE+S+ ++N+ KNRYANV AYDHSR++L  + G  G DYINANY+DGY +P +YIATQGPL  TF DFWRMVWE+ + +IVM+T LEER+R+KCDQYWP++GT +Y D  I VT+ ++  LA+YT+RT  +         +     + REI+  Q+TAWPDHGVPD+P P L+FLKR++  NP  + PII HCSAG+GRTGAFIVID  LER+R++ TVDI+G V+ +RAQR+YMVQTE+QY+F+H+ VLDAV + +TEV    +  H+  L +        + +GI++EF+ L+  K  + RCT ANLPVNR KNR+++ +PY+ NR+ ++ + G +GSDYINAS+IDGY+   AYIATQAP  ET  DFWR IWEHNS II ML +  E G+E+C  YWP E   +    VV+PM EY+M ++ L+EF+++D    + RTVRQF F EWP+ G P+ A + F++F+ QVH T  QFG  GPITVHC +G GRT VF+ALSI L+R++ E V+D+F  V+ LR +R NM+Q  EQY F YLAA +Y+ ++D+F
Sbjct: 1637 PSLPNNGNNMTTVSHPAVPIAELANHIERLRMNNNAGFQSEFESIETGQHFTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTATYGD--IEVTLLESVHLAHYTMRTMRL---------KMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQPSA----DQLSGIDMEFRHLTTLKWTSNRCTVANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYHLREFRISDINTREVRTVRQFHFMEWPDVGKPHTA-DHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYLAAYDNF 2226          

HSP 2 Score: 249.98 bits (637), Expect = 5.320e-66
Identity = 345/1435 (24.04%), Postives = 599/1435 (41.74%), Query Frame = 2
Query:  212 PAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGAS-LR-QQVQMDNNNDVVQCIAENHLGVDT-KSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQV--VGT-GSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIR-RNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHW---EVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTL--LIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSA-IDNWHIREVQDTPYY--LNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRL-DGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENI--LNEISNLKIWGTNISKDSATICWK------------------MNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLDQ-VKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQI--SHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPG-TPYYISSEFFPAPENIETKALNDYQIKVSWNF-PEKANQVTDLLSQVNGFHVQVSTNRDFPDGKITFKKIVGPFTSTVMEKIYPNHYFIRVQAIIRDKRIAEWSNIHTLTVFKSKYTERNIKGLNCIGQT-NSIKVTWEKPDDYTEIKS--FLIELSGYRKFRNIYGAYKIEKIKARTSRIEFFGE--EQSTYNYSIPNLEPNTNYDXXXXXXXXXXXXXXXXXXXXXCVT------LMEQPKSILSPMPVPLRKVSNEIILRLSRTNEILGMISHYYLIVSPIKETHVTPHDVNID--ETFTQTKNLKAMNSRYVAAQFTPALFRSKSYVDFVLGSNSPIESFH 4354
            PA +   P  +T      I   C+A GNP P+V +++NGK    D +R  I+S   G S LR ++V +D+N  VV C A+N +       A++TV+  + +VP GFP I   P     + GK A + C V  DP AKV W+++        + R+ V  +G  G+L I++ RE D G YEC+A N +G   S++  L ++ R +     Y  E++               V  G   NLTC A G P+P V W   ++ + +    +P   P+G      + + LT +  + ++ C A + +G I+    +I K+ P  P  +  S V + S VI W P K N  I+ Y +   +K +  +                +  + E+ + S  I  L A+  YE  V + +  +G    SLP+  QT    P++ P    A++++ DSI V W P  Q NG I GY++YYT  L +  I  W   + +   +   +N L  ++ Y+V+V A N  GD P+S    +    G          +P  P  L   +L +  +Q+ W  P  +    + GY ++Y   DG+++  +   H      ++++  L P K Y+  +A  +  G G   + TE    + I  +   S   +     S  S  I WK                    L++SK A    + Y    D S   S+  +  +++  +    +VL+ L P S Y++ V    +T D           SS   + T+++  VP  P   + ++ ++TS K++W  P       + YY+   R ++ +    K     + + + +    +E  L++L PN  Y   + A +R G G   + + I T G      +P E     SV +   + P  +   + W  P++  +   I  Y + +   G P+   + K V         T  S   + +  G  Y   + A N     + A      P   P   P  ++ +  K  + + W PP  + RNG IT YK     M       ++      T+     +     Y+FK+ A   +G GP+SP  T     +     P N+  +A ++    V W+F  +KA+          G  +     +  P   I  +    P    V+  +  +  +      +++ R    S+    TV +S      ++ L  + +T NS+++TWE    Y   ++  F +  +G + + N        +++ +T     FG+  ++    Y   NL P+  Y + + +        +   +    +T       ++ PK + S    P      + ++RL+   E  G ISHY++I+ P    + T   VN+D  E    T   +A  +R ++   +  L R  S V    G +S   S+H
Sbjct:   94 PARLVVRPDSSTVVDESKISFFCRADGNPLPSVIWRVNGK-SITDHNRISIKSLATGLSTLRFERVSLDDNATVVSCSADNGVANPVVAEASLTVVPRD-KVPIGFPQIELHPSLKSVEQGKTAYVSCRVRGDPRAKVLWLRDLIPLDIRADGRYSVSTIGNPGALMIQHAREEDQGKYECIARNTLGVAHSKAANLYVKVRRVPPYFSYKLERQ-------------YVVGVGGNINLTCVAVGYPMPRVFWKKTDLMVLD----DPSTAPIG-----KNVLTLTHVESTENFTCVAVSALGNIEATTTVIAKELPPPPVNIVVSSVTSESVVITWKPPKYNEAINKYVVNYRLKYSEGRS--------------SRGKTMETLENSLVIDGLVAFQTYEFTVRS-AGPVGVGLESLPVEAQTKPSKPATAPVSPQARSLNRDSILVKWGPCEQPNGLITGYKVYYTNDLVTTPIREWKQHDAKSDEFMTTINGLEPDSRYFVRVIAQNSEGDSPLSTLVTVATRQG----------IPGQPPMLTVKALDSRRMQLTWDKP--LYSSPVVGYTVRYNTSDGEKELTLTSPH-----EKHVVTGLHPDKYYYFRVAAYSDRGQG---EFTEPMISKTIASIPLSSPTIVSAAATSSKSVEIRWKGPEQKKLNGVLTAYRINYFRLEDSKTANLESVEYDEDMDDS---SSFLDRMSVVVPSDATSYVLSDLLPYSSYEITVA--ASTMDG------YGPESSIRVVKTLED--VPSAPRNFNAELTSATSVKLTWDAPAAANGALLGYYVYLDRMVNGEPVVEKGSKKRIVMIRDSSKRYFE--LDSLDPNTEYSFRLNAFNRNGDGEFSERKSIITQG------IPPEAPEIVSVSLDRDEPP--VVARIEWKMPKMKPNETPIEKYNLWLRAQGYPDSYVKAKTVD-------GTDLSTTISGLWMGVVYDVLLAAENREGRSQNATETIATPVGSPDGEPIDVQYEVMKGKIVVSWRPPSEEKRNGNITSYKAILSAMDATADRYEQPVPAPSTSSTF-EVNVRRAYLFKVAAATMKGIGPYSPVLTINPDPAALVGPPTNVRVEATSNSTAVVQWDFESQKADSFVVKYMHEPGNRMDTEKWKQLPVVSIDKEN---PKRFAVVSDLNAHKPYAFCVLAVKNNRQGPCSD--PPTVLESVTPTYMVQNLRVLWKTSNSVQLTWE----YNGPRNVGFYVNHTGRKDYVN-------HELQEKTMSTPGFGQDVDEKHREYLWTNLRPHMMYTIHVGVRTLPPGARKYWPQEVVTITDPTGPPFVDVPKLVDSSGTQP-----GQQMIRLTPATEEYGPISHYWIILVP--ANYSTEDVVNLDPIELEKATAEKRAQLARSLSVSPSKKLKRKASEV----GDDSQSASYH 1411          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 688.723 bits (1776), Expect = 0.000e+0
Identity = 315/606 (51.98%), Postives = 429/606 (70.79%), Query Frame = 2
Query: 4913 PDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            P L  N  +++    P +P+  L + I  LR N+N  F  E+ESI+ GQ FTWE+S+ ++N+ KNRYANV AYDHSR++L  + G  G DYINANY+DGY +P +YIATQGPL  TF DFWRMVWE+ + +IVM+T LEER+R+KCDQYWP++GT +Y D  I VT+ ++  LA+YT+RT  +         +     + REI+  Q+TAWPDHGVPD+P P L+FLKR++  NP  + PII HCSAG+GRTGAFIVID  LER+R++ TVDI+G V+ +RAQR+YMVQTE+QY+F+H+ VLDAV + +TEV    +  H+  L +        + +GI++EF+ L+  K  + RCT ANLPVNR KNR+++ +PY+ NR+ ++ + G +GSDYINAS+IDGY+   AYIATQAP  ET  DFWR IWEHNS II ML +  E G+E+C  YWP E   +    VV+PM EY+M ++ L+EF+++D    + RTVRQF F EWP+ G P+ A + F++F+ QVH T  QFG  GPITVHC +G GRT VF+ALSI L+R++ E V+D+F  V+ LR +R NM+Q  EQY F YLAA +Y+ ++D+F
Sbjct: 1590 PSLPNNGNNMTTVSHPAVPIAELANHIERLRMNNNAGFQSEFESIETGQHFTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTATYGD--IEVTLLESVHLAHYTMRTMRL---------KMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQPSA----DQLSGIDMEFRHLTTLKWTSNRCTVANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYHLREFRISDINTREVRTVRQFHFMEWPDVGKPHTA-DHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYLAAYDNF 2179          

HSP 2 Score: 250.366 bits (638), Expect = 3.612e-66
Identity = 345/1435 (24.04%), Postives = 599/1435 (41.74%), Query Frame = 2
Query:  212 PAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGAS-LR-QQVQMDNNNDVVQCIAENHLGVDT-KSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQV--VGT-GSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIR-RNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHW---EVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTL--LIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSA-IDNWHIREVQDTPYY--LNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRL-DGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENI--LNEISNLKIWGTNISKDSATICWK------------------MNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLDQ-VKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQI--SHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPG-TPYYISSEFFPAPENIETKALNDYQIKVSWNF-PEKANQVTDLLSQVNGFHVQVSTNRDFPDGKITFKKIVGPFTSTVMEKIYPNHYFIRVQAIIRDKRIAEWSNIHTLTVFKSKYTERNIKGLNCIGQT-NSIKVTWEKPDDYTEIKS--FLIELSGYRKFRNIYGAYKIEKIKARTSRIEFFGE--EQSTYNYSIPNLEPNTNYDXXXXXXXXXXXXXXXXXXXXXCVT------LMEQPKSILSPMPVPLRKVSNEIILRLSRTNEILGMISHYYLIVSPIKETHVTPHDVNID--ETFTQTKNLKAMNSRYVAAQFTPALFRSKSYVDFVLGSNSPIESFH 4354
            PA +   P  +T      I   C+A GNP P+V +++NGK    D +R  I+S   G S LR ++V +D+N  VV C A+N +       A++TV+  + +VP GFP I   P     + GK A + C V  DP AKV W+++        + R+ V  +G  G+L I++ RE D G YEC+A N +G   S++  L ++ R +     Y  E++               V  G   NLTC A G P+P V W   ++ + +    +P   P+G      + + LT +  + ++ C A + +G I+    +I K+ P  P  +  S V + S VI W P K N  I+ Y +   +K +  +                +  + E+ + S  I  L A+  YE  V + +  +G    SLP+  QT    P++ P    A++++ DSI V W P  Q NG I GY++YYT  L +  I  W   + +   +   +N L  ++ Y+V+V A N  GD P+S    +    G          +P  P  L   +L +  +Q+ W  P  +    + GY ++Y   DG+++  +   H      ++++  L P K Y+  +A  +  G G   + TE    + I  +   S   +     S  S  I WK                    L++SK A    + Y    D S   S+  +  +++  +    +VL+ L P S Y++ V    +T D           SS   + T+++  VP  P   + ++ ++TS K++W  P       + YY+   R ++ +    K     + + + +    +E  L++L PN  Y   + A +R G G   + + I T G      +P E     SV +   + P  +   + W  P++  +   I  Y + +   G P+   + K V         T  S   + +  G  Y   + A N     + A      P   P   P  ++ +  K  + + W PP  + RNG IT YK     M       ++      T+     +     Y+FK+ A   +G GP+SP  T     +     P N+  +A ++    V W+F  +KA+          G  +     +  P   I  +    P    V+  +  +  +      +++ R    S+    TV +S      ++ L  + +T NS+++TWE    Y   ++  F +  +G + + N        +++ +T     FG+  ++    Y   NL P+  Y + + +        +   +    +T       ++ PK + S    P      + ++RL+   E  G ISHY++I+ P    + T   VN+D  E    T   +A  +R ++   +  L R  S V    G +S   S+H
Sbjct:   47 PARLVVRPDSSTVVDESKISFFCRADGNPLPSVIWRVNGK-SITDHNRISIKSLATGLSTLRFERVSLDDNATVVSCSADNGVANPVVAEASLTVVPRD-KVPIGFPQIELHPSLKSVEQGKTAYVSCRVRGDPRAKVLWLRDLIPLDIRADGRYSVSTIGNPGALMIQHAREEDQGKYECIARNTLGVAHSKAANLYVKVRRVPPYFSYKLERQ-------------YVVGVGGNINLTCVAVGYPMPRVFWKKTDLMVLD----DPSTAPIG-----KNVLTLTHVESTENFTCVAVSALGNIEATTTVIAKELPPPPVNIVVSSVTSESVVITWKPPKYNEAINKYVVNYRLKYSEGRS--------------SRGKTMETLENSLVIDGLVAFQTYEFTVRS-AGPVGVGLESLPVEAQTKPSKPATAPVSPQARSLNRDSILVKWGPCEQPNGLITGYKVYYTNDLVTTPIREWKQHDAKSDEFMTTINGLEPDSRYFVRVIAQNSEGDSPLSTLVTVATRQG----------IPGQPPMLTVKALDSRRMQLTWDKP--LYSSPVVGYTVRYNTSDGEKELTLTSPH-----EKHVVTGLHPDKYYYFRVAAYSDRGQG---EFTEPMISKTIASIPLSSPTIVSAAATSSKSVEIRWKGPEQKKLNGVLTAYRINYFRLEDSKTANLESVEYDEDMDDS---SSFLDRMSVVVPSDATSYVLSDLLPYSSYEITVA--ASTMDG------YGPESSIRVVKTLED--VPSAPRNFNAELTSATSVKLTWDAPAAANGALLGYYVYLDRMVNGEPVVEKGSKKRIVMIRDSSKRYFE--LDSLDPNTEYSFRLNAFNRNGDGEFSERKSIITQG------IPPEAPEIVSVSLDRDEPP--VVARIEWKMPKMKPNETPIEKYNLWLRAQGYPDSYVKAKTVD-------GTDLSTTISGLWMGVVYDVLLAAENREGRSQNATETIATPVGSPDGEPIDVQYEVMKGKIVVSWRPPSEEKRNGNITSYKAILSAMDATADRYEQPVPAPSTSSTF-EVNVRRAYLFKVAAATMKGIGPYSPVLTINPDPAALVGPPTNVRVEATSNSTAVVQWDFESQKADSFVVKYMHEPGNRMDTEKWKQLPVVSIDKEN---PKRFAVVSDLNAHKPYAFCVLAVKNNRQGPCSD--PPTVLESVTPTYMVQNLRVLWKTSNSVQLTWE----YNGPRNVGFYVNHTGRKDYVN-------HELQEKTMSTPGFGQDVDEKHREYLWTNLRPHMMYTIHVGVRTLPPGARKYWPQEVVTITDPTGPPFVDVPKLVDSSGTQP-----GQQMIRLTPATEEYGPISHYWIILVP--ANYSTEDVVNLDPIELEKATAEKRAQLARSLSVSPSKKLKRKASEV----GDDSQSASYH 1364          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 688.337 bits (1775), Expect = 0.000e+0
Identity = 315/606 (51.98%), Postives = 429/606 (70.79%), Query Frame = 2
Query: 4913 PDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            P L  N  +++    P +P+  L + I  LR N+N  F  E+ESI+ GQ FTWE+S+ ++N+ KNRYANV AYDHSR++L  + G  G DYINANY+DGY +P +YIATQGPL  TF DFWRMVWE+ + +IVM+T LEER+R+KCDQYWP++GT +Y D  I VT+ ++  LA+YT+RT  +         +     + REI+  Q+TAWPDHGVPD+P P L+FLKR++  NP  + PII HCSAG+GRTGAFIVID  LER+R++ TVDI+G V+ +RAQR+YMVQTE+QY+F+H+ VLDAV + +TEV    +  H+  L +        + +GI++EF+ L+  K  + RCT ANLPVNR KNR+++ +PY+ NR+ ++ + G +GSDYINAS+IDGY+   AYIATQAP  ET  DFWR IWEHNS II ML +  E G+E+C  YWP E   +    VV+PM EY+M ++ L+EF+++D    + RTVRQF F EWP+ G P+ A + F++F+ QVH T  QFG  GPITVHC +G GRT VF+ALSI L+R++ E V+D+F  V+ LR +R NM+Q  EQY F YLAA +Y+ ++D+F
Sbjct: 1658 PSLPNNGNNMTTVSHPAVPIAELANHIERLRMNNNAGFQSEFESIETGQHFTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTATYGD--IEVTLLESVHLAHYTMRTMRL---------KMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQPSA----DQLSGIDMEFRHLTTLKWTSNRCTVANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYHLREFRISDINTREVRTVRQFHFMEWPDVGKPHTA-DHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYLAAYDNF 2247          

HSP 2 Score: 251.136 bits (640), Expect = 2.449e-66
Identity = 349/1447 (24.12%), Postives = 602/1447 (41.60%), Query Frame = 2
Query:  212 PAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGAS-LR-QQVQMDNNNDVVQCIAENHLGVDT-KSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQV--VGT-GSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIR-RNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHW---EVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSY--------------TLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSA-IDNWHIREVQDTPYY--LNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRL-DGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENI--LNEISNLKIWGTNISKDSATICWK------------------MNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLDQ-VKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQI--SHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPG-TPYYISSEFFPAPENIETKALNDYQIKVSWNF-PEKANQVTDLLSQVNGFHVQVSTNRDFPDGKITFKKIVGPFTSTVMEKIYPNHYFIRVQAIIRDKRIAEWSNIHTLTVFKSKYTERNIKGLNCIGQT-NSIKVTWEKPDDYTEIKS--FLIELSGYRKFRNIYGAYKIEKIKARTSRIEFFGE--EQSTYNYSIPNLEPNTNYDXXXXXXXXXXXXXXXXXXXXXCVT------LMEQPKSILSPMPVPLRKVSNEIILRLSRTNEILGMISHYYLIVSPIKETHVTPHDVNID--ETFTQTKNLKAMNSRYVAAQFTPALFRSKSYVDFVLGSNSPIESFH 4354
            PA +   P  +T      I   C+A GNP P+V +++NGK    D +R  I+S   G S LR ++V +D+N  VV C A+N +       A++TV+  + +VP GFP I   P     + GK A + C V  DP AKV W+++        + R+ V  +G  G+L I++ RE D G YEC+A N +G   S++  L ++ R +     Y  E++               V  G   NLTC A G P+P V W   ++ + +    +P   P+G      + + LT +  + ++ C A + +G I+    +I K+ P  P  +  S V + S VI W P K N  I+ Y               L  KD+  +D     R         +  + E+ + S  I  L A+  YE  V + +  +G    SLP+  QT    P++ P    A++++ DSI V W P  Q NG I GY++YYT  L +  I  W   + +   +   +N L  ++ Y+V+V A N  GD P+S    +    G          +P  P  L   +L +  +Q+ W  P  +    + GY ++Y   DG+++  +   H      ++++  L P K Y+  +A  +  G G   + TE    + I  +   S   +     S  S  I WK                    L++SK A    + Y    D S   S+  +  +++  +    +VL+ L P S Y++ V    +T D           SS   + T+++  VP  P   + ++ ++TS K++W  P       + YY+   R ++ +    K     + + + +    +E  L++L PN  Y   + A +R G G   + + I T G      +P E     SV +   + P  +   + W  P++  +   I  Y + +   G P+   + K V         T  S   + +  G  Y   + A N     + A      P   P   P  ++ +  K  + + W PP  + RNG IT YK     M       ++      T+     +     Y+FK+ A   +G GP+SP  T     +     P N+  +A ++    V W+F  +KA+          G  +     +  P   I  +    P    V+  +  +  +      +++ R    S+    TV +S      ++ L  + +T NS+++TWE    Y   ++  F +  +G + + N        +++ +T     FG+  ++    Y   NL P+  Y + + +        +   +    +T       ++ PK + S    P ++     ++RL+   E  G ISHY++I+ P    + T   VN+D  E    T   +A  +R ++   +  L R  S V    G +S   S+H
Sbjct:   91 PARLVVRPDSSTVVDESKISFFCRADGNPLPSVIWRVNGK-SITDHNRISIKSLATGLSTLRFERVSLDDNATVVSCSADNGVANPVVAEASLTVVPRD-KVPIGFPQIELHPSLKSVEQGKTAYVSCRVRGDPRAKVLWLRDLIPLDIRADGRYSVSTIGNPGALMIQHAREEDQGKYECIARNTLGVAHSKAANLYVKVRRVPPYFSYKLERQ-------------YVVGVGGNINLTCVAVGYPMPRVFWKKTDLMVLD----DPSTAPIG-----KNVLTLTHVESTENFTCVAVSALGNIEATTTVIAKELPPPPVNIVVSSVTSESVVITWKPPKYNEAINKYVVNYRLKSENKDDAALFAKDSRAEDESDSERYSEGR--SSRGKTMETLENSLVIDGLVAFQTYEFTVRS-AGPVGVGLESLPVEAQTKPSKPATAPVSPQARSLNRDSILVKWGPCEQPNGLITGYKVYYTNDLVTTPIREWKQHDAKSDEFMTTINGLEPDSRYFVRVIAQNSEGDSPLSTLVTVATRQG----------IPGQPPMLTVKALDSRRMQLTWDKP--LYSSPVVGYTVRYNTSDGEKELTLTSPH-----EKHVVTGLHPDKYYYFRVAAYSDRGQG---EFTEPMISKTIASIPLSSPTIVSAAATSSKSVEIRWKGPEQKKLNGVLTAYRINYFRLEDSKTANLESVEYDEDMDDS---SSFLDRMSVVVPSDATSYVLSDLLPYSSYEITVA--ASTMDG------YGPESSIRVVKTLED--VPSAPRNFNAELTSATSVKLTWDAPAAANGALLGYYVYLDRMVNGEPVVEKGSKKRIVMIRDSSKRYFE--LDSLDPNTEYSFRLNAFNRNGDGEFSERKSIITQG------IPPEAPEIVSVSLDRDEPP--VVARIEWKMPKMKPNETPIEKYNLWLRAQGYPDSYVKAKTVD-------GTDLSTTISGLWMGVVYDVLLAAENREGRSQNATETIATPVGSPDGEPIDVQYEVMKGKIVVSWRPPSEEKRNGNITSYKAILSAMDATADRYEQPVPAPSTSSTF-EVNVRRAYLFKVAAATMKGIGPYSPVLTINPDPAALVGPPTNVRVEATSNSTAVVQWDFESQKADSFVVKYMHEPGNRMDTEKWKQLPVVSIDKEN---PKRFAVVSDLNAHKPYAFCVLAVKNNRQGPCSD--PPTVLESVTPTYMVQNLRVLWKTSNSVQLTWE----YNGPRNVGFYVNHTGRKDYVN-------HELQEKTMSTPGFGQDVDEKHREYLWTNLRPHMMYTIHVGVRTLPPGARKYWPQEVVTITDPTGPPFVDVPKLVDSSGTQPGQQ-----MIRLTPATEEYGPISHYWIILVPAN--YSTEDVVNLDPIELEKATAEKRAQLARSLSVSPSKKLKRKASEV----GDDSQSASYH 1432          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Fly
Match: Lar (gene:FBgn0000464 transcript:FBtr0081260)

HSP 1 Score: 825.469 bits (2131), Expect = 0.000e+0
Identity = 382/593 (64.42%), Postives = 471/593 (79.43%), Query Frame = 2
Query: 4958 PPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSN--KDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            PPIP+    + I  L++NDN  FSQEYESI+PGQQFTW+NSNLE N++KNRYANV AYDHSR+ L  + GV+GSDYINANY DGY++ NAY+ATQGPL  TF DFWRM WE  TA+IVMMT+LEERTRIKCDQYWP +GTE+Y  G I VTIT+T+ELA Y+IRTF           + C     D+REI+Q QFTAWPDHGVPD+P P L FL+R RA  P  S P+IVHCSAGVGRTG +IVID+ LER++HE  +DI+G V+ +RAQRNYMVQTEDQY+F+H+ +L+A+    TEV  +N+ TH+QKL+    T   +  +G+E+EF+KLS  K ++++  +ANLP N+ KNRLV+ILPYE +R+ L PI G EGSDY+NAS+IDGY+   AYIA Q P+ +  EDFWRM+WEHNSTI+VMLTKL+EMGREKC +YWP ERS R+QY+VVDP+ EYNMP + L+EFKVTDARDG SRTVRQFQF +WPEQGVP ++ E FI+FIGQVHKTKEQFGQ+GPITVHCSAGVGR+GVF+ LSI LER++ EGVLD+FQ VR LR QR  MVQ+E+QY FCY AA +Y+ SFD++
Sbjct: 1452 PPIPISEFANHIERLKSNDNQKFSQEYESIEPGQQFTWDNSNLEHNKSKNRYANVTAYDHSRVQLPAVEGVVGSDYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWPTRGTETY--GQIFVTITETQELATYSIRTF-----------QLCRQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPESGPVIVHCSAGVGRTGCYIVIDSMLERMKHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAILEAIICGVTEVPARNLHTHLQKLL---ITEPGETISGMEVEFKKLSNVKMDSSKFVTANLPCNKHKNRLVHILPYESSRVYLTPIHGIEGSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRMLWEHNSTIVVMLTKLKEMGREKCFQYWPHERSVRYQYYVVDPIAEYNMPQYKLREFKVTDARDGSSRTVRQFQFIDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRSGVFITLSIVLERMQYEGVLDVFQTVRILRSQRPAMVQTEDQYHFCYRAALEYLGSFDNY 2027          

HSP 2 Score: 334.724 bits (857), Expect = 6.915e-92
Identity = 352/1357 (25.94%), Postives = 576/1357 (42.45%), Query Frame = 2
Query:  212 PAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR--QQVQMDNNNDVVQCIAENHLG-VDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMT----PQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENR-PLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPY-YLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSA--------QLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLDQ--VKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAIS---------LIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFG-ETARINYTIPEERPSAPPNKLEIQGEKKTV-TLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHV--QVSTNRDFPDGKITFKKIVGPFTSTVMEKIYPNHYFIRVQAIIRD--KRIAEWSNIHTLTVFKSKYTERNIKGLNCIGQTNSIKVTWEKPDDYTEIKSFLIELSGYRKFRNIYGAYKIEKIKARTSRIEFFGEEQSTYNYSIPNLEPNTNYDXXXXXXXXXXXXXXXXXXXXXCVTLMEQPKSILSPMPVPLRKVSN--EIILRLSRTNEILGMISHYYLIVSP 4174
            P  I   P +   + G      C A+G+P P++ ++ NGK  S    R  +     G S+   + V+   ++   +C+AEN +G   +  AT+T+ + + + PAGFP+IT GP   + + G    + C+   +P+  + WIKN   KVD +N R+ +   G L I+N RE D G YEC+A N +GT  S++  L           Y+K +  P T    P+ +      EV  G   NL+C A GSP+P V W   +       PEN  P+G      + + L +I ES +Y C A + +G I   + + V+  P APT V  S+V ATS  +EW   K    +  Y +  K  +       +  I  +Y+  + LS               YT YE  V+AV NNIG   PS P    T E    S P ++  + +S  ++ +TW+PP   NG++ GY++YYT        +W+ + V ++    ++ L  +A Y V+V AY   G GP+S    +    G          VP  P N R   +  T++ + WT P    ++ +  YEL +    D                Y +D L P   Y+I LA +++ G G +         Q        NI           T I+  S TI     L         RI Y  +F +   +   E  T  +  T     VL  L+  + Y +WV    +  D           S  + + T   + VP  P+ V    +NSTS  +SWK P++      ++ Y I  +EL ++ K         D+  +   NV       L P+  Y I+V A +RKG G      ++KT G   V       R T S+KI   +    +++ L W  P  ++G + GYR+            ++  P+  K     K + N+               G  Y F V   N +  G ET +I +  PE  P  PP+ + I+ +   V  + W PP  ++RNGIIT+Y +Q+   K+    L      +    + TNL+ENT Y+F++RA  K+G GP+S         +   AP +++ +A ++   ++ W   E       LL    G+ +   ++   D  D +     +        +EK     Y + + A  ++   R++E   +      K +    N++  +    T+S+ ++W  P   T + ++ I     + F +  G  + + +  R   ++ +        ++I  L P T Y+  + +               +  T M  P+ ++ P       V N  EI++ L + +E  G ISHYYL+V P
Sbjct:   35 PPEIIRKPQNQGVRVGGVASFYCAARGDPPPSIVWRKNGKKVSGTQSRYTVLEQPGGISILRIEPVRAGRDDAPYECVAENGVGDAVSADATLTIYEGD-KTPAGFPVITQGPGTRVIEVGHTVLMTCKAIGNPTPNIYWIKN-QTKVDMSNPRYSL-KDGFLQIENSREEDQGKYECVAENSMGTEHSKATNL-----------YVKVRRVPPTFSRPPETIS-----EVMLGSNLNLSCIAVGSPMPHVKW---MKGSEDLTPENEMPIG-----RNVLQLINIQESANYTCIAASTLGQIDSVSVVKVQSLPTAPTDVQISEVTATSVRLEW-SYKGPEDLQYYVIQYKPKNANQAFSEISGIITMYYVVRALS--------------PYTEYEFYVIAV-NNIGRGPPSAPATCTTGETKMESAPRNVQVRTLSSSTMVITWEPPETPNGQVTGYKVYYTTNSNQPEASWNSQMVDNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQG----------VPSQPSNFRATDIGETAVTLQWTKPTHSSENIVH-YELYW---NDTYANQAHHKRISNSEAYTLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYVPGAPPRNI-----------TAIATSSTTISLSW-LPPPVERSNGRIIYYKVFFVEVGREDDEATTMTLNMTSI---VLDELKRWTEYKIWVLAGTSVGDGP--------RSHPIILRT--QEDVPGDPQDVKATPLNSTSIHVSWKPPLEKDRNGIIRGYHIHAQELRDEGKGFLNEPFKFDVVDTLEFNV-----TGLQPDTKYSIQVAALTRKGDGDRSAAIVVKTPGGVPV-------RPTVSLKI--MEREPIVSIELEWERPAQTYGELRGYRLRWGVKDQALKEEMLSGPQMTK-----KRFDNLER-------------GVEYEFRVAGSNHIGIGQETVKI-FQTPEGTPGGPPSNITIRFQTPDVLCVTWDPPTREHRNGIITRYDVQFH--KKIDHGLGSERNMTLRKAVFTNLEENTEYIFRVRAYTKQGAGPFSDKLIVETERDMGRAPMSLQAEATSEQTAEIWW---EPVTSRGKLL----GYKIFYTMTAVEDLDDWQTKTVGLTESADLVNLEKF--AQYAVAIAARFKNGLGRLSEKVTVR----IKPEDVPLNLRAHDV--STHSMTLSWSPPIRLTPV-NYKISFDAMKVFVDSQGFSQTQIVPKREIILKHY-----VKTHTINELSPFTTYN--VNVSAIPSDYSYRPPTKITVTTQMAAPQPMVKP---DFYGVVNGEEILVILPQASEEYGPISHYYLVVVP 1248          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Fly
Match: Lar (gene:FBgn0000464 transcript:FBtr0331241)

HSP 1 Score: 825.083 bits (2130), Expect = 0.000e+0
Identity = 382/593 (64.42%), Postives = 471/593 (79.43%), Query Frame = 2
Query: 4958 PPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSN--KDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            PPIP+    + I  L++NDN  FSQEYESI+PGQQFTW+NSNLE N++KNRYANV AYDHSR+ L  + GV+GSDYINANY DGY++ NAY+ATQGPL  TF DFWRM WE  TA+IVMMT+LEERTRIKCDQYWP +GTE+Y  G I VTIT+T+ELA Y+IRTF           + C     D+REI+Q QFTAWPDHGVPD+P P L FL+R RA  P  S P+IVHCSAGVGRTG +IVID+ LER++HE  +DI+G V+ +RAQRNYMVQTEDQY+F+H+ +L+A+    TEV  +N+ TH+QKL+    T   +  +G+E+EF+KLS  K ++++  +ANLP N+ KNRLV+ILPYE +R+ L PI G EGSDY+NAS+IDGY+   AYIA Q P+ +  EDFWRM+WEHNSTI+VMLTKL+EMGREKC +YWP ERS R+QY+VVDP+ EYNMP + L+EFKVTDARDG SRTVRQFQF +WPEQGVP ++ E FI+FIGQVHKTKEQFGQ+GPITVHCSAGVGR+GVF+ LSI LER++ EGVLD+FQ VR LR QR  MVQ+E+QY FCY AA +Y+ SFD++
Sbjct: 1350 PPIPISEFANHIERLKSNDNQKFSQEYESIEPGQQFTWDNSNLEHNKSKNRYANVTAYDHSRVQLPAVEGVVGSDYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWPTRGTETY--GQIFVTITETQELATYSIRTF-----------QLCRQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPESGPVIVHCSAGVGRTGCYIVIDSMLERMKHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAILEAIICGVTEVPARNLHTHLQKLL---ITEPGETISGMEVEFKKLSNVKMDSSKFVTANLPCNKHKNRLVHILPYESSRVYLTPIHGIEGSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRMLWEHNSTIVVMLTKLKEMGREKCFQYWPHERSVRYQYYVVDPIAEYNMPQYKLREFKVTDARDGSSRTVRQFQFIDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRSGVFITLSIVLERMQYEGVLDVFQTVRILRSQRPAMVQTEDQYHFCYRAALEYLGSFDNY 1925          

HSP 2 Score: 248.054 bits (632), Expect = 2.447e-65
Identity = 282/1108 (25.45%), Postives = 463/1108 (41.79%), Query Frame = 2
Query:  212 PAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR--QQVQMDNNNDVVQCIAENHLG-VDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMT----PQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENR-PLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPY-YLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNL-----ITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINS---TSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKT-HGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISH--GLILGYRVAISLIGPPEFVKELKPVKIYRNVSTE---TYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQG-EKKTVTLKWHPPPIDYRNGIITKYKIQY-FDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFP 3460
            P  I   P +   + G      C A+G+P P++ ++ NGK  S    R  +     G S+   + V+   ++   +C+AEN +G   +  AT+T+ + + + PAGFP+IT GP   + + G    + C+   +P+  + WIKN   KVD +N R+  +  G L I+N RE D G YEC+A N +GT  S++  L           Y+K +  P T    P+ +      EV  G   NL+C A GSP+P V W   +       PEN  P+G      + + L +I ES +Y C A + +G I   + + V+  P APT V  S+V ATS  +EW   K    +  Y +  K  +       +  I  +Y+  + LS               YT YE  V+AV NNIG   PS P    T E+   S P ++  + +S  ++ +TW+PP   NG++ GY++YYT        +W+ + V ++    ++ L  +A Y V+V AY   G GP+S    +    G          VP  P N R   +  T++ + WT P    ++ +  YEL +    D                Y +D L P   Y+I LA +++ G G +         + +  +  ++K   T ++  S  + WK  L++ +  +     Y +     EL+   +   N      + DT      +T L+PD+ Y + V  +    D +         S+ + + T     VP +P  VS+K++      S ++ W+ P +T  +++ Y + W       K   +         S P    +   +NL     Y+  V  ++  G G  E  +I +T  G    P     +R         F+ P  L V   W+PP   H  G+I  Y V        +F K     KI   + +E   T +      +     Y+F V+A      G  +       E      P  L+ +   ++T  + W   P+  R G +  YKI Y     E +   +        +  + NL++   Y   I A  K G G  S      I  E  P   N+    ++ + + +SW+ P
Sbjct:   35 PPEIIRKPQNQGVRVGGVASFYCAARGDPPPSIVWRKNGKKVSGTQSRYTVLEQPGGISILRIEPVRAGRDDAPYECVAENGVGDAVSADATLTIYEGD-KTPAGFPVITQGPGTRVIEVGHTVLMTCKAIGNPTPNIYWIKN-QTKVDMSNPRYS-LKDGFLQIENSREEDQGKYECVAENSMGTEHSKATNL-----------YVKVRRVPPTFSRPPETIS-----EVMLGSNLNLSCIAVGSPMPHVKW---MKGSEDLTPENEMPIG-----RNVLQLINIQESANYTCIAASTLGQIDSVSVVKVQSLPTAPTDVQISEVTATSVRLEW-SYKGPEDLQYYVIQYKPKNANQAFSEISGIITMYYVVRALS--------------PYTEYEFYVIAV-NNIGRGPPSAPATC-TTEM--ESAPRNVQVRTLSSSTMVITWEPPETPNGQVTGYKVYYTTNSNQPEASWNSQMVDNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQG----------VPSQPSNFRATDIGETAVTLQWTKPTHSSENIVH-YELYW---NDTYANQAHHKRISNSEAYTLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYVPGDPQDVK--ATPLNSTSIHVSWKPPLEKDRNGIIR--GYHI--HAQELRDEGKGFLNEPFKFDVVDT--LEFNVTGLQPDTKYSIQVAALTRKGDGD--------RSAAIVVKT--PGGVPVRP-TVSLKIMEREPIVSIELEWERPAQTYGELRGYRLRWGVKDQALKEEML---------SGPQMTKKR-FDNLERGVEYEFRVAGSNHIGIGQ-ETVKIFQTPEGTPGGPPSNITIR---------FQTPDVLCV--TWDPPTREHRNGIITRYDV--------QFHK-----KIDHGLGSERNMTLRKAVFTNLEENTEYIFRVRAYTKQGAGPFSDKLIVETERDMGRAPMSLQAEATSEQTAEIWWE--PVTSR-GKLLGYKIFYTMTAVEDLDDWQTKTVGLTESADLVNLEKFAQYAVAIAARFKNGLGRLSEKVTVRIKPEDVPL--NLRAHDVSTHSMTLSWSPP 1023          

HSP 3 Score: 54.299 bits (129), Expect = 1.901e-6
Identity = 63/273 (23.08%), Postives = 107/273 (39.19%), Query Frame = 2
Query: 2846 PPQISHGLILGYRVAISLIG---PPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQ------ALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQVSTNRDFPDGKITFKKIVGPFTSTVMEKIYPNHYFIRVQA 3637
            PP+    ++LG  + +S I    P   VK +K         +E    + E  IG     L  +Q       + +   G+   ++    +  P+AP +    +    +V L+W      Y+     +Y +  +  K       E         ++  L   T Y F + AVN  G GP  P  P   ++E   AP N++ + L+   + ++W  PE  N       QV G+ V  +TN + P+     + +     +TV E      Y +RVQA
Sbjct:  239 PPETISEVMLGSNLNLSCIAVGSPMPHVKWMK--------GSEDLTPENEMPIGRNVLQLINIQESANYTCIAASTLGQIDSVSVVKVQSLPTAPTDVQISEVTATSVRLEW-----SYKGPEDLQYYVIQYKPKNANQAFSEISGIITMYYVVRALSPYTEYEFYVIAVNNIGRGP--PSAPATCTTEMESAPRNVQVRTLSSSTMVITWEPPETPN------GQVTGYKVYYTTNSNQPEASWNSQMVDNSELTTVSELTPHAIYTVRVQA 490          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Fly
Match: Lar (gene:FBgn0000464 transcript:FBtr0112800)

HSP 1 Score: 825.083 bits (2130), Expect = 0.000e+0
Identity = 382/593 (64.42%), Postives = 471/593 (79.43%), Query Frame = 2
Query: 4958 PPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSN--KDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            PPIP+    + I  L++NDN  FSQEYESI+PGQQFTW+NSNLE N++KNRYANV AYDHSR+ L  + GV+GSDYINANY DGY++ NAY+ATQGPL  TF DFWRM WE  TA+IVMMT+LEERTRIKCDQYWP +GTE+Y  G I VTIT+T+ELA Y+IRTF           + C     D+REI+Q QFTAWPDHGVPD+P P L FL+R RA  P  S P+IVHCSAGVGRTG +IVID+ LER++HE  +DI+G V+ +RAQRNYMVQTEDQY+F+H+ +L+A+    TEV  +N+ TH+QKL+    T   +  +G+E+EF+KLS  K ++++  +ANLP N+ KNRLV+ILPYE +R+ L PI G EGSDY+NAS+IDGY+   AYIA Q P+ +  EDFWRM+WEHNSTI+VMLTKL+EMGREKC +YWP ERS R+QY+VVDP+ EYNMP + L+EFKVTDARDG SRTVRQFQF +WPEQGVP ++ E FI+FIGQVHKTKEQFGQ+GPITVHCSAGVGR+GVF+ LSI LER++ EGVLD+FQ VR LR QR  MVQ+E+QY FCY AA +Y+ SFD++
Sbjct: 1434 PPIPISEFANHIERLKSNDNQKFSQEYESIEPGQQFTWDNSNLEHNKSKNRYANVTAYDHSRVQLPAVEGVVGSDYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWPTRGTETY--GQIFVTITETQELATYSIRTF-----------QLCRQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPESGPVIVHCSAGVGRTGCYIVIDSMLERMKHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAILEAIICGVTEVPARNLHTHLQKLL---ITEPGETISGMEVEFKKLSNVKMDSSKFVTANLPCNKHKNRLVHILPYESSRVYLTPIHGIEGSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRMLWEHNSTIVVMLTKLKEMGREKCFQYWPHERSVRYQYYVVDPIAEYNMPQYKLREFKVTDARDGSSRTVRQFQFIDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRSGVFITLSIVLERMQYEGVLDVFQTVRILRSQRPAMVQTEDQYHFCYRAALEYLGSFDNY 2009          

HSP 2 Score: 334.339 bits (856), Expect = 9.449e-92
Identity = 352/1358 (25.92%), Postives = 577/1358 (42.49%), Query Frame = 2
Query:  209 SPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR--QQVQMDNNNDVVQCIAENHLG-VDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMT----PQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENR-PLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPY-YLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSA--------QLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLDQ--VKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAIS---------LIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFG-ETARINYTIPEERPSAPPNKLEIQGEKKTV-TLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHV--QVSTNRDFPDGKITFKKIVGPFTSTVMEKIYPNHYFIRVQAIIRD--KRIAEWSNIHTLTVFKSKYTERNIKGLNCIGQTNSIKVTWEKPDDYTEIKSFLIELSGYRKFRNIYGAYKIEKIKARTSRIEFFGEEQSTYNYSIPNLEPNTNYDXXXXXXXXXXXXXXXXXXXXXCVTLMEQPKSILSPMPVPLRKVSN--EIILRLSRTNEILGMISHYYLIVSP 4174
            +P  I   P +   + G      C A+G+P P++ ++ NGK  S    R  +     G S+   + V+   ++   +C+AEN +G   +  AT+T+ + + + PAGFP+IT GP   + + G    + C+   +P+  + WIKN   KVD +N R+ +   G L I+N RE D G YEC+A N +GT  S++  L           Y+K +  P T    P+ +      EV  G   NL+C A GSP+P V W   +       PEN  P+G      + + L +I ES +Y C A + +G I   + + V+  P APT V  S+V ATS  +EW   K    +  Y +  K  +       +  I  +Y+  + LS               YT YE  V+AV NNIG   PS P    T E    S P ++  + +S  ++ +TW+PP   NG++ GY++YYT        +W+ + V ++    ++ L  +A Y V+V AY   G GP+S    +    G          VP  P N R   +  T++ + WT P    ++ +  YEL +    D                Y +D L P   Y+I LA +++ G G +         Q        NI           T I+  S TI     L         RI Y  +F +   +   E  T  +  T     VL  L+  + Y +WV    +  D           S  + + T   + VP  P+ V    +NSTS  +SWK P++      ++ Y I  +EL ++ K         D+  +   NV       L P+  Y I+V A +RKG G      ++KT G   V       R T S+KI   +    +++ L W  P  ++G + GYR+            ++  P+  K     K + N+               G  Y F V   N +  G ET +I +  PE  P  PP+ + I+ +   V  + W PP  ++RNGIIT+Y +Q+   K+    L      +    + TNL+ENT Y+F++RA  K+G GP+S         +   AP +++ +A ++   ++ W   E       LL    G+ +   ++   D  D +     +        +EK     Y + + A  ++   R++E   +      K +    N++  +    T+S+ ++W  P   T + ++ I     + F +  G  + + +  R   ++ +        ++I  L P T Y+  + +               +  T M  P+ ++ P       V N  EI++ L + +E  G ISHYYL+V P
Sbjct:   16 NPPEIIRKPQNQGVRVGGVASFYCAARGDPPPSIVWRKNGKKVSGTQSRYTVLEQPGGISILRIEPVRAGRDDAPYECVAENGVGDAVSADATLTIYEGD-KTPAGFPVITQGPGTRVIEVGHTVLMTCKAIGNPTPNIYWIKN-QTKVDMSNPRYSL-KDGFLQIENSREEDQGKYECVAENSMGTEHSKATNL-----------YVKVRRVPPTFSRPPETIS-----EVMLGSNLNLSCIAVGSPMPHVKW---MKGSEDLTPENEMPIG-----RNVLQLINIQESANYTCIAASTLGQIDSVSVVKVQSLPTAPTDVQISEVTATSVRLEW-SYKGPEDLQYYVIQYKPKNANQAFSEISGIITMYYVVRALS--------------PYTEYEFYVIAV-NNIGRGPPSAPATCTTGETKMESAPRNVQVRTLSSSTMVITWEPPETPNGQVTGYKVYYTTNSNQPEASWNSQMVDNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQG----------VPSQPSNFRATDIGETAVTLQWTKPTHSSENIVH-YELYW---NDTYANQAHHKRISNSEAYTLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYVPGAPPRNI-----------TAIATSSTTISLSW-LPPPVERSNGRIIYYKVFFVEVGREDDEATTMTLNMTSI---VLDELKRWTEYKIWVLAGTSVGDGP--------RSHPIILRT--QEDVPGDPQDVKATPLNSTSIHVSWKPPLEKDRNGIIRGYHIHAQELRDEGKGFLNEPFKFDVVDTLEFNV-----TGLQPDTKYSIQVAALTRKGDGDRSAAIVVKTPGGVPV-------RPTVSLKI--MEREPIVSIELEWERPAQTYGELRGYRLRWGVKDQALKEEMLSGPQMTK-----KRFDNLER-------------GVEYEFRVAGSNHIGIGQETVKI-FQTPEGTPGGPPSNITIRFQTPDVLCVTWDPPTREHRNGIITRYDVQFH--KKIDHGLGSERNMTLRKAVFTNLEENTEYIFRVRAYTKQGAGPFSDKLIVETERDMGRAPMSLQAEATSEQTAEIWW---EPVTSRGKLL----GYKIFYTMTAVEDLDDWQTKTVGLTESADLVNLEKF--AQYAVAIAARFKNGLGRLSEKVTVR----IKPEDVPLNLRAHDV--STHSMTLSWSPPIRLTPV-NYKISFDAMKVFVDSQGFSQTQIVPKREIILKHY-----VKTHTINELSPFTTYN--VNVSAIPSDYSYRPPTKITVTTQMAAPQPMVKP---DFYGVVNGEEILVILPQASEEYGPISHYYLVVVP 1230          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Fly
Match: Lar (gene:FBgn0000464 transcript:FBtr0331240)

HSP 1 Score: 825.083 bits (2130), Expect = 0.000e+0
Identity = 382/593 (64.42%), Postives = 471/593 (79.43%), Query Frame = 2
Query: 4958 PPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSN--KDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            PPIP+    + I  L++NDN  FSQEYESI+PGQQFTW+NSNLE N++KNRYANV AYDHSR+ L  + GV+GSDYINANY DGY++ NAY+ATQGPL  TF DFWRM WE  TA+IVMMT+LEERTRIKCDQYWP +GTE+Y  G I VTIT+T+ELA Y+IRTF           + C     D+REI+Q QFTAWPDHGVPD+P P L FL+R RA  P  S P+IVHCSAGVGRTG +IVID+ LER++HE  +DI+G V+ +RAQRNYMVQTEDQY+F+H+ +L+A+    TEV  +N+ TH+QKL+    T   +  +G+E+EF+KLS  K ++++  +ANLP N+ KNRLV+ILPYE +R+ L PI G EGSDY+NAS+IDGY+   AYIA Q P+ +  EDFWRM+WEHNSTI+VMLTKL+EMGREKC +YWP ERS R+QY+VVDP+ EYNMP + L+EFKVTDARDG SRTVRQFQF +WPEQGVP ++ E FI+FIGQVHKTKEQFGQ+GPITVHCSAGVGR+GVF+ LSI LER++ EGVLD+FQ VR LR QR  MVQ+E+QY FCY AA +Y+ SFD++
Sbjct: 1358 PPIPISEFANHIERLKSNDNQKFSQEYESIEPGQQFTWDNSNLEHNKSKNRYANVTAYDHSRVQLPAVEGVVGSDYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWPTRGTETY--GQIFVTITETQELATYSIRTF-----------QLCRQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPESGPVIVHCSAGVGRTGCYIVIDSMLERMKHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAILEAIICGVTEVPARNLHTHLQKLL---ITEPGETISGMEVEFKKLSNVKMDSSKFVTANLPCNKHKNRLVHILPYESSRVYLTPIHGIEGSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRMLWEHNSTIVVMLTKLKEMGREKCFQYWPHERSVRYQYYVVDPIAEYNMPQYKLREFKVTDARDGSSRTVRQFQFIDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRSGVFITLSIVLERMQYEGVLDVFQTVRILRSQRPAMVQTEDQYHFCYRAALEYLGSFDNY 1933          

HSP 2 Score: 246.128 bits (627), Expect = 8.919e-65
Identity = 281/1113 (25.25%), Postives = 462/1113 (41.51%), Query Frame = 2
Query:  212 PAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR--QQVQMDNNNDVVQCIAENHLG-VDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMT----PQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENR-PLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELP-----PSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPY-YLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNL-----ITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINS---TSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKT-HGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISH--GLILGYRVAISLIGPPEFVKELKPVKIYRNVSTE---TYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQG-EKKTVTLKWHPPPIDYRNGIITKYKIQY-FDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFP 3460
            P  I   P +   + G      C A+G+P P++ ++ NGK  S    R  +     G S+   + V+   ++   +C+AEN +G   +  AT+T+ + + + PAGFP+IT GP   + + G    + C+   +P+  + WIKN   KVD +N R+  +  G L I+N RE D G YEC+A N +GT  S++  L           Y+K +  P T    P+ +      EV  G   NL+C A GSP+P V W   +       PEN  P+G      + + L +I ES +Y C A + +G I   + + V+  P APT V  S+V ATS  +EW   K    +  Y +  K  +       +  I  +Y+  + LS               YT YE  V+AV NNIG   PS P    T +         S P ++  + +S  ++ +TW+PP   NG++ GY++YYT        +W+ + V ++    ++ L  +A Y V+V AY   G GP+S    +    G          VP  P N R   +  T++ + WT P    ++ +  YEL +    D                Y +D L P   Y+I LA +++ G G +         + +  +  ++K   T ++  S  + WK  L++ +  +     Y +     EL+   +   N      + DT      +T L+PD+ Y + V  +    D +         S+ + + T     VP +P  VS+K++      S ++ W+ P +T  +++ Y + W       K   +         S P    +   +NL     Y+  V  ++  G G  E  +I +T  G    P     +R         F+ P  L V   W+PP   H  G+I  Y V        +F K     KI   + +E   T +      +     Y+F V+A      G  +       E      P  L+ +   ++T  + W   P+  R G +  YKI Y     E +   +        +  + NL++   Y   I A  K G G  S      I  E  P   N+    ++ + + +SW+ P
Sbjct:   35 PPEIIRKPQNQGVRVGGVASFYCAARGDPPPSIVWRKNGKKVSGTQSRYTVLEQPGGISILRIEPVRAGRDDAPYECVAENGVGDAVSADATLTIYEGD-KTPAGFPVITQGPGTRVIEVGHTVLMTCKAIGNPTPNIYWIKN-QTKVDMSNPRYS-LKDGFLQIENSREEDQGKYECVAENSMGTEHSKATNL-----------YVKVRRVPPTFSRPPETIS-----EVMLGSNLNLSCIAVGSPMPHVKW---MKGSEDLTPENEMPIG-----RNVLQLINIQESANYTCIAASTLGQIDSVSVVKVQSLPTAPTDVQISEVTATSVRLEW-SYKGPEDLQYYVIQYKPKNANQAFSEISGIITMYYVVRALS--------------PYTEYEFYVIAV-NNIGRGPPSAPATCTTGDFSFGGTKMESAPRNVQVRTLSSSTMVITWEPPETPNGQVTGYKVYYTTNSNQPEASWNSQMVDNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQG----------VPSQPSNFRATDIGETAVTLQWTKPTHSSENIVH-YELYW---NDTYANQAHHKRISNSEAYTLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYVPGDPQDVK--ATPLNSTSIHVSWKPPLEKDRNGIIR--GYHI--HAQELRDEGKGFLNEPFKFDVVDT--LEFNVTGLQPDTKYSIQVAALTRKGDGD--------RSAAIVVKT--PGGVPVRP-TVSLKIMEREPIVSIELEWERPAQTYGELRGYRLRWGVKDQALKEEML---------SGPQMTKKR-FDNLERGVEYEFRVAGSNHIGIGQ-ETVKIFQTPEGTPGGPPSNITIR---------FQTPDVLCV--TWDPPTREHRNGIITRYDV--------QFHK-----KIDHGLGSERNMTLRKAVFTNLEENTEYIFRVRAYTKQGAGPFSDKLIVETERDMGRAPMSLQAEATSEQTAEIWWE--PVTSR-GKLLGYKIFYTMTAVEDLDDWQTKTVGLTESADLVNLEKFAQYAVAIAARFKNGLGRLSEKVTVRIKPEDVPL--NLRAHDVSTHSMTLSWSPP 1031          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Fly
Match: Lar (gene:FBgn0000464 transcript:FBtr0331242)

HSP 1 Score: 824.698 bits (2129), Expect = 0.000e+0
Identity = 382/593 (64.42%), Postives = 471/593 (79.43%), Query Frame = 2
Query: 4958 PPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSN--KDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            PPIP+    + I  L++NDN  FSQEYESI+PGQQFTW+NSNLE N++KNRYANV AYDHSR+ L  + GV+GSDYINANY DGY++ NAY+ATQGPL  TF DFWRM WE  TA+IVMMT+LEERTRIKCDQYWP +GTE+Y  G I VTIT+T+ELA Y+IRTF           + C     D+REI+Q QFTAWPDHGVPD+P P L FL+R RA  P  S P+IVHCSAGVGRTG +IVID+ LER++HE  +DI+G V+ +RAQRNYMVQTEDQY+F+H+ +L+A+    TEV  +N+ TH+QKL+    T   +  +G+E+EF+KLS  K ++++  +ANLP N+ KNRLV+ILPYE +R+ L PI G EGSDY+NAS+IDGY+   AYIA Q P+ +  EDFWRM+WEHNSTI+VMLTKL+EMGREKC +YWP ERS R+QY+VVDP+ EYNMP + L+EFKVTDARDG SRTVRQFQF +WPEQGVP ++ E FI+FIGQVHKTKEQFGQ+GPITVHCSAGVGR+GVF+ LSI LER++ EGVLD+FQ VR LR QR  MVQ+E+QY FCY AA +Y+ SFD++
Sbjct: 1364 PPIPISEFANHIERLKSNDNQKFSQEYESIEPGQQFTWDNSNLEHNKSKNRYANVTAYDHSRVQLPAVEGVVGSDYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWPTRGTETY--GQIFVTITETQELATYSIRTF-----------QLCRQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPESGPVIVHCSAGVGRTGCYIVIDSMLERMKHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAILEAIICGVTEVPARNLHTHLQKLL---ITEPGETISGMEVEFKKLSNVKMDSSKFVTANLPCNKHKNRLVHILPYESSRVYLTPIHGIEGSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRMLWEHNSTIVVMLTKLKEMGREKCFQYWPHERSVRYQYYVVDPIAEYNMPQYKLREFKVTDARDGSSRTVRQFQFIDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRSGVFITLSIVLERMQYEGVLDVFQTVRILRSQRPAMVQTEDQYHFCYRAALEYLGSFDNY 1939          

HSP 2 Score: 247.669 bits (631), Expect = 2.669e-65
Identity = 282/1108 (25.45%), Postives = 463/1108 (41.79%), Query Frame = 2
Query:  212 PAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR--QQVQMDNNNDVVQCIAENHLG-VDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMT----PQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENR-PLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPY-YLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNL-----ITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINS---TSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKT-HGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISH--GLILGYRVAISLIGPPEFVKELKPVKIYRNVSTE---TYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQG-EKKTVTLKWHPPPIDYRNGIITKYKIQY-FDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFP 3460
            P  I   P +   + G      C A+G+P P++ ++ NGK  S    R  +     G S+   + V+   ++   +C+AEN +G   +  AT+T+ + + + PAGFP+IT GP   + + G    + C+   +P+  + WIKN   KVD +N R+  +  G L I+N RE D G YEC+A N +GT  S++  L           Y+K +  P T    P+ +      EV  G   NL+C A GSP+P V W   +       PEN  P+G      + + L +I ES +Y C A + +G I   + + V+  P APT V  S+V ATS  +EW   K    +  Y +  K  +       +  I  +Y+  + LS               YT YE  V+AV NNIG   PS P    T E+   S P ++  + +S  ++ +TW+PP   NG++ GY++YYT        +W+ + V ++    ++ L  +A Y V+V AY   G GP+S    +    G          VP  P N R   +  T++ + WT P    ++ +  YEL +    D                Y +D L P   Y+I LA +++ G G +         + +  +  ++K   T ++  S  + WK  L++ +  +     Y +     EL+   +   N      + DT      +T L+PD+ Y + V  +    D +         S+ + + T     VP +P  VS+K++      S ++ W+ P +T  +++ Y + W       K   +         S P    +   +NL     Y+  V  ++  G G  E  +I +T  G    P     +R         F+ P  L V   W+PP   H  G+I  Y V        +F K     KI   + +E   T +      +     Y+F V+A      G  +       E      P  L+ +   ++T  + W   P+  R G +  YKI Y     E +   +        +  + NL++   Y   I A  K G G  S      I  E  P   N+    ++ + + +SW+ P
Sbjct:   49 PPEIIRKPQNQGVRVGGVASFYCAARGDPPPSIVWRKNGKKVSGTQSRYTVLEQPGGISILRIEPVRAGRDDAPYECVAENGVGDAVSADATLTIYEGD-KTPAGFPVITQGPGTRVIEVGHTVLMTCKAIGNPTPNIYWIKN-QTKVDMSNPRYS-LKDGFLQIENSREEDQGKYECVAENSMGTEHSKATNL-----------YVKVRRVPPTFSRPPETIS-----EVMLGSNLNLSCIAVGSPMPHVKW---MKGSEDLTPENEMPIG-----RNVLQLINIQESANYTCIAASTLGQIDSVSVVKVQSLPTAPTDVQISEVTATSVRLEW-SYKGPEDLQYYVIQYKPKNANQAFSEISGIITMYYVVRALS--------------PYTEYEFYVIAV-NNIGRGPPSAPATC-TTEM--ESAPRNVQVRTLSSSTMVITWEPPETPNGQVTGYKVYYTTNSNQPEASWNSQMVDNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQG----------VPSQPSNFRATDIGETAVTLQWTKPTHSSENIVH-YELYW---NDTYANQAHHKRISNSEAYTLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYVPGDPQDVK--ATPLNSTSIHVSWKPPLEKDRNGIIR--GYHI--HAQELRDEGKGFLNEPFKFDVVDT--LEFNVTGLQPDTKYSIQVAALTRKGDGD--------RSAAIVVKT--PGGVPVRP-TVSLKIMEREPIVSIELEWERPAQTYGELRGYRLRWGVKDQALKEEML---------SGPQMTKKR-FDNLERGVEYEFRVAGSNHIGIGQ-ETVKIFQTPEGTPGGPPSNITIR---------FQTPDVLCV--TWDPPTREHRNGIITRYDV--------QFHK-----KIDHGLGSERNMTLRKAVFTNLEENTEYIFRVRAYTKQGAGPFSDKLIVETERDMGRAPMSLQAEATSEQTAEIWWE--PVTSR-GKLLGYKIFYTMTAVEDLDDWQTKTVGLTESADLVNLEKFAQYAVAIAARFKNGLGRLSEKVTVRIKPEDVPL--NLRAHDVSTHSMTLSWSPP 1037          

HSP 3 Score: 54.299 bits (129), Expect = 1.886e-6
Identity = 63/273 (23.08%), Postives = 107/273 (39.19%), Query Frame = 2
Query: 2846 PPQISHGLILGYRVAISLIG---PPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQ------ALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQVSTNRDFPDGKITFKKIVGPFTSTVMEKIYPNHYFIRVQA 3637
            PP+    ++LG  + +S I    P   VK +K         +E    + E  IG     L  +Q       + +   G+   ++    +  P+AP +    +    +V L+W      Y+     +Y +  +  K       E         ++  L   T Y F + AVN  G GP  P  P   ++E   AP N++ + L+   + ++W  PE  N       QV G+ V  +TN + P+     + +     +TV E      Y +RVQA
Sbjct:  253 PPETISEVMLGSNLNLSCIAVGSPMPHVKWMK--------GSEDLTPENEMPIGRNVLQLINIQESANYTCIAASTLGQIDSVSVVKVQSLPTAPTDVQISEVTATSVRLEW-----SYKGPEDLQYYVIQYKPKNANQAFSEISGIITMYYVVRALSPYTEYEFYVIAVNNIGRGP--PSAPATCTTEMESAPRNVQVRTLSSSTMVITWEPPETPN------GQVTGYKVYYTTNSNQPEASWNSQMVDNSELTTVSELTPHAIYTVRVQA 504          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Zebrafish
Match: ptprsa (protein tyrosine phosphatase receptor type Sa [Source:ZFIN;Acc:ZDB-GENE-020107-3])

HSP 1 Score: 870.537 bits (2248), Expect = 0.000e+0
Identity = 399/624 (63.94%), Postives = 497/624 (79.65%), Query Frame = 2
Query: 4859 PMFEQRSLELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            P      +E+++I N Q P ++ +         PPIP+  L      L+ANDN   SQEYESIDPGQQFTWE+SNLE+N+ KNRYANVIAYDHSR++L  I G+ GSDYIN+NYIDGY++ NAYIATQGPL  TFGDFWRMVWEQ  A++VMMT+LEE++RIKCDQYWP++GTE+Y  G I VT+ DT ELA + +RTF +  N SS         +KRE+RQ+QFTAWPDHGVP+ P P L FL+R++  NP  + PII HCSAGVGRTG FIVID  LERI+HE TVDI+G V++MR+QRNYMVQTEDQY F+H+ +L+AV   NTEV+ +++ +++QKL + +     +  +G+ELEF++L+  K + +R  SANLP N+ KNRLVNI+PYE  R+CLQPIRG EGSDYIN+S+IDGY+  KAYIATQ PL ET EDFWRM+WE+NSTI+VMLTKLREMGREKCH+YWP ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRTVRQFQFT+WPEQGVP ++ E FI+FIGQVHKTKEQFGQ+GPI+VHCSAGVGRTGVF+ LSI LER++ EGV+D+FQ V+ LR QR  MVQ+E++Y+FCY AA +Y+ SFD +
Sbjct: 1197 PHHPTDPVEMRRI-NFQTPGMMNH---------PPIPISELAEHTELLKANDNLKLSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVILAPIEGITGSDYINSNYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRAATVVMMTRLEEKSRIKCDQYWPSRGTETY--GMIQVTLLDTIELATFCVRTFSLHKNGSS---------EKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIIAHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVAARSLFSYIQKLAQVEAG---EHVSGMELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINSSFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFDHY 1795          

HSP 2 Score: 296.204 bits (757), Expect = 4.692e-80
Identity = 269/997 (26.98%), Postives = 437/997 (43.83%), Query Frame = 2
Query:  506 VPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSN--NERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQP-SSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNP-PIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPY-YLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGV-SAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKG--PMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQ-ISHGL-ILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKT---VTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNF 3457
            +P GFP I  GP   + +  + A + C  S +P  ++TW K+    +D N  N R + + +G+L I+N  ETD G YEC+A+N  G   S    L           Y++ +  P  P+     +  E+  G   N+TC A GSP+P V W +        N E+    DE P   + + L  + ES +Y C A + +G+I+  AQI VK  P  P     ++  ATS  I W     NP P+  Y +  +    K P      + ++               + I  L   T+YE++V A  N IG   PS P+  +T E  P+SPP ++ A+ IS +++ V W  P + NG+IKGYR+YYT      +  W I  VQD+    + +L+ + TY ++V A+   GDGP SD   + V+ G          VP  P N +   +S T +++ W  PA  +   +  YEL Y+   D  G + K+   P  + +++D L+P   Y  SLA  +  G+G  +  L +TT          ++K   ++ S     + W+    ES+        Y++ + +  + + +E +T  +        +L  L   + Y + V           +  +     S+  +   D D     P  V ++V+NST+ K+ W+   P K   Q++ Y + +  + N    S+   +  D+  ++     E ++  L P+  Y I V A + KG G+  K +++ T G    P      + ++S  I            + W PP  ++ GL + GYR+           K++ P+        E   S   + I  G TY+F+V A +   FGE A     +PEE P   P   E  G   T   V   W PP +  RNG IT+Y + Y +        +      + + ++ +L+ N  Y  KIRA    G GP+SP   Y   +     P N   K +    + +SW F
Sbjct:   23 LPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKD-FLPIDPNTSNGRIKQLRSGALQIENTEETDQGKYECVASNVEGVRYSSPANL-----------YVRVRRVP--PRFSILPTSQEIMPGGSVNITCVAVGSPMPYVKWML--------NSEDLTPEDEMPVGRNVLELNSVRESANYTCVAMSSLGIIETVAQITVKSLPKPPGTPVVTETTATSITITW--DSGNPEPVSHYIIQYR---AKSPESKFETVDSI-----------TTTRYSIGGLSPNTDYEIRVSAF-NTIGQGPPSEPVEARTGEQAPASPPRNIQARIISQNTVLVRWDEPDEPNGQIKGYRVYYTMDPTLPMSMWQIHNVQDSVLTTIQSLVTSETYTIRVLAFTSVGDGPFSDPIHVKVLQG----------VPGQPTNFQVGEVSDTGVELTW-EPAF-EKEGIISYELHYKEGKD--GPLGKKKFAP-TSSFVVDGLRPNTEYFFSLAAVSSKGIGAFTNDLAQTTSQAKPSAPPQDIKC--SSSSSTVLMVSWRPPPAESQNG--ELAGYIVRYAV--VGAGAEVSTEHVEAPTSDQILLQRLEKWTMYRVTVA---------ASTSVGSGPESEPLLCRTDEDVPGAPPRRVEVEVLNSTAIKVMWRSLLPGKQHGQIRGYQVHYVRVEN--GESRGLPLIKDVMLADAQ---EMVIGGLQPDTTYSITVAAYTTKGDGARSKPKLVLTKGAVPGPPFLSVNQNSESTAI------------IRWQPPDYVAPGLEVQGYRLQFGR-------KDVNPLATLEFGPQELEYSI--SNIHRGATYIFKVSAKSKSGFGEEATQELRVPEEVPRGYPQITE--GSNITCCSVQFSWLPPVLAERNGAITEYTLSYQEAGTISGPKELRLPADENSYILNSLRPNAVYDVKIRAHTSVGPGPYSPPIQYRTVAYEADVPRNFTVKLVTKTTVLLSWKF 922          

HSP 3 Score: 93.9745 bits (232), Expect = 2.212e-18
Identity = 228/1060 (21.51%), Postives = 418/1060 (39.43%), Query Frame = 2
Query:  272 LICKAQGNPKPTVQ-FKINGKVQSNDSHRKIIRSFDFGASLRQQVQMDNNNDVVQ----CIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCH--AKNKMGLIKKEAQIIVKKKPMAPTL----VSYSKVEATSAVIEW-LPVKSNPPIDSYTLLIKDTSNKDPHL--GLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPV-PQNLRGASLSTTSIQIMWT-HPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIE-PYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALT--HRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGP--MKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVP-SMPREL-RMTQSVKIPSFKGPKRLAVYLAWNPPQIS--HGLI----LGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKI----GPGKTYLFEVQALNSVNFGE-TARINYTIPEERPSAPPNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGP 3349
            ++C A GNP P +  FK    +  N S+ + I+    GA     +Q++N  +  Q    C+A N  GV   S     +     VP  F I+   P       G    I C     P   V W+ NS    D   E    VG   L + +VRE+   +Y C+A + +G +I     + ++             + P TP + +       +T     +T ++ G+P P+ H+ +Q     + +PE++    +  +++   +  ++ +  Y     A N +G       +  +    AP      +    +   + ++ W  P + N  I  Y +        DP L   + QI N+             V   I  L     Y ++V+A + ++G+   S PI  + L+  P   PT+     +S   +++TW+P  ++ G I  Y L+Y E     +          + + ++ L  N  Y+  + A +  G G  ++          D  +T   + P   PQ+++ +S S+T + + W   PA   + +L GY ++Y + G    ++  EH+E P   Q L+  L+    Y +++A  T  G G  ++      DE++       ++    ++  +  + W+  L   +      +++ Y+ + +  E +        ++ D Q    V+  L+PD+ Y + V       D          +  KL ++     +VP  P  +S+   + +++ I W+ P  +    +V+ Y +++          K  N    + +  P  + E+ ++N+     Y  +V A S+ G G     E+       +VP  +PR   ++T+   I         +V  +W PP ++  +G I    L Y+ A ++ GP    KEL+              +DE + I     P   Y  +++A  SV  G  +  I Y         P N       K TV L W      Y +    K  I+Y   K  +           T  +ITNL+ NT Y F+I   +    GP
Sbjct:   47 MLCAASGNPDPEITWFKDFLPIDPNTSNGR-IKQLRSGA-----LQIENTEETDQGKYECVASNVEGVRYSSPANLYVRVR-RVPPRFSIL---PTSQEIMPGGSVNITCVAVGSPMPYVKWMLNSE---DLTPEDEMPVGRNVLELNSVRES--ANYTCVAMSSLG-IIETVAQITVK----------SLPKPPGTPVVTE-------TTATSITITWDS-GNPEPVSHYIIQY---RAKSPESKFETVDSITTTRYSIGGLSPNTDYEIRVSAFNTIGQGPPSEPVEARTGEQAPASPPRNIQARIISQNTVLVRWDEPDEPNGQIKGYRVYY----TMDPTLPMSMWQIHNV----------QDSVLTTIQSLVTSETYTIRVLAFT-SVGDGPFSDPIHVKVLQGVPGQ-PTNFQVGEVSDTGVELTWEPAFEKEG-IISYELHYKEGKDGPLGKKKF--APTSSFVVDGLRPNTEYFFSLAAVSSKGIGAFTN----------DLAQTTSQAKPSAPPQDIKCSSSSSTVLMVSWRPPPAESQNGELAGYIVRYAVVG-AGAEVSTEHVEAPTSDQILLQRLEKWTMYRVTVAASTSVGSGPESEPLLCRTDEDVPGAPPR-RVEVEVLNSTAIKVMWRSLLPGKQHGQIRGYQVHYVRV-ENGESRGLPLIKDVMLADAQEM--VIGGLQPDTTYSITVAAYTTKGDGA-------RSKPKLVLT---KGAVPGPP-FLSVNQNSESTAIIRWQPPDYVAPGLEVQGYRLQF--------GRKDVNPLATL-EFGPQEL-EYSISNIHRGATYIFKVSAKSKSGFGEEATQEL-------RVPEEVPRGYPQITEGSNITC------CSVQFSWLPPVLAERNGAITEYTLSYQEAGTISGP----KELR------------LPADENSYILNSLRPNAVYDVKIRAHTSVGPGPYSPPIQYRTVAYEADVPRNFTVKLVTKTTVLLSWK----FYDSRFPYKCTIEYHRQKSDI-------DARMTKTLITNLRPNTTYEFRISCQDSSDGGP 974          

HSP 4 Score: 60.077 bits (144), Expect = 3.959e-8
Identity = 84/384 (21.88%), Postives = 146/384 (38.02%), Query Frame = 2
Query: 2438 PEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHIL---NNLLPNKYYKIEVLAASRKGKG---SPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELK--PVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGE-TARINYTIPEERPSAPPNKLEIQGEKKTVTL-KWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXX-XXXXXMITNLQENTNYVFKIRAVNKEGDGPWS-----------PGTPYYISSEFFPAPENIETKALNDYQIKVSWN--FPEKANQVTDLLSQVNGFHVQ 3517
            P  +  ++I+  +  + W  P +   Q+K Y + +             + T+ ++    +NV + +L    +L+ ++ Y I VLA +  G G    P   ++++      VP  P   ++ +              V L W P     G+I  Y +           KE K  P+   +   T ++  D    + P   Y F + A++S   G  T  +  T  + +PSAPP  ++      TV +  W PPP + +NG +  Y ++Y  +        E     +    ++  L++ T Y   + A    G GP S           PG P          P  +E + LN   IKV W    P K +       Q+ G+ V 
Sbjct:  310 PRNIQARIISQNTVLVRWDEPDEPNGQIKGYRVYY-----------TMDPTLPMSMWQIHNVQDSVLTTIQSLVTSETYTIRVLAFTSVGDGPFSDPIHVKVLQ-----GVPGQPTNFQVGEVSDT---------GVELTWEPAFEKEGII-SYEL---------HYKEGKDGPLGKKKFAPTSSFVVD---GLRPNTEYFFSLAAVSSKGIGAFTNDLAQTTSQAKPSAPPQDIKCSSSSSTVLMVSWRPPPAESQNGELAGYIVRYAVVGAGAEVSTEHVEAPTSDQILLQRLEKWTMYRVTVAASTSVGSGPESEPLLCRTDEDVPGAP----------PRRVEVEVLNSTAIKVMWRSLLPGKQH------GQIRGYQVH 639          

HSP 5 Score: 56.6102 bits (135), Expect = 5.458e-7
Identity = 87/374 (23.26%), Postives = 160/374 (42.78%), Query Frame = 2
Query: 2402 ISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETAR-INYTIPEERPSAPPNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPA--PENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHV 3514
            ++ +   S+P  P    +    +TS  I+W       + V +YII++R  S +SK   V ++T             + +  L PN  Y+I V A +  G+G P   E ++     + P+ P   R  Q+  I       +  V + W+ P   +G I GYRV  ++   P     +  +   ++    T +S     +   +TY   V A  SV  G  +  I+  + +  P  P N    +     V L W   P   + GII+ Y++ Y + K+    L + +    ++ ++  L+ NT Y F + AV+ +G G ++       +S+  P+  P++I+  + +   + VSW  P   +Q  +L   +  + V
Sbjct:  203 VAQITVKSLPKPPGTPVVTETTATSITITWDS--GNPEPVSHYIIQYRAKSPESKFETVDSITTT----------RYSIGGLSPNTDYEIRVSAFNTIGQGPPS--EPVEARTGEQAPASPP--RNIQARII------SQNTVLVRWDEPDEPNGQIKGYRVYYTM--DPTLPMSMWQIHNVQDSVLTTIQS-----LVTSETYTIRVLAFTSVGDGPFSDPIHVKVLQGVPGQPTNFQVGEVSDTGVELTWE--PAFEKEGIIS-YELHYKEGKD--GPLGKKKFAPTSSFVVDGLRPNTEYFFSLAAVSSKGIGAFTNDLA-QTTSQAKPSAPPQDIKCSSSSSTVLMVSWRPPPAESQNGELAGYIVRYAV 541          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Zebrafish
Match: ptprsa (protein tyrosine phosphatase receptor type Sa [Source:ZFIN;Acc:ZDB-GENE-020107-3])

HSP 1 Score: 868.226 bits (2242), Expect = 0.000e+0
Identity = 393/591 (66.50%), Postives = 484/591 (81.90%), Query Frame = 2
Query: 4958 PPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            PPIP+  L      L+ANDN   SQEYESIDPGQQFTWE+SNLE+N+ KNRYANVIAYDHSR++L  I G+ GSDYIN+NYIDGY++ NAYIATQGPL  TFGDFWRMVWEQ  A++VMMT+LEE++RIKCDQYWP++GTE+Y  G I VT+ DT ELA + +RTF +  N SS         +KRE+RQ+QFTAWPDHGVP+ P P L FL+R++  NP  + PII HCSAGVGRTG FIVID  LERI+HE TVDI+G V++MR+QRNYMVQTEDQY F+H+ +L+AV   NTEV+ +++ +++QKL + +     +  +G+ELEF++L+  K + +R  SANLP N+ KNRLVNI+PYE  R+CLQPIRG EGSDYIN+S+IDGY+  KAYIATQ PL ET EDFWRM+WE+NSTI+VMLTKLREMGREKCH+YWP ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRTVRQFQFT+WPEQGVP ++ E FI+FIGQVHKTKEQFGQ+GPI+VHCSAGVGRTGVF+ LSI LER++ EGV+D+FQ V+ LR QR  MVQ+E++Y+FCY AA +Y+ SFD +
Sbjct: 1341 PPIPISELAEHTELLKANDNLKLSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVILAPIEGITGSDYINSNYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRAATVVMMTRLEEKSRIKCDQYWPSRGTETY--GMIQVTLLDTIELATFCVRTFSLHKNGSS---------EKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIIAHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVAARSLFSYIQKLAQVEAG---EHVSGMELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINSSFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFDHY 1916          

HSP 2 Score: 330.487 bits (846), Expect = 1.295e-90
Identity = 299/1095 (27.31%), Postives = 485/1095 (44.29%), Query Frame = 2
Query:  221 ITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGAS--LR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSN--NERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQP-SSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNP-PIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPY-YLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGV-SAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKG--PMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQ-ISHGL-ILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKT---VTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNF 3457
             T+ P+D    +G  +  +C+A G+PKP V +   GK    +S R     FD GA   LR Q ++   + +V +C AEN  G     A +++I  +  +P GFP I  GP   + +  + A + C  S +P  ++TW K+    +D N  N R + + +G+L I+N  ETD G YEC+A+N  G   S    L           Y++ +  P  P+     +  E+  G   N+TC A GSP+P V W +        N E+    DE P   + + L  + ES +Y C A + +G+I+  AQI VK  P  P     ++  ATS  I W     NP P+  Y +  +    K P      + ++               + I  L   T+YE++V A  N IG   PS P+  +T E  P+SPP ++ A+ IS +++ V W  P + NG+IKGYR+YYT      +  W I  VQD+    + +L+ + TY ++V A+   GDGP SD   + V+ G          VP  P N +   +S T +++ W  PA  +   +  YEL Y+   D  G + K+   P  + +++D L+P   Y  SLA  +  G+G  +  L +TT          ++K   ++ S     + W+    ES+        Y++ + +  + + +E +T  +        +L  L   + Y + V           +  +     S+  +   D D     P  V ++V+NST+ K+ W+   P K   Q++ Y + +  + N    S+   +  D+  ++     E ++  L P+  Y I V A + KG G+  K +++ T G    P      + ++S  I            + W PP  ++ GL + GYR+           K++ P+        E   S   + I  G TY+F+V A +   FGE A     +PEE P   P   E  G   T   V   W PP +  RNG IT+Y + Y +        +      + + ++ +L+ N  Y  KIRA    G GP+SP   Y   +     P N   K +    + +SW F
Sbjct:   33 FTKVPVDMIGVSGGVVSFVCQATGDPKPKVTWNKKGK--RVNSQRIETIEFDEGAGAVLRIQPLRAPRDENVYECQAENSEGEINVQAKLSIIREDL-LPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKD-FLPIDPNTSNGRIKQLRSGALQIENTEETDQGKYECVASNVEGVRYSSPANL-----------YVRVRRVP--PRFSILPTSQEIMPGGSVNITCVAVGSPMPYVKWML--------NSEDLTPEDEMPVGRNVLELNSVRESANYTCVAMSSLGIIETVAQITVKSLPKPPGTPVVTETTATSITITW--DSGNPEPVSHYIIQYR---AKSPESKFETVDSI-----------TTTRYSIGGLSPNTDYEIRVSAF-NTIGQGPPSEPVEARTGEQAPASPPRNIQARIISQNTVLVRWDEPDEPNGQIKGYRVYYTMDPTLPMSMWQIHNVQDSVLTTIQSLVTSETYTIRVLAFTSVGDGPFSDPIHVKVLQG----------VPGQPTNFQVGEVSDTGVELTW-EPAF-EKEGIISYELHYKEGKD--GPLGKKKFAP-TSSFVVDGLRPNTEYFFSLAAVSSKGIGAFTNDLAQTTSQAKPSAPPQDIKC--SSSSSTVLMVSWRPPPAESQNG--ELAGYIVRYAV--VGAGAEVSTEHVEAPTSDQILLQRLEKWTMYRVTVA---------ASTSVGSGPESEPLLCRTDEDVPGAPPRRVEVEVLNSTAIKVMWRSLLPGKQHGQIRGYQVHYVRVEN--GESRGLPLIKDVMLADAQ---EMVIGGLQPDTTYSITVAAYTTKGDGARSKPKLVLTKGAVPGPPFLSVNQNSESTAI------------IRWQPPDYVAPGLEVQGYRLQFGR-------KDVNPLATLEFGPQELEYSI--SNIHRGATYIFKVSAKSKSGFGEEATQELRVPEEVPRGYPQITE--GSNITCCSVQFSWLPPVLAERNGAITEYTLSYQEAGTISGPKELRLPADENSYILNSLRPNAVYDVKIRAHTSVGPGPYSPPIQYRTVAYEADVPRNFTVKLVTKTTVLLSWKF 1027          

HSP 3 Score: 60.4622 bits (145), Expect = 3.379e-8
Identity = 84/384 (21.88%), Postives = 146/384 (38.02%), Query Frame = 2
Query: 2438 PEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHIL---NNLLPNKYYKIEVLAASRKGKG---SPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELK--PVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGE-TARINYTIPEERPSAPPNKLEIQGEKKTVTL-KWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXX-XXXXXMITNLQENTNYVFKIRAVNKEGDGPWS-----------PGTPYYISSEFFPAPENIETKALNDYQIKVSWN--FPEKANQVTDLLSQVNGFHVQ 3517
            P  +  ++I+  +  + W  P +   Q+K Y + +             + T+ ++    +NV + +L    +L+ ++ Y I VLA +  G G    P   ++++      VP  P   ++ +              V L W P     G+I  Y +           KE K  P+   +   T ++  D    + P   Y F + A++S   G  T  +  T  + +PSAPP  ++      TV +  W PPP + +NG +  Y ++Y  +        E     +    ++  L++ T Y   + A    G GP S           PG P          P  +E + LN   IKV W    P K +       Q+ G+ V 
Sbjct:  415 PRNIQARIISQNTVLVRWDEPDEPNGQIKGYRVYY-----------TMDPTLPMSMWQIHNVQDSVLTTIQSLVTSETYTIRVLAFTSVGDGPFSDPIHVKVLQ-----GVPGQPTNFQVGEVSDT---------GVELTWEPAFEKEGII-SYEL---------HYKEGKDGPLGKKKFAPTSSFVVD---GLRPNTEYFFSLAAVSSKGIGAFTNDLAQTTSQAKPSAPPQDIKCSSSSSTVLMVSWRPPPAESQNGELAGYIVRYAVVGAGAEVSTEHVEAPTSDQILLQRLEKWTMYRVTVAASTSVGSGPESEPLLCRTDEDVPGAP----------PRRVEVEVLNSTAIKVMWRSLLPGKQH------GQIRGYQVH 744          

HSP 4 Score: 56.6102 bits (135), Expect = 4.896e-7
Identity = 87/374 (23.26%), Postives = 160/374 (42.78%), Query Frame = 2
Query: 2402 ISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETAR-INYTIPEERPSAPPNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPA--PENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHV 3514
            ++ +   S+P  P    +    +TS  I+W       + V +YII++R  S +SK   V ++T             + +  L PN  Y+I V A +  G+G P   E ++     + P+ P   R  Q+  I       +  V + W+ P   +G I GYRV  ++   P     +  +   ++    T +S     +   +TY   V A  SV  G  +  I+  + +  P  P N    +     V L W   P   + GII+ Y++ Y + K+    L + +    ++ ++  L+ NT Y F + AV+ +G G ++       +S+  P+  P++I+  + +   + VSW  P   +Q  +L   +  + V
Sbjct:  308 VAQITVKSLPKPPGTPVVTETTATSITITWDS--GNPEPVSHYIIQYRAKSPESKFETVDSITTT----------RYSIGGLSPNTDYEIRVSAFNTIGQGPPS--EPVEARTGEQAPASPP--RNIQARII------SQNTVLVRWDEPDEPNGQIKGYRVYYTM--DPTLPMSMWQIHNVQDSVLTTIQS-----LVTSETYTIRVLAFTSVGDGPFSDPIHVKVLQGVPGQPTNFQVGEVSDTGVELTWE--PAFEKEGIIS-YELHYKEGKD--GPLGKKKFAPTSSFVVDGLRPNTEYFFSLAAVSSKGIGAFTNDLA-QTTSQAKPSAPPQDIKCSSSSSTVLMVSWRPPPAESQNGELAGYIVRYAV 646          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Zebrafish
Match: ptprfa (protein tyrosine phosphatase receptor type Fa [Source:ZFIN;Acc:ZDB-GENE-020107-2])

HSP 1 Score: 867.07 bits (2239), Expect = 0.000e+0
Identity = 392/591 (66.33%), Postives = 482/591 (81.56%), Query Frame = 2
Query: 4958 PPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            PP+ V  L   I  LRAND+  FSQEYES+DPGQQFTWENSNLE+N+ KNRYANVIAYDHSR++L  ++GV GSDYIN NYIDGY++ NAYIATQGPL  T  DFWRMVWEQ T++IVMMT+LEE++R+KCDQYWP++GTE+Y  G I V++ DT ELA Y++RTF +  N SS         +KRE+RQ+QF AWPDHGVP+ P P+L FL+R++A NP  + P++VHCSAGVGRTG FIVID  LER++HE +VDI+G V+ MR+QRNYMVQTEDQY+F+HE +L+A    NTEV  +++ TH+QKL +A         T +ELEF+KL+  K + +R  SA+LP N+ KNRLVNI+P+E +R+CLQPIRG EGSDYINAS+IDGY+  KAYIATQ PL ET EDFWRM+WEHNSTI+VMLTKLREMGREKCH+YWP ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRT+RQFQFT+WPEQGVP +  E FI+FIGQVHKTKEQFGQ+GPITVHCSAGVGRTGVF+ LSI LER++ EGV+D+FQ ++ LR QR  MVQ+E+QY+ CY AA +Y+ SFD +
Sbjct: 1316 PPVSVCALADHIERLRANDSLRFSQEYESVDPGQQFTWENSNLEVNKPKNRYANVIAYDHSRVVLTPVDGVPGSDYINGNYIDGYRKQNAYIATQGPLPETLSDFWRMVWEQRTSTIVMMTRLEEKSRVKCDQYWPSRGTETY--GMIQVSMLDTVELATYSVRTFALYKNGSS---------EKREVRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKSVDIYGHVTCMRSQRNYMVQTEDQYIFIHEALLEAATCGNTEVPARSLYTHIQKLTQAPPG---DTVTAMELEFKKLANSKAHTSRFISASLPCNKFKNRLVNIMPFESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLSETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVP-KTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTIKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFDHY 1891          

HSP 2 Score: 346.28 bits (887), Expect = 1.721e-95
Identity = 308/1093 (28.18%), Postives = 496/1093 (45.38%), Query Frame = 2
Query:  233 PLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGAS--LR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHE-KVDSNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNP-PIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPY-YLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKY-RLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFD-ISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDK-PEAVSIKVINSTSSKISWKGPM--KTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEE---AKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKTVT-LKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPA-PENIETKALNDYQIKVSWNFPE 3463
            P D T  +G     +C+A G PKP + +   GK  S  S R  +  FD G+   LR Q ++   +  + +C A N +G    SA +TV++ + ++P GFP I  GP   + +  + A + C  S +P  +++W K+     ++S+N R + + +G+L I+N  E+D G YEC+A N  GT  S    L           Y++ +  P  P+     +  EV  G   NLTC A G+P+P V W    G       E  P+G      + + LT+I +SG+Y C A + +G+I   AQI VK  P  P  +  ++  ATS  + W     NP P+  Y +  +   + +   G +++  +               + I  L  Y+ YE +V+AV NNIG   PS  +  +T E  PSSPP  + A+ +S  ++ V W+PP + NG+I+GYR+YYT  L   +  W     +D+    ++ L+ + TY ++V A+   GDGP SD   +    G          VP  P      +   T I + W  P  V D ++  YEL Y   D D K  +     +P  + Y ID+LKP   Y  SLA +++ G+GV  Q  E    ++  +     ++   ++S  S  + W      S+     R  Y L +  +S          ++  D     +VL  L   + Y +WVK   +TD      V     S    I T   + VP   P  V +  INST+ ++SWK P+  K    ++ Y + +  L N     +   + V + ++      E +++ LLP   Y + V A + KG G+  K +++ T G   VP  P       ++ I +  G   L   + W PP+   G ++GYR+         + +E + +   R+      ++D+      +  G TY+F++ A N    GE      + PE+ PS+ P  L++ G   T T L W PPP+  RNG I +Y + Y D+        +T   + T   I  L+ +T Y  ++RA   +G GP SP       S   P   +N   KA+    + ++W  PE
Sbjct:   39 PEDQTGISGGVASFVCQAVGEPKPRITWMKKGKKVS--SQRFEVIEFDDGSGSVLRIQPLRTHRDEAIYECTATNSVGEINTSAKLTVLEED-QIPHGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEISWFKDFLPVDINSSNGRIKQLRSGALQIENSEESDQGKYECVAVNSAGTRYSAPANL-----------YVRVRRVP--PRFSIPPTNHEVMPGGSVNLTCVAVGAPMPYVKW--MKGEQELTKEEEMPIG-----RNVLELTNIRQSGNYTCVAISSLGMIDTTAQITVKALPRPPASLIVTETTATSVTLTW--DSGNPEPVSYYVIQYRSKISDN---GFQEVDGV-----------ASTRYSIGGLSPYSEYEFRVMAV-NNIGRGPPSGMVETRTSEQAPSSPPLRVQARMLSATTMLVQWEPPEEPNGQIRGYRVYYTSDLHFPLSTWQKHNTEDSSLTTISGLVPDITYGLRVLAFTSVGDGPPSDILQVKTQQG----------VPAQPTGFEAEAELDTRIMLSWLWP--VQD-QITKYELTYWEADSDNKHHVI---FDPAGS-YAIDSLKPDTLYKFSLAARSEMGLGVYTQPIEARTAQSAPSAPPQ-EVHLISLSSSSIKVSWVAPPAASRHGSIVR--YSLAYQAVSGEDQERHEVKDIPAD--VSSYVLEGLEKWTEYTVWVK--AHTD------VGPGPESGSTRIRT--QEDVPGAPPRRVEVDNINSTALRVSWKPPLQQKQHGHIRGYQVVYSRLENGEPRGQPIILDVALPEAQ-----EAVISGLLPETTYSVTVAAYTTKGDGARSKAKVVTTTG--AVPGKP-------TMIISTTIGNTAL---IQWQPPKEMVGELMGYRL--------RYKREEEDIYTVRDFR----RTDDHFTVTGLHKGATYIFKLCAKNRAGNGEEYSKEISTPEDVPSSYPQNLKVVGLTTTTTKLAWDPPPLPERNGKIVRYVVVYRDIN---SHQNQTNGTADTEMTIQGLKPDTTYDIRVRAFTGKGGGPISPSIQSRTMSTSMPEFTKNFGVKAVMKTSVLLTWEVPE 1027          

HSP 3 Score: 90.8929 bits (224), Expect = 1.840e-17
Identity = 103/413 (24.94%), Postives = 180/413 (43.58%), Query Frame = 2
Query: 1337 SFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQ--NGRIKGYRLYYTE------RLWSAIDNWHIREVQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHP-AMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWK---MNLDESKIALTHRISYMLIF-DISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLDQVKYYII 2536
            S+ +  L+ +T Y V V A   ++G    S   R +T E  P +PP  +    I+  +++V+WKPPLQQ  +G I+GY++ Y+       R    I +  + E Q+    ++ L+   TY V V AY   GDG  S A           V T   +VP  P  +   ++  T++ I W  P  MV +  L GY L+Y+ +  E+              + +  L  G  Y   L  K + G G       +T ++   +   NLK+ G  ++  +  + W    +     KI     + Y++++ DI+    + +N TN   DT+     +  L+PD+ YD+ V+         ++  ++  T S          S+P+  +   +K +  TS  ++W+ P     QV + I+
Sbjct:  667 SYVLEGLEKWTEYTVWVKA-HTDVGPGPESGSTRIRTQEDVPGAPPRRVEVDNINSTALRVSWKPPLQQKQHGHIRGYQVVYSRLENGEPRGQPIILDVALPEAQEA--VISGLLPETTYSVTVAAYTTKGDGARSKAK----------VVTTTGAVPGKPTMIISTTIGNTAL-IQWQPPKEMVGE--LMGYRLRYKRE--EEDIYTVRDFRRTDDHFTVTGLHKGATYIFKLCAKNRAGNGEEYSKEISTPEDVPSSYPQNLKVVG--LTTTTTKLAWDPPPLPERNGKI-----VRYVVVYRDIN----SHQNQTNGTADTEM---TIQGLKPDTTYDIRVRAFTGKGGGPISPSIQSRTMST---------SMPEFTKNFGVKAVMKTSVLLTWEVPETYKSQVPFKIL 1038          

HSP 4 Score: 58.5362 bits (140), Expect = 1.494e-7
Identity = 81/357 (22.69%), Postives = 146/357 (40.90%), Query Frame = 2
Query: 2423 SVPDKPEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMP---RELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELK-PVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKT-VTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWS-PGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKANQ 3475
            ++P  P ++ +    +TS  ++W       + V YY+I++R   + +   +V  V              + +  L P   Y+  V+A +  G+G P    +++T  + + PS P    + RM  +  +            + W PP+  +G I GYRV         +  +L  P+  ++  +TE       + + P  TY   V A  SV  G  + I     ++   A P   E + E  T + L W  P  D     ITKY++ Y++             +   +  I +L+ +T Y F + A ++ G G ++ P       S     P+ +   +L+   IKVSW  P  A++
Sbjct:  317 ALPRPPASLIVTETTATSVTLTWDS--GNPEPVSYYVIQYRSKISDNGFQEVDGVAST----------RYSIGGLSPYSEYEFRVMAVNNIGRGPPSG--MVETRTSEQAPSSPPLRVQARMLSATTM-----------LVQWEPPEEPNGQIRGYRVY--------YTSDLHFPLSTWQKHNTEDSSLTTISGLVPDITYGLRVLAFTSVGDGPPSDILQVKTQQGVPAQPTGFEAEAELDTRIMLSWLWPVQDQ----ITKYELTYWEADS--DNKHHVIFDPAGSYAIDSLKPDTLYKFSLAARSEMGLGVYTQPIEARTAQSAPSAPPQEVHLISLSSSSIKVSWVAPPAASR 634          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Zebrafish
Match: ptprfa (protein tyrosine phosphatase receptor type Fa [Source:ZFIN;Acc:ZDB-GENE-020107-2])

HSP 1 Score: 867.07 bits (2239), Expect = 0.000e+0
Identity = 392/591 (66.33%), Postives = 482/591 (81.56%), Query Frame = 2
Query: 4958 PPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            PP+ V  L   I  LRAND+  FSQEYES+DPGQQFTWENSNLE+N+ KNRYANVIAYDHSR++L  ++GV GSDYIN NYIDGY++ NAYIATQGPL  T  DFWRMVWEQ T++IVMMT+LEE++R+KCDQYWP++GTE+Y  G I V++ DT ELA Y++RTF +  N SS         +KRE+RQ+QF AWPDHGVP+ P P+L FL+R++A NP  + P++VHCSAGVGRTG FIVID  LER++HE +VDI+G V+ MR+QRNYMVQTEDQY+F+HE +L+A    NTEV  +++ TH+QKL +A         T +ELEF+KL+  K + +R  SA+LP N+ KNRLVNI+P+E +R+CLQPIRG EGSDYINAS+IDGY+  KAYIATQ PL ET EDFWRM+WEHNSTI+VMLTKLREMGREKCH+YWP ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRT+RQFQFT+WPEQGVP +  E FI+FIGQVHKTKEQFGQ+GPITVHCSAGVGRTGVF+ LSI LER++ EGV+D+FQ ++ LR QR  MVQ+E+QY+ CY AA +Y+ SFD +
Sbjct: 1337 PPVSVCALADHIERLRANDSLRFSQEYESVDPGQQFTWENSNLEVNKPKNRYANVIAYDHSRVVLTPVDGVPGSDYINGNYIDGYRKQNAYIATQGPLPETLSDFWRMVWEQRTSTIVMMTRLEEKSRVKCDQYWPSRGTETY--GMIQVSMLDTVELATYSVRTFALYKNGSS---------EKREVRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKSVDIYGHVTCMRSQRNYMVQTEDQYIFIHEALLEAATCGNTEVPARSLYTHIQKLTQAPPG---DTVTAMELEFKKLANSKAHTSRFISASLPCNKFKNRLVNIMPFESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLSETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVP-KTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTIKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFDHY 1912          

HSP 2 Score: 338.961 bits (868), Expect = 3.162e-93
Identity = 310/1099 (28.21%), Postives = 497/1099 (45.22%), Query Frame = 2
Query:  233 PLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGAS--LR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHE-KVDSNNERFQVV---GT---GSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNP-PIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPY-YLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKY-RLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFD-ISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDK-PEAVSIKVINSTSSKISWKGPM--KTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEE---AKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKTVT-LKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPA-PENIETKALNDYQIKVSWNFPE 3463
            P D T  +G     +C+A G PKP + +   GK  S  S R  +  FD G+   LR Q ++   +  + +C A N +G    SA +TV++ + ++P GFP I  GP   + +  + A + C  S +P  +++W K+     ++S+N R + +   GT   G+L I+N  E+D G YEC+A N  GT  S    L           Y++ +  P  P+     +  EV  G   NLTC A G+P+P V W    G       E  P+G      + + LT+I +SG+Y C A + +G+I   AQI VK  P  P  +  ++  ATS  + W     NP P+  Y +  +   + +   G +++  +               + I  L  Y+ YE +V+AV NNIG   PS  +  +T E  PSSPP  + A+ +S  ++ V W+PP + NG+I+GYR+YYT  L   +  W     +D+    ++ L+ + TY ++V A+   GDGP SD   +    G          VP  P      +   T I + W  P  V D ++  YEL Y   D D K  +     +P  + Y ID+LKP   Y  SLA +++ G+GV  Q  E    ++  +     ++   ++S  S  + W      S+     R  Y L +  +S          ++  D     +VL  L   + Y +WVK   +TD      V     S    I T   + VP   P  V +  INST+ ++SWK P+  K    ++ Y + +  L N     +   + V + ++      E +++ LLP   Y + V A + KG G+  K +++ T G   VP  P       ++ I +  G   L   + W PP+   G ++GYR+         + +E + +   R+      ++D+      +  G TY+F++ A N    GE      + PE+ PS+ P  L++ G   T T L W PPP+  RNG I +Y + Y D+        +T   + T   I  L+ +T Y  ++RA   +G GP SP       S   P   +N   KA+    + ++W  PE
Sbjct:   39 PEDQTGISGGVASFVCQAVGEPKPRITWMKKGKKVS--SQRFEVIEFDDGSGSVLRIQPLRTHRDEAIYECTATNSVGEINTSAKLTVLEED-QIPHGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEISWFKDFLPVDINSSNGRIKQLRSGGTPIRGALQIENSEESDQGKYECVAVNSAGTRYSAPANL-----------YVRVRRVP--PRFSIPPTNHEVMPGGSVNLTCVAVGAPMPYVKW--MKGEQELTKEEEMPIG-----RNVLELTNIRQSGNYTCVAISSLGMIDTTAQITVKALPRPPASLIVTETTATSVTLTW--DSGNPEPVSYYVIQYRSKISDN---GFQEVDGV-----------ASTRYSIGGLSPYSEYEFRVMAV-NNIGRGPPSGMVETRTSEQAPSSPPLRVQARMLSATTMLVQWEPPEEPNGQIRGYRVYYTSDLHFPLSTWQKHNTEDSSLTTISGLVPDITYGLRVLAFTSVGDGPPSDILQVKTQQG----------VPAQPTGFEAEAELDTRIMLSWLWP--VQD-QITKYELTYWEADSDNKHHVI---FDPAGS-YAIDSLKPDTLYKFSLAARSEMGLGVYTQPIEARTAQSAPSAPPQ-EVHLISLSSSSIKVSWVAPPAASRHGSIVR--YSLAYQAVSGEDQERHEVKDIPAD--VSSYVLEGLEKWTEYTVWVK--AHTD------VGPGPESGSTRIRT--QEDVPGAPPRRVEVDNINSTALRVSWKPPLQQKQHGHIRGYQVVYSRLENGEPRGQPIILDVALPEAQ-----EAVISGLLPETTYSVTVAAYTTKGDGARSKAKVVTTTG--AVPGKP-------TMIISTTIGNTAL---IQWQPPKEMVGELMGYRL--------RYKREEEDIYTVRDFR----RTDDHFTVTGLHKGATYIFKLCAKNRAGNGEEYSKEISTPEDVPSSYPQNLKVVGLTTTTTKLAWDPPPLPERNGKIVRYVVVYRDIN---SHQNQTNGTADTEMTIQGLKPDTTYDIRVRAFTGKGGGPISPSIQSRTMSTSMPEFTKNFGVKAVMKTSVLLTWEVPE 1033          

HSP 3 Score: 90.8929 bits (224), Expect = 2.202e-17
Identity = 103/413 (24.94%), Postives = 180/413 (43.58%), Query Frame = 2
Query: 1337 SFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQ--NGRIKGYRLYYTE------RLWSAIDNWHIREVQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHP-AMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWK---MNLDESKIALTHRISYMLIF-DISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLDQVKYYII 2536
            S+ +  L+ +T Y V V A   ++G    S   R +T E  P +PP  +    I+  +++V+WKPPLQQ  +G I+GY++ Y+       R    I +  + E Q+    ++ L+   TY V V AY   GDG  S A           V T   +VP  P  +   ++  T++ I W  P  MV +  L GY L+Y+ +  E+              + +  L  G  Y   L  K + G G       +T ++   +   NLK+ G  ++  +  + W    +     KI     + Y++++ DI+    + +N TN   DT+     +  L+PD+ YD+ V+         ++  ++  T S          S+P+  +   +K +  TS  ++W+ P     QV + I+
Sbjct:  673 SYVLEGLEKWTEYTVWVKA-HTDVGPGPESGSTRIRTQEDVPGAPPRRVEVDNINSTALRVSWKPPLQQKQHGHIRGYQVVYSRLENGEPRGQPIILDVALPEAQEA--VISGLLPETTYSVTVAAYTTKGDGARSKAK----------VVTTTGAVPGKPTMIISTTIGNTAL-IQWQPPKEMVGE--LMGYRLRYKRE--EEDIYTVRDFRRTDDHFTVTGLHKGATYIFKLCAKNRAGNGEEYSKEISTPEDVPSSYPQNLKVVG--LTTTTTKLAWDPPPLPERNGKI-----VRYVVVYRDIN----SHQNQTNGTADTEM---TIQGLKPDTTYDIRVRAFTGKGGGPISPSIQSRTMST---------SMPEFTKNFGVKAVMKTSVLLTWEVPETYKSQVPFKIL 1044          

HSP 4 Score: 58.151 bits (139), Expect = 1.755e-7
Identity = 81/357 (22.69%), Postives = 146/357 (40.90%), Query Frame = 2
Query: 2423 SVPDKPEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMP---RELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELK-PVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKT-VTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWS-PGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKANQ 3475
            ++P  P ++ +    +TS  ++W       + V YY+I++R   + +   +V  V              + +  L P   Y+  V+A +  G+G P    +++T  + + PS P    + RM  +  +            + W PP+  +G I GYRV         +  +L  P+  ++  +TE       + + P  TY   V A  SV  G  + I     ++   A P   E + E  T + L W  P  D     ITKY++ Y++             +   +  I +L+ +T Y F + A ++ G G ++ P       S     P+ +   +L+   IKVSW  P  A++
Sbjct:  323 ALPRPPASLIVTETTATSVTLTWDS--GNPEPVSYYVIQYRSKISDNGFQEVDGVAST----------RYSIGGLSPYSEYEFRVMAVNNIGRGPPSG--MVETRTSEQAPSSPPLRVQARMLSATTM-----------LVQWEPPEEPNGQIRGYRVY--------YTSDLHFPLSTWQKHNTEDSSLTTISGLVPDITYGLRVLAFTSVGDGPPSDILQVKTQQGVPAQPTGFEAEAELDTRIMLSWLWPVQDQ----ITKYELTYWEADS--DNKHHVIFDPAGSYAIDSLKPDTLYKFSLAARSEMGLGVYTQPIEARTAQSAPSAPPQEVHLISLSSSSIKVSWVAPPAASR 640          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Zebrafish
Match: ptprfa (protein tyrosine phosphatase receptor type Fa [Source:ZFIN;Acc:ZDB-GENE-020107-2])

HSP 1 Score: 867.07 bits (2239), Expect = 0.000e+0
Identity = 392/591 (66.33%), Postives = 482/591 (81.56%), Query Frame = 2
Query: 4958 PPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            PP+ V  L   I  LRAND+  FSQEYES+DPGQQFTWENSNLE+N+ KNRYANVIAYDHSR++L  ++GV GSDYIN NYIDGY++ NAYIATQGPL  T  DFWRMVWEQ T++IVMMT+LEE++R+KCDQYWP++GTE+Y  G I V++ DT ELA Y++RTF +  N SS         +KRE+RQ+QF AWPDHGVP+ P P+L FL+R++A NP  + P++VHCSAGVGRTG FIVID  LER++HE +VDI+G V+ MR+QRNYMVQTEDQY+F+HE +L+A    NTEV  +++ TH+QKL +A         T +ELEF+KL+  K + +R  SA+LP N+ KNRLVNI+P+E +R+CLQPIRG EGSDYINAS+IDGY+  KAYIATQ PL ET EDFWRM+WEHNSTI+VMLTKLREMGREKCH+YWP ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRT+RQFQFT+WPEQGVP +  E FI+FIGQVHKTKEQFGQ+GPITVHCSAGVGRTGVF+ LSI LER++ EGV+D+FQ ++ LR QR  MVQ+E+QY+ CY AA +Y+ SFD +
Sbjct: 1316 PPVSVCALADHIERLRANDSLRFSQEYESVDPGQQFTWENSNLEVNKPKNRYANVIAYDHSRVVLTPVDGVPGSDYINGNYIDGYRKQNAYIATQGPLPETLSDFWRMVWEQRTSTIVMMTRLEEKSRVKCDQYWPSRGTETY--GMIQVSMLDTVELATYSVRTFALYKNGSS---------EKREVRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKSVDIYGHVTCMRSQRNYMVQTEDQYIFIHEALLEAATCGNTEVPARSLYTHIQKLTQAPPG---DTVTAMELEFKKLANSKAHTSRFISASLPCNKFKNRLVNIMPFESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLSETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVP-KTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTIKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFDHY 1891          

HSP 2 Score: 346.28 bits (887), Expect = 1.721e-95
Identity = 308/1093 (28.18%), Postives = 496/1093 (45.38%), Query Frame = 2
Query:  233 PLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGAS--LR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHE-KVDSNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNP-PIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPY-YLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKY-RLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFD-ISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDK-PEAVSIKVINSTSSKISWKGPM--KTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEE---AKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKTVT-LKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPA-PENIETKALNDYQIKVSWNFPE 3463
            P D T  +G     +C+A G PKP + +   GK  S  S R  +  FD G+   LR Q ++   +  + +C A N +G    SA +TV++ + ++P GFP I  GP   + +  + A + C  S +P  +++W K+     ++S+N R + + +G+L I+N  E+D G YEC+A N  GT  S    L           Y++ +  P  P+     +  EV  G   NLTC A G+P+P V W    G       E  P+G      + + LT+I +SG+Y C A + +G+I   AQI VK  P  P  +  ++  ATS  + W     NP P+  Y +  +   + +   G +++  +               + I  L  Y+ YE +V+AV NNIG   PS  +  +T E  PSSPP  + A+ +S  ++ V W+PP + NG+I+GYR+YYT  L   +  W     +D+    ++ L+ + TY ++V A+   GDGP SD   +    G          VP  P      +   T I + W  P  V D ++  YEL Y   D D K  +     +P  + Y ID+LKP   Y  SLA +++ G+GV  Q  E    ++  +     ++   ++S  S  + W      S+     R  Y L +  +S          ++  D     +VL  L   + Y +WVK   +TD      V     S    I T   + VP   P  V +  INST+ ++SWK P+  K    ++ Y + +  L N     +   + V + ++      E +++ LLP   Y + V A + KG G+  K +++ T G   VP  P       ++ I +  G   L   + W PP+   G ++GYR+         + +E + +   R+      ++D+      +  G TY+F++ A N    GE      + PE+ PS+ P  L++ G   T T L W PPP+  RNG I +Y + Y D+        +T   + T   I  L+ +T Y  ++RA   +G GP SP       S   P   +N   KA+    + ++W  PE
Sbjct:   39 PEDQTGISGGVASFVCQAVGEPKPRITWMKKGKKVS--SQRFEVIEFDDGSGSVLRIQPLRTHRDEAIYECTATNSVGEINTSAKLTVLEED-QIPHGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEISWFKDFLPVDINSSNGRIKQLRSGALQIENSEESDQGKYECVAVNSAGTRYSAPANL-----------YVRVRRVP--PRFSIPPTNHEVMPGGSVNLTCVAVGAPMPYVKW--MKGEQELTKEEEMPIG-----RNVLELTNIRQSGNYTCVAISSLGMIDTTAQITVKALPRPPASLIVTETTATSVTLTW--DSGNPEPVSYYVIQYRSKISDN---GFQEVDGV-----------ASTRYSIGGLSPYSEYEFRVMAV-NNIGRGPPSGMVETRTSEQAPSSPPLRVQARMLSATTMLVQWEPPEEPNGQIRGYRVYYTSDLHFPLSTWQKHNTEDSSLTTISGLVPDITYGLRVLAFTSVGDGPPSDILQVKTQQG----------VPAQPTGFEAEAELDTRIMLSWLWP--VQD-QITKYELTYWEADSDNKHHVI---FDPAGS-YAIDSLKPDTLYKFSLAARSEMGLGVYTQPIEARTAQSAPSAPPQ-EVHLISLSSSSIKVSWVAPPAASRHGSIVR--YSLAYQAVSGEDQERHEVKDIPAD--VSSYVLEGLEKWTEYTVWVK--AHTD------VGPGPESGSTRIRT--QEDVPGAPPRRVEVDNINSTALRVSWKPPLQQKQHGHIRGYQVVYSRLENGEPRGQPIILDVALPEAQ-----EAVISGLLPETTYSVTVAAYTTKGDGARSKAKVVTTTG--AVPGKP-------TMIISTTIGNTAL---IQWQPPKEMVGELMGYRL--------RYKREEEDIYTVRDFR----RTDDHFTVTGLHKGATYIFKLCAKNRAGNGEEYSKEISTPEDVPSSYPQNLKVVGLTTTTTKLAWDPPPLPERNGKIVRYVVVYRDIN---SHQNQTNGTADTEMTIQGLKPDTTYDIRVRAFTGKGGGPISPSIQSRTMSTSMPEFTKNFGVKAVMKTSVLLTWEVPE 1027          

HSP 3 Score: 90.8929 bits (224), Expect = 1.840e-17
Identity = 103/413 (24.94%), Postives = 180/413 (43.58%), Query Frame = 2
Query: 1337 SFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQ--NGRIKGYRLYYTE------RLWSAIDNWHIREVQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHP-AMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWK---MNLDESKIALTHRISYMLIF-DISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLDQVKYYII 2536
            S+ +  L+ +T Y V V A   ++G    S   R +T E  P +PP  +    I+  +++V+WKPPLQQ  +G I+GY++ Y+       R    I +  + E Q+    ++ L+   TY V V AY   GDG  S A           V T   +VP  P  +   ++  T++ I W  P  MV +  L GY L+Y+ +  E+              + +  L  G  Y   L  K + G G       +T ++   +   NLK+ G  ++  +  + W    +     KI     + Y++++ DI+    + +N TN   DT+     +  L+PD+ YD+ V+         ++  ++  T S          S+P+  +   +K +  TS  ++W+ P     QV + I+
Sbjct:  667 SYVLEGLEKWTEYTVWVKA-HTDVGPGPESGSTRIRTQEDVPGAPPRRVEVDNINSTALRVSWKPPLQQKQHGHIRGYQVVYSRLENGEPRGQPIILDVALPEAQEA--VISGLLPETTYSVTVAAYTTKGDGARSKAK----------VVTTTGAVPGKPTMIISTTIGNTAL-IQWQPPKEMVGE--LMGYRLRYKRE--EEDIYTVRDFRRTDDHFTVTGLHKGATYIFKLCAKNRAGNGEEYSKEISTPEDVPSSYPQNLKVVG--LTTTTTKLAWDPPPLPERNGKI-----VRYVVVYRDIN----SHQNQTNGTADTEM---TIQGLKPDTTYDIRVRAFTGKGGGPISPSIQSRTMST---------SMPEFTKNFGVKAVMKTSVLLTWEVPETYKSQVPFKIL 1038          

HSP 4 Score: 58.5362 bits (140), Expect = 1.494e-7
Identity = 81/357 (22.69%), Postives = 146/357 (40.90%), Query Frame = 2
Query: 2423 SVPDKPEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMP---RELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELK-PVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKT-VTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWS-PGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKANQ 3475
            ++P  P ++ +    +TS  ++W       + V YY+I++R   + +   +V  V              + +  L P   Y+  V+A +  G+G P    +++T  + + PS P    + RM  +  +            + W PP+  +G I GYRV         +  +L  P+  ++  +TE       + + P  TY   V A  SV  G  + I     ++   A P   E + E  T + L W  P  D     ITKY++ Y++             +   +  I +L+ +T Y F + A ++ G G ++ P       S     P+ +   +L+   IKVSW  P  A++
Sbjct:  317 ALPRPPASLIVTETTATSVTLTWDS--GNPEPVSYYVIQYRSKISDNGFQEVDGVAST----------RYSIGGLSPYSEYEFRVMAVNNIGRGPPSG--MVETRTSEQAPSSPPLRVQARMLSATTM-----------LVQWEPPEEPNGQIRGYRVY--------YTSDLHFPLSTWQKHNTEDSSLTTISGLVPDITYGLRVLAFTSVGDGPPSDILQVKTQQGVPAQPTGFEAEAELDTRIMLSWLWPVQDQ----ITKYELTYWEADS--DNKHHVIFDPAGSYAIDSLKPDTLYKFSLAARSEMGLGVYTQPIEARTAQSAPSAPPQEVHLISLSSSSIKVSWVAPPAASR 634          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Xenopus
Match: brdt (bromodomain, testis-specific [Source:Xenbase;Acc:XB-GENE-983868])

HSP 1 Score: 952.584 bits (2461), Expect = 0.000e+0
Identity = 709/2136 (33.19%), Postives = 1076/2136 (50.37%), Query Frame = 2
Query:  515 GFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQVV----GTGS-LTIKNVRE-TDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEV-STGQGANLTCNAEGSPIPLVHW--EVQIGNPNSPNPENRPLGDEQ-PSSSTIHL--TDITESGSYVCHAKNKMGL-IKKEAQIIVKKKPMAPTL----VSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDN-WHIRE-VQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVD--NDSVPDKPEA--VSIKVINSTSSKI--SWKGPMKTLDQ--VKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPR---ELRMTQSVKIPSFKGPKRLAVYLAWNPP--QISHGLILGYRVAISLI--GPPEFVKELKPVKIYRNVSTETYKSDEEAK-------IGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAP--PNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPA--PENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQVSTNR----DFPDGKITFKKIVGPFTSTVMEKIYPNH-YFIRVQAIIRDKRIAEWSNIHTLTVFKSKYTERNIKGLNCIGQTNSIKVTWEKPDDYTEIKSFLIELSGYRKFRNIYGAYKIEKIKARTSRIEFFGEEQSTYNYSIPNLEPNTNYDXXXXXXXXXXXXXXXXXXXXXCVTLMEQPKSILSPMPVPLRKVSNEIILRLSRTNEILGMISHYYLIVSPIKETH-------VTPHDVNIDETFTQTKNLKAMNSRYVAAQFTPALFRSKSYV----DFVLGSNSPIESFHSNDWIFLKRLPVKKKTNLKAFLRACVIPEGLTSDLKSIPVERCTSSEWSMTFSTDINREIQVFTA--AVIAGIGSIVFLVFI-CIGFACFLKRSHSKISRPLGSTDPCLKQPLMMQPGLSGGNLPQYTNIVNIGNSSRHGYTDSLRTNSDLCATSGVMTPINNHQPLSVSNPMFEQRSLELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            G P     P D +   G +A   C+ + DP  +VTW K   +KV  N++RF+ +    G G+ L I+ +R   D   YEC+A N  G  +           +++ L  ++E + P     +D   +++V    + A + C A G+P P + W  +    +P S N   + L  E  P    + +  ++ T+ G Y C A N  G+     A + V+ + +AP      VS+  +   +  I  + V S  P   + +  +D + +D     R +                   ++T +K   NY    VA+S+ +G  +    I  ++L   P +P         +  SI VTW      +G       Y  E    + D  + I+E +  T Y +  L  N+ Y + V+A N  G GP S+  P++   G    +  P S P   +N++   LS+T++ I W  P +  + ++ GY + Y ++ D+    + ++         I +L   + Y + +   T  G G  +   +    + +  +  N +      S+ S  + W     +S +   + ++Y      +E++ T + AT+         + +  L+P++ Y                  L   +S  L   T+D    ++  KP A   ++K ++S S+ I  SW  P        +  Y + +  L +     K         K  P    + +L  L     Y+I V+A +  G G       I+T  +  VPS P    E+ +  S  I  F           W  P     HG I GY+V    +  G    +  +K V +    +   ++ D+ A+       + P  +Y   V A      G+ AR    +   R + P  P+    Q    ++ ++W PP      G I  Y++Q F  ++ +L       E +   + TN+ +   YVFK+    + G          +I  E  P   P+ IE   +    I+++W  P  A +   +      + V  S+ +    D P    +F          ++  + PN  Y ++++A  R         +   T    +   +N K +  + +T S+ ++WE P++YT    + I+          Y  + +E +  RT++              I +L P T Y+  +    +++  L+      +   ++ Q K +++  P P   ++  ++L    T+E + +   YY++V P+K++         +P +++++E       +   + R++     P  + +  +      F LG     + F +      K L + K+     F+ A +  EG  + +         +S +S     D      +      +I  IG ++ +VFI CI  A  L ++  K S P                                        T  L  N+++            H P   ++P      +E+++I N Q P ++ +         PPIP+  L      L+ANDN   SQEYES+DPGQQFTWE+SNLE+N+AKNRYANVIAYDHSR++L  + G++GSDYINANYIDGY++ NAYIATQG L  TFGDFWRMVWEQ +A++VMMTKLEE++RIKCDQYWP++GTE+Y  G I VT+ DT ELA + +RTF +   + S SSE      KRE+RQ+QFTAWPDHGVP+ P P L FL+R++  NP  + P++VHCSAGVGRTG FIVID  LERI+HE TVDI+G V++MR+QRNYMVQTEDQY F+H+ +L+AV   NTEV  +N+ T++QKL + +     +  TG+ELEF++L+  K + +R  SANLP N+ KNRLVNI+PYE  R+CLQPIRG EGSDYINAS+IDGY+  KAYIATQ PL ET EDFWRM+WE+NSTI+VMLTKLREMGREKCH+YWP ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRTVRQFQFT+WPEQGVP ++ E FI+FIGQVHKTKEQFGQ+GPI+VHCSAGVGRTGVF+ LSI LER++ EGV+D+FQ V+ LR QR  MVQ+E++Y+FCY AA +Y+ SFD +
Sbjct:   31 GKPKFIKIPTDEIGVSGGVASFVCQATGDPKPRVTWNKRG-KKV--NSQRFETIEFDEGAGAVLRIQPLRTPRDENVYECVAQNVHGEEV-----------VSAKLTVLREDQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPASSNGRIKQLRSENTPIRGALQIENSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPVSHEIMPGGNVNITCVAVGSPMPYVKWMVGAEDLTPEDDMPVGRNV------------------LELTNVKESANY--TCVAMSS-LGVIESVAQITVKSLPKAPGTP----VVTETTATSITVTW-----DSGNPDPVSYYVIEYKSKSQDGPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSE--PVVTRTG----EQAPASAP---RNVQARMLSSTTMIIQWEEP-VEPNGQIRGYRVYYTMEPDQPVSSWLKYNVDDSLLTTIGSLLEHETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNFRAEAK--SETSIGLTWSPPRQDSIVK--YELNYREGEGGNEIRKTFDPATS---------YTVEGLKPNTEYLF---------------RLAARSSHGLGAWTLDIKERTMQSKPSAPPRNVKCVSSKSTTILVSWLPPPAESQNGVLAGYSVRYSALDSDDTRPKEV-------KDIPPQTTQILLEALEKWTVYRITVVAHTEVGPGPESPPVEIRTDED--VPSAPPRKVEVEVLNSTAIKVF-----------WRSPVQNRQHGQIRGYQVHYVRMENGEASGLTLIKDVML----ADAQWEMDDTAEYEMVISGLQPETSYSVTVAAYTMK--GDGARSKPKLVTTRGAVPGKPDLFVHQNSDGSLLVEWEPP--RESEGHILGYRLQ-FGRQDVMLLSTLEFGELEKKYLATNIHKGATYVFKMAVKGRVGLS--EEAVKEFIVPEDTPKGFPQLIEKGIVTSMSIQLNWLPPVLAERNGVITKYTLAYRVAGSSEKLQEIDLPSSDNSF----------ILTDLNPNTVYEVKIRAHTRKGPGPYSPTVQYRTFLLDQVLPKNFK-VKMVTKT-SVLLSWEFPENYTSTMLYKIQ----------YNMHAVE-VDGRTTK------------KLITSLRPKTYYNFILTNRGNAMGGLQQTVAARTAPNMLGQ-KPMVTRKPDPDGSIT--VLLPEVETSEPVRI---YYIVVVPLKKSRDHFLNPLGSPEEMDLEELIQSIPKVHRRSLRHLLHLEFPRPYIAAGFRTLPGHFTLGDQKIHDGFEN------KALEIGKRYVF--FILAML--EGAEAKM-------FAASPYSDPIQIDDQDPQPIIDGEEGLIWVIGPVLAVVFIICIVIAILLYKNKRKNSDP---------------------------------------RTKCLLNNAEIAP----------HHP---TDP------VEMRRI-NFQTPGMLNH---------PPIPIADLSEHTEHLKANDNLKLSQEYESVDPGQQFTWEHSNLEVNKAKNRYANVIAYDHSRVILLPVEGIIGSDYINANYIDGYRKQNAYIATQGALPETFGDFWRMVWEQRSATVVMMTKLEEKSRIKCDQYWPSRGTETY--GMIQVTLLDTIELATFCVRTFSL---HKSGSSE------KREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPVVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVPARNLYTYIQKLAQIELG---EHVTGMELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFDHY 1912          

HSP 2 Score: 348.206 bits (892), Expect = 7.076e-96
Identity = 321/1155 (27.79%), Postives = 520/1155 (45.02%), Query Frame = 2
Query:  191 CQTSGQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVD--SNNERFQVVGT------GSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNP-PIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPY-YLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGV-SAQLTETTKDENILNEISNLKIWGTNISKDSATIC--WKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLD--QVKYYIIEWRELSNKSKNSKVFNVTVDINKS----NPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVA-----ISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQG--EKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPY--YISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQVSTNRDFPDGKITFKKI 3568
            CQ  G+ P  I + P D    +G     +C+A G+PKP V +   GK  ++     I      GA LR Q ++   + +V +C+A+N  G +  SA +TV+  + ++P+GFP I  GP   + +  + A + C  S +P  ++TW K+    VD  S+N R + + +      G+L I+N  ETD G YEC+ATN  G   S    L +R    +             P+        E+  G   N+TC A GSP+P V W   +G  +    ++ P+G      + + LT++ ES +Y C A + +G+I+  AQI VK  P AP     ++  ATS  + W     NP P+  Y +  K  S   P+              ++  +     + I  L   + YE+ V AV N+IG   PS P+  +T E  P+S P ++ A+ +S  ++ + W+ P++ NG+I+GYR+YYT      + +W    V D+    + +L+ + TY V+V A+   GDGP+SD   +    G          VP  P N R  + S TSI + W+ P       +  YEL YR +G E G   ++  +P  T Y ++ LKP   Y   LA ++  G+G  +  + E T          N+K     +S  S TI   W     ES+  +     Y + +   +   T       I   Q    +L  L   + Y + V  + +T+      V     S  + I T D D     P  V ++V+NST+ K+ W+ P++     Q++ Y + +  + N   +       V +  +    +    YE +++ L P   Y + V A + KG G+  K +++ T G   VP  P +L + Q+            ++ + W PP+ S G ILGYR+      + L+   EF +  K     + ++T  +K         G TY+F++     V   E A   + +PE+ P   P  +E +G     ++ L W PP +  RNG+ITKY + Y          +     S  + ++T+L  NT Y  KIRA  ++G GP+SP   Y  ++  +    P+N + K +    + +SW FPE          Q N   V+V       DG+ T K I
Sbjct:   27 CQFKGK-PKFI-KIPTDEIGVSGGVASFVCQATGDPKPRVTWNKRGKKVNSQRFETIEFDEGAGAVLRIQPLRTPRDENVYECVAQNVHGEEVVSAKLTVLRED-QLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKD-FLPVDPASSNGRIKQLRSENTPIRGALQIENSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVA-------------PRFSILPVSHEIMPGGNVNITCVAVGSPMPYVKW--MVGAEDLTPEDDMPVG-----RNVLELTNVKESANYTCVAMSSLGVIESVAQITVKSLPKAPGTPVVTETTATSITVTW--DSGNPDPVSYYVIEYKSKSQDGPY--------------QIKEDITTTRYSIGGLSPNSEYEIWVSAV-NSIGQGPPSEPVVTRTGEQAPASAPRNVQARMLSSTTMIIQWEEPVEPNGQIRGYRVYYTMEPDQPVSSWLKYNVDDSLLTTIGSLLEHETYTVRVLAFTSVGDGPLSDPIQVKTQQG----------VPGQPMNFRAEAKSETSIGLTWSPPR---QDSIVKYELNYR-EG-EGGNEIRKTFDP-ATSYTVEGLKPNTEYLFRLAARSSHGLGAWTLDIKERTMQSKPSAPPRNVKC----VSSKSTTILVSWLPPPAESQNGVL--AGYSVRYSALDSDDTRPKEVKDIP-PQTTQILLEALEKWTVYRITV--VAHTE------VGPGPESPPVEIRT-DEDVPSAPPRKVEVEVLNSTAIKVFWRSPVQNRQHGQIRGYQVHYVRMENGEASGLTLIKDVMLADAQWEMDDTAEYEMVISGLQPETSYSVTVAAYTMKGDGARSKPKLVTTRG--AVPGKP-DLFVHQN---------SDGSLLVEWEPPRESEGHILGYRLQFGRQDVMLLSTLEFGELEK-----KYLATNIHK---------GATYVFKMAVKGRVGLSEEAVKEFIVPEDTPKGFPQLIE-KGIVTSMSIQLNWLPPVLAERNGVITKYTLAYRVAGSSEKLQEIDLPSSDNSFILTDLNPNTVYEVKIRAHTRKGPGPYSPTVQYRTFLLDQVL--PKNFKVKMVTKTSVLLSWEFPENYTSTMLYKIQYNMHAVEV-------DGRTTKKLI 1072          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Xenopus
Match: brdt (bromodomain, testis-specific [Source:Xenbase;Acc:XB-GENE-983868])

HSP 1 Score: 952.199 bits (2460), Expect = 0.000e+0
Identity = 706/2133 (33.10%), Postives = 1070/2133 (50.16%), Query Frame = 2
Query:  515 GFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQVV----GTGS-LTIKNVRE-TDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEV-STGQGANLTCNAEGSPIPLVHW--EVQIGNPNSPNPENRPLGDEQPSSSTIHL--TDITESGSYVCHAKNKMGL-IKKEAQIIVKKKPMAPTL----VSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDN-WHIRE-VQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDES--KIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVD--NDSVPDKPEA--VSIKVINSTSSKI--SWKGPMKTLDQ--VKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPR---ELRMTQSVKIPSFKGPKRLAVYLAWNPP--QISHGLILGYRVAISLIGPPEFVK----ELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAP--PNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPA--PENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQVSTNR----DFPDGKITFKKIVGPFTSTVMEKIYPNH-YFIRVQAIIRDKRIAEWSNIHTLTVFKSKYTERNIKGLNCIGQTNSIKVTWEKPDDYTEIKSFLIELSGYRKFRNIYGAYKIEKIKARTSRIEFFGEEQSTYNYSIPNLEPNTNYDXXXXXXXXXXXXXXXXXXXXXCVTLMEQPKSILSPMPVPLRKVSNEIILRLSRTNEILGMISHYYLIVSPIKETH-------VTPHDVNIDETFTQTKNLKAMNSRYVAAQFTPALFRSKSYV----DFVLGSNSPIESFHSNDWIFLKRLPVKKKTNLKAFLRACVIPEGLTSDLKSIPVERC-TSSEWSMTFSTDINREIQVFTA--AVIAGIGSIVFLVFI-CIGFACFLKRSHSKISRPLGSTDPCLKQPLMMQPGLSGGNLPQYTNIVNIGNSSRHGYTDSLRTNSDLCATSGVMTPINNHQPLSVSNPMFEQRSLELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            G P     P D +   G +A   C+ + DP  +VTW K   +KV  N++RF+ +    G G+ L I+ +R   D   YEC+A N  G  +           +++ L  ++E + P     +D   +++V    + A + C A G+P P + W  +    +P S N   + L   + ++  + +  ++ T+ G Y C A N  G+     A + V+ + +AP      VS+  +   +  I  + V S  P   + +  +D + +D     R +                   ++T +K   NY    VA+S+ +G  +    I  ++L   P +P         +  SI VTW      +G       Y  E    + D  + I+E +  T Y +  L  N+ Y + V+A N  G GP S+  P++   G    +  P S P   +N++   LS+T++ I W  P +  + ++ GY + Y ++ D+    + ++         I +L   + Y + +   T  G G  +   +    + +  +  N +      S+ S  + W     +S  K  L +R                E    + T      + +  L+P++ Y                  L   +S  L   T+D    ++  KP A   ++K ++S S+ I  SW  P        +  Y + +  L +     K         K  P    + +L  L     Y+I V+A +  G G       I+T  +  VPS P    E+ +  S  I  F           W  P     HG I GY+V         +V+    E   + + ++V     +    + + P  +Y   V A      G+ AR    +   R + P  P+    Q    ++ ++W PP      G I  Y++Q F  ++ +L       E +   + TN+ +   YVFK+    + G          +I  E  P   P+ IE   +    I+++W  P  A +   +      + V  S+ +    D P    +F          ++  + PN  Y ++++A  R         +   T    +   +N K +  + +T S+ ++WE P++YT    + I+          Y  + +E +  RT++              I +L P T Y+  +    +++  L+      +   ++ Q K +++  P P   ++  ++L    T+E + +   YY++V P+K++         +P +++++E       +   + R++     P  + +  +      F LG     + F +      K L + K+     F+ A +  EG+       P+++   +S +S     D      +      +I  IG ++ +VFI CI  A  L ++  K S P                                        T  L  N+++            H P   ++P      +E+++I N Q P ++ +         PPIP+  L      L+ANDN   SQEYES+DPGQQFTWE+SNLE+N+AKNRYANVIAYDHSR++L  + G++GSDYINANYIDGY++ NAYIATQG L  TFGDFWRMVWEQ +A++VMMTKLEE++RIKCDQYWP++GTE+Y  G I VT+ DT ELA + +RTF +   + S SSE      KRE+RQ+QFTAWPDHGVP+ P P L FL+R++  NP  + P++VHCSAGVGRTG FIVID  LERI+HE TVDI+G V++MR+QRNYMVQTEDQY F+H+ +L+AV   NTEV  +N+ T++QKL + +     +  TG+ELEF++L+  K + +R  SANLP N+ KNRLVNI+PYE  R+CLQPIRG EGSDYINAS+IDGY+  KAYIATQ PL ET EDFWRM+WE+NSTI+VMLTKLREMGREKCH+YWP ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRTVRQFQFT+WPEQGVP ++ E FI+FIGQVHKTKEQFGQ+GPI+VHCSAGVGRTGVF+ LSI LER++ EGV+D+FQ V+ LR QR  MVQ+E++Y+FCY AA +Y+ SFD +
Sbjct:   22 GKPKFIKIPTDEIGVSGGVASFVCQATGDPKPRVTWNKRG-KKV--NSQRFETIEFDEGAGAVLRIQPLRTPRDENVYECVAQNVHGEEV-----------VSAKLTVLREDQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPASSNGRIKQLRSGKTTNCALQIENSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPVSHEIMPGGNVNITCVAVGSPMPYVKWMVGAEDLTPEDDMPVGRNV------------------LELTNVKESANY--TCVAMSS-LGVIESVAQITVKSLPKAPGTP----VVTETTATSITVTW-----DSGNPDPVSYYVIEYKSKSQDGPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSE--PVVTRTG----EQAPASAP---RNVQARMLSSTTMIIQWEEP-VEPNGQIRGYRVYYTMEPDQPVSSWLKYNVDDSLLTTIGSLLEHETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNFRAEAK--SETSIGLTWSPPRQDSIVKYELNYR--------------EGEGGNEVRTFDPATSYTVEGLKPNTEYLF---------------RLAARSSHGLGAWTLDIKERTMQSKPSAPPRNVKCVSSKSTTILVSWLPPPAESQNGVLAGYSVRYSALDSDDTRPKEV-------KDIPPQTTQILLEALEKWTVYRITVVAHTEVGPGPESPPVEIRTDED--VPSAPPRKVEVEVLNSTAIKVF-----------WRSPVQNRQHGQIRGYQV--------HYVRMENGEASGLTLIKDVMLADAQEMVISGLQPETSYSVTVAAYTMK--GDGARSKPKLVTTRGAVPGKPDLFVHQNSDGSLLVEWEPP--RESEGHILGYRLQ-FGRQDVMLLSTLEFGELEKKYLATNIHKGATYVFKMAVKGRVGLS--EEAVKEFIVPEDTPKGFPQLIEKGIVTSMSIQLNWLPPVLAERNGVITKYTLAYRVAGSSEKLQEIDLPSSDNSF----------ILTDLNPNTVYEVKIRAHTRKGPGPYSPTVQYRTFLLDQVLPKNFK-VKMVTKT-SVLLSWEFPENYTSTMLYKIQ----------YNMHAVE-VDGRTTK------------KLITSLRPKTYYNFILTNRGNAMGGLQQTVAARTAPNMLGQ-KPMVTRKPDPDGSIT--VLLPEVETSEPVRI---YYIVVVPLKKSRDHFLNPLGSPEEMDLEELIQSIPKVHRRSLRHLLHLEFPRPYIAAGFRTLPGHFTLGDQKIHDGFEN------KALEIGKRYVF--FILAML--EGIFF----FPMQKMFAASPYSDPIQIDDQDPQPIIDGEEGLIWVIGPVLAVVFIICIVIAILLYKNKRKNSDP---------------------------------------RTKCLLNNAEIAP----------HHP---TDP------VEMRRI-NFQTPGMLNH---------PPIPIADLSEHTEHLKANDNLKLSQEYESVDPGQQFTWEHSNLEVNKAKNRYANVIAYDHSRVILLPVEGIIGSDYINANYIDGYRKQNAYIATQGALPETFGDFWRMVWEQRSATVVMMTKLEEKSRIKCDQYWPSRGTETY--GMIQVTLLDTIELATFCVRTFSL---HKSGSSE------KREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPVVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVPARNLYTYIQKLAQIELG---EHVTGMELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFDHY 1896          

HSP 2 Score: 342.043 bits (876), Expect = 4.987e-94
Identity = 313/1137 (27.53%), Postives = 510/1137 (44.85%), Query Frame = 2
Query:  233 PLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVD--SNNERFQVVGTG-----SLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNP-PIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPY-YLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRL-DGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGV-SAQLTETTKDENILNEISNLKIWGTNISKDSATIC--WKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLD--QVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVA-----ISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQG--EKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPY--YISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQVSTNRDFPDGKITFKKI 3568
            P D    +G     +C+A G+PKP V +   GK  ++     I      GA LR Q ++   + +V +C+A+N  G +  SA +TV+  + ++P+GFP I  GP   + +  + A + C  S +P  ++TW K+    VD  S+N R + + +G     +L I+N  ETD G YEC+ATN  G   S    L +R    +             P+        E+  G   N+TC A GSP+P V W   +G  +    ++ P+G      + + LT++ ES +Y C A + +G+I+  AQI VK  P AP     ++  ATS  + W     NP P+  Y +  K  S   P+              ++  +     + I  L   + YE+ V AV N+IG   PS P+  +T E  P+S P ++ A+ +S  ++ + W+ P++ NG+I+GYR+YYT      + +W    V D+    + +L+ + TY V+V A+   GDGP+SD   +    G          VP  P N R  + S TSI + W+ P       +  YEL YR  +G  + + F        T Y ++ LKP   Y   LA ++  G+G  +  + E T          N+K     +S  S TI   W     ES+  +     Y + +   +   T       I   Q    +L  L   + Y + V  + +T+      V     S  + I T D D     P  V ++V+NST+ K+ W+ P++     Q++ Y + +  + N   +     +  D+  ++     E +++ L P   Y + V A + KG G+  K +++ T G   VP  P +L + Q+            ++ + W PP+ S G ILGYR+      + L+   EF +  K     + ++T  +K         G TY+F++     V   E A   + +PE+ P   P  +E +G     ++ L W PP +  RNG+ITKY + Y          +     S  + ++T+L  NT Y  KIRA  ++G GP+SP   Y  ++  +    P+N + K +    + +SW FPE          Q N   V+V       DG+ T K I
Sbjct:   30 PTDEIGVSGGVASFVCQATGDPKPRVTWNKRGKKVNSQRFETIEFDEGAGAVLRIQPLRTPRDENVYECVAQNVHGEEVVSAKLTVLRED-QLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKD-FLPVDPASSNGRIKQLRSGKTTNCALQIENSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVA-------------PRFSILPVSHEIMPGGNVNITCVAVGSPMPYVKW--MVGAEDLTPEDDMPVG-----RNVLELTNVKESANYTCVAMSSLGVIESVAQITVKSLPKAPGTPVVTETTATSITVTW--DSGNPDPVSYYVIEYKSKSQDGPY--------------QIKEDITTTRYSIGGLSPNSEYEIWVSAV-NSIGQGPPSEPVVTRTGEQAPASAPRNVQARMLSSTTMIIQWEEPVEPNGQIRGYRVYYTMEPDQPVSSWLKYNVDDSLLTTIGSLLEHETYTVRVLAFTSVGDGPLSDPIQVKTQQG----------VPGQPMNFRAEAKSETSIGLTWSPPR---QDSIVKYELNYREGEGGNEVRTFDP-----ATSYTVEGLKPNTEYLFRLAARSSHGLGAWTLDIKERTMQSKPSAPPRNVKC----VSSKSTTILVSWLPPPAESQNGVL--AGYSVRYSALDSDDTRPKEVKDIP-PQTTQILLEALEKWTVYRITV--VAHTE------VGPGPESPPVEIRT-DEDVPSAPPRKVEVEVLNSTAIKVFWRSPVQNRQHGQIRGYQVHYVRMENGEASG--LTLIKDVMLADAQ---EMVISGLQPETSYSVTVAAYTMKGDGARSKPKLVTTRG--AVPGKP-DLFVHQN---------SDGSLLVEWEPPRESEGHILGYRLQFGRQDVMLLSTLEFGELEK-----KYLATNIHK---------GATYVFKMAVKGRVGLSEEAVKEFIVPEDTPKGFPQLIE-KGIVTSMSIQLNWLPPVLAERNGVITKYTLAYRVAGSSEKLQEIDLPSSDNSFILTDLNPNTVYEVKIRAHTRKGPGPYSPTVQYRTFLLDQVL--PKNFKVKMVTKTSVLLSWEFPENYTSTMLYKIQYNMHAVEV-------DGRTTKKLI 1052          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Xenopus
Match: brdt (bromodomain, testis-specific [Source:Xenbase;Acc:XB-GENE-983868])

HSP 1 Score: 951.814 bits (2459), Expect = 0.000e+0
Identity = 706/2123 (33.25%), Postives = 1069/2123 (50.35%), Query Frame = 2
Query:  539 PIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQVV----GTGS-LTIKNVRE-TDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEV-STGQGANLTCNAEGSPIPLVHW--EVQIGNPNSPNPENRPLGDEQ-PSSSTIHL--TDITESGSYVCHAKNKMGL-IKKEAQIIVKKKPMAPTL----VSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDN-WHIRE-VQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVD--NDSVPDKPEA--VSIKVINSTSSKI--SWKGPMKTLDQ--VKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPR---ELRMTQSVKIPSFKGPKRLAVYLAWNPP--QISHGLILGYRVAISLIGPPEFVK----ELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAP--PNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPA--PENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQVSTNR----DFPDGKITFKKIVGPFTSTVMEKIYPNH-YFIRVQAIIRDKRIAEWSNIHTLTVFKSKYTERNIKGLNCIGQTNSIKVTWEKPDDYTEIKSFLIELSGYRKFRNIYGAYKIEKIKARTSRIEFFGEEQSTYNYSIPNLEPNTNYDXXXXXXXXXXXXXXXXXXXXXCVTLMEQPKSILSPMPVPLRKVSNEIILRLSRTNEILGMISHYYLIVSPIKETH-------VTPHDVNIDETFTQTKNLKAMNSRYVAAQFTPALFRSKSYV----DFVLGSNSPIESFHSNDWIFLKRLPVKKKTNLKAFLRACVIPEGLTSDLKSIPVERCTSSEWSMTFSTDINREIQVFTA--AVIAGIGSIVFLVFI-CIGFACFLKRSHSKISRPLGSTDPCLKQPLMMQPGLSGGNLPQYTNIVNIGNSSRHGYTDSLRTNSDLCATSGVMTPINNHQPLSVSNPMFEQRSLELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            P D +   G +A   C+ + DP  +VTW K   +KV  N++RF+ +    G G+ L I+ +R   D   YEC+A N  G  +           +++ L  ++E + P     +D   +++V    + A + C A G+P P + W  +    +P S N   + L  E  P    + +  ++ T+ G Y C A N  G+     A + V+ + +AP      VS+  +   +  I  + V S  P   + +  +D + +D     R +                   ++T +K   NY    VA+S+ +G  +    I  ++L   P +P         +  SI VTW      +G       Y  E    + D  + I+E +  T Y +  L  N+ Y + V+A N  G GP S+  P++   G    +  P S P   +N++   LS+T++ I W  P +  + ++ GY + Y ++ D+    + ++         I +L   + Y + +   T  G G  +   +    + +  +  N +      S+ S  + W     +S +   + ++Y      +E++ T + AT+         + +  L+P++ Y                  L   +S  L   T+D    ++  KP A   ++K ++S S+ I  SW  P        +  Y + +  L +     K         K  P    + +L  L     Y+I V+A +  G G       I+T  +  VPS P    E+ +  S  I  F           W  P     HG I GY+V         +V+    E   + + ++V     +    + + P  +Y   V A      G+ AR    +   R + P  P+    Q    ++ ++W PP      G I  Y++Q F  ++ +L       E +   + TN+ +   YVFK+    + G          +I  E  P   P+ IE   +    I+++W  P  A +   +      + V  S+ +    D P    +F          ++  + PN  Y ++++A  R         +   T    +   +N K +  + +T S+ ++WE P++YT    + I+          Y  + +E +  RT++              I +L P T Y+  +    +++  L+      +   ++ Q K +++  P P   ++  ++L    T+E + +   YY++V P+K++         +P +++++E       +   + R++     P  + +  +      F LG     + F +      K L + K+     F+ A +  EG  + +         +S +S     D      +      +I  IG ++ +VFI CI  A  L ++  K S P                                        T  L  N+++            H P   ++P      +E+++I N Q P        I     PPIP+  L      L+ANDN   SQEYES+DPGQQFTWE+SNLE+N+AKNRYANVIAYDHSR++L  + G++GSDYINANYIDGY++ NAYIATQG L  TFGDFWRMVWEQ +A++VMMTKLEE++RIKCDQYWP++GTE+Y  G I VT+ DT ELA + +RTF +   + S SSE      KRE+RQ+QFTAWPDHGVP+ P P L FL+R++  NP  + P++VHCSAGVGRTG FIVID  LERI+HE TVDI+G V++MR+QRNYMVQTEDQY F+H+ +L+AV   NTEV  +N+ T++QKL + +     +  TG+ELEF++L+  K + +R  SANLP N+ KNRLVNI+PYE  R+CLQPIRG EGSDYINAS+IDGY+  KAYIATQ PL ET EDFWRM+WE+NSTI+VMLTKLREMGREKCH+YWP ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRTVRQFQFT+WPEQGVP ++ E FI+FIGQVHKTKEQFGQ+GPI+VHCSAGVGRTGVF+ LSI LER++ EGV+D+FQ V+ LR QR  MVQ+E++Y+FCY AA +Y+ SFD +
Sbjct:   30 PTDEIGVSGGVASFVCQATGDPKPRVTWNKRG-KKV--NSQRFETIEFDEGAGAVLRIQPLRTPRDENVYECVAQNVHGEEV-----------VSAKLTVLREDQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPASSNGRIKQLRSENTPIRGALQIENSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPVSHEIMPGGNVNITCVAVGSPMPYVKWMVGAEDLTPEDDMPVGRNV------------------LELTNVKESANY--TCVAMSS-LGVIESVAQITVKSLPKAPGTP----VVTETTATSITVTW-----DSGNPDPVSYYVIEYKSKSQDGPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSE--PVVTRTG----EQAPASAP---RNVQARMLSSTTMIIQWEEP-VEPNGQIRGYRVYYTMEPDQPVSSWLKYNVDDSLLTTIGSLLEHETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNFRAEAK--SETSIGLTWSPPRQDSIVK--YELNYREGEGGNEIRKTFDPATS---------YTVEGLKPNTEYLF---------------RLAARSSHGLGAWTLDIKERTMQSKPSAPPRNVKCVSSKSTTILVSWLPPPAESQNGVLAGYSVRYSALDSDDTRPKEV-------KDIPPQTTQILLEALEKWTVYRITVVAHTEVGPGPESPPVEIRTDED--VPSAPPRKVEVEVLNSTAIKVF-----------WRSPVQNRQHGQIRGYQV--------HYVRMENGEASGLTLIKDVMLADAQEMVISGLQPETSYSVTVAAYTMK--GDGARSKPKLVTTRGAVPGKPDLFVHQNSDGSLLVEWEPP--RESEGHILGYRLQ-FGRQDVMLLSTLEFGELEKKYLATNIHKGATYVFKMAVKGRVGLS--EEAVKEFIVPEDTPKGFPQLIEKGIVTSMSIQLNWLPPVLAERNGVITKYTLAYRVAGSSEKLQEIDLPSSDNSF----------ILTDLNPNTVYEVKIRAHTRKGPGPYSPTVQYRTFLLDQVLPKNFK-VKMVTKT-SVLLSWEFPENYTSTMLYKIQ----------YNMHAVE-VDGRTTK------------KLITSLRPKTYYNFILTNRGNAMGGLQQTVAARTAPNMLGQ-KPMVTRKPDPDGSIT--VLLPEVETSEPVRI---YYIVVVPLKKSRDHFLNPLGSPEEMDLEELIQSIPKVHRRSLRHLLHLEFPRPYIAAGFRTLPGHFTLGDQKIHDGFEN------KALEIGKRYVF--FILAML--EGAEAKM-------FAASPYSDPIQIDDQDPQPIIDGEEGLIWVIGPVLAVVFIICIVIAILLYKNKRKNSDP---------------------------------------RTKCLLNNAEIAP----------HHP---TDP------VEMRRI-NFQTPG------KIGMLNHPPIPIADLSEHTEHLKANDNLKLSQEYESVDPGQQFTWEHSNLEVNKAKNRYANVIAYDHSRVILLPVEGIIGSDYINANYIDGYRKQNAYIATQGALPETFGDFWRMVWEQRSATVVMMTKLEEKSRIKCDQYWPSRGTETY--GMIQVTLLDTIELATFCVRTFSL---HKSGSSE------KREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPVVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVPARNLYTYIQKLAQIELG---EHVTGMELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFDHY 1897          

HSP 2 Score: 347.051 bits (889), Expect = 1.593e-95
Identity = 318/1149 (27.68%), Postives = 519/1149 (45.17%), Query Frame = 2
Query:  197 TSGQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVD--SNNERFQVVGT------GSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNP-PIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPY-YLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGV-SAQLTETTKDENILNEISNLKIWGTNISKDSATIC--WKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLD--QVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVA-----ISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQG--EKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPY--YISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQVSTNRDFPDGKITFKKI 3568
            ++G  P  I + P D    +G     +C+A G+PKP V +   GK  ++     I      GA LR Q ++   + +V +C+A+N  G +  SA +TV+  + ++P+GFP I  GP   + +  + A + C  S +P  ++TW K+    VD  S+N R + + +      G+L I+N  ETD G YEC+ATN  G   S    L +R    +             P+        E+  G   N+TC A GSP+P V W   +G  +    ++ P+G      + + LT++ ES +Y C A + +G+I+  AQI VK  P AP     ++  ATS  + W     NP P+  Y +  K  S   P+              ++  +     + I  L   + YE+ V AV N+IG   PS P+  +T E  P+S P ++ A+ +S  ++ + W+ P++ NG+I+GYR+YYT      + +W    V D+    + +L+ + TY V+V A+   GDGP+SD   +    G          VP  P N R  + S TSI + W+ P       +  YEL YR +G E G   ++  +P  T Y ++ LKP   Y   LA ++  G+G  +  + E T          N+K     +S  S TI   W     ES+  +     Y + +   +   T       I   Q    +L  L   + Y + V  + +T+      V     S  + I T D D     P  V ++V+NST+ K+ W+ P++     Q++ Y + +  + N   +     +  D+  ++     E +++ L P   Y + V A + KG G+  K +++ T G   VP  P +L + Q+            ++ + W PP+ S G ILGYR+      + L+   EF +  K     + ++T  +K         G TY+F++     V   E A   + +PE+ P   P  +E +G     ++ L W PP +  RNG+ITKY + Y          +     S  + ++T+L  NT Y  KIRA  ++G GP+SP   Y  ++  +    P+N + K +    + +SW FPE          Q N   V+V       DG+ T K I
Sbjct:   19 STGSKPKFI-KIPTDEIGVSGGVASFVCQATGDPKPRVTWNKRGKKVNSQRFETIEFDEGAGAVLRIQPLRTPRDENVYECVAQNVHGEEVVSAKLTVLRED-QLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKD-FLPVDPASSNGRIKQLRSENTPIRGALQIENSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVA-------------PRFSILPVSHEIMPGGNVNITCVAVGSPMPYVKW--MVGAEDLTPEDDMPVG-----RNVLELTNVKESANYTCVAMSSLGVIESVAQITVKSLPKAPGTPVVTETTATSITVTW--DSGNPDPVSYYVIEYKSKSQDGPY--------------QIKEDITTTRYSIGGLSPNSEYEIWVSAV-NSIGQGPPSEPVVTRTGEQAPASAPRNVQARMLSSTTMIIQWEEPVEPNGQIRGYRVYYTMEPDQPVSSWLKYNVDDSLLTTIGSLLEHETYTVRVLAFTSVGDGPLSDPIQVKTQQG----------VPGQPMNFRAEAKSETSIGLTWSPPR---QDSIVKYELNYR-EG-EGGNEIRKTFDP-ATSYTVEGLKPNTEYLFRLAARSSHGLGAWTLDIKERTMQSKPSAPPRNVKC----VSSKSTTILVSWLPPPAESQNGVL--AGYSVRYSALDSDDTRPKEVKDIP-PQTTQILLEALEKWTVYRITV--VAHTE------VGPGPESPPVEIRT-DEDVPSAPPRKVEVEVLNSTAIKVFWRSPVQNRQHGQIRGYQVHYVRMENGEASG--LTLIKDVMLADAQ---EMVISGLQPETSYSVTVAAYTMKGDGARSKPKLVTTRG--AVPGKP-DLFVHQN---------SDGSLLVEWEPPRESEGHILGYRLQFGRQDVMLLSTLEFGELEK-----KYLATNIHK---------GATYVFKMAVKGRVGLSEEAVKEFIVPEDTPKGFPQLIE-KGIVTSMSIQLNWLPPVLAERNGVITKYTLAYRVAGSSEKLQEIDLPSSDNSFILTDLNPNTVYEVKIRAHTRKGPGPYSPTVQYRTFLLDQVL--PKNFKVKMVTKTSVLLSWEFPENYTSTMLYKIQYNMHAVEV-------DGRTTKKLI 1054          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Xenopus
Match: brdt (bromodomain, testis-specific [Source:Xenbase;Acc:XB-GENE-983868])

HSP 1 Score: 951.429 bits (2458), Expect = 0.000e+0
Identity = 706/2109 (33.48%), Postives = 1060/2109 (50.26%), Query Frame = 2
Query:  539 PIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQVV----GTGS-LTIKNVRE-TDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEV-STGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGL-IKKEAQIIVKKKPMAPTL----VSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDN-WHIRE-VQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDES--KIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKI--SWKGPMKTLDQ--VKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPR---ELRMTQSVKIPSFKGPKRLAVYLAWNPP--QISHGLILGYRVAISLIGPPEFVK----ELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAP--PNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPA--PENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQVSTNR----DFPDGKITFKKIVGPFTSTVMEKIYPNH-YFIRVQAIIRDKRIAEWSNIHTLTVFKSKYTERNIKGLNCIGQTNSIKVTWEKPDDYTEIKSFLIELSGYRKFRNIYGAYKIEKIKARTSRIEFFGEEQSTYNYSIPNLEPNTNYDXXXXXXXXXXXXXXXXXXXXXCVTLMEQPKSILSPMPVPLRKVSNEIILRLSRTNEILGMISHYYLIVSPIKETHVTPHDVNIDETF----TQTKNLKAMNSRYVAAQFTPALFRSKSYVDFVLGSNSPIESFHSNDWIFLKRLPVKKKTNLKAFLRACVIPEGLTSDLKSIPVERCTSSEWSMTFSTDINREIQVFTAAVIAGIGSIVFLVFI-CIGFACFLKRSHSKISRPLGSTDPCLKQPLMMQPGLSGGNLPQYTNIVNIGNSSRHGYTD--SLRTNSDLCATSGVMTPINNHQPLSVSNPMFEQRSLELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            P D +   G +A   C+ + DP  +VTW K   +KV  N++RF+ +    G G+ L I+ +R   D   YEC+A N  G  +           +++ L  ++E + P     +D   +++V    + A + C A G+P P + W  +   P  P   N  +   +  +  I  ++ T+ G Y C A N  G+     A + V+ + +AP      VS+  +   +  I  + V S  P   + +  +D + +D     R +                   ++T +K   NY    VA+S+ +G  +    I  ++L   P +P         +  SI VTW      +G       Y  E    + D  + I+E +  T Y +  L  N+ Y + V+A N  G GP S+  P++   G    +  P S P   +N++   LS+T++ I W  P +  + ++ GY + Y ++ D+    + ++         I +L   + Y + +   T  G G  +   +    + +  +  N +      S+ S  + W     +S  K  L +R    +   I   + T + AT+         + +  L+P++ Y   +    +       + +K+ T            S P  P   ++K ++S S+ I  SW  P        +  Y + +  L +     K         K  P    + +L  L     Y+I V+A +  G G       I+T  +  VPS P    E+ +  S  I  F           W  P     HG I GY+V         +V+    E   + + ++V     +    + + P  +Y   V A      G+ AR    +   R + P  P+    Q    ++ ++W PP      G I  Y++Q F  ++ +L       E +   + TN+ +   YVFK+    + G          +I  E  P   P+ IE   +    I+++W  P  A +   +      + V  S+ +    D P    +F          ++  + PN  Y ++++A  R         +   T    +   RN K +  + +T S+ ++WE P++YT    + I+          Y  + +E +  RT++              I +L P T Y+  +    +++  L+      +   ++ Q K +++  P P   ++  ++L    T+EI      YY++V P+K++    H +N   T+       ++L+ +        +  A FR+     F LG     + F +      K L + K+     F+ A +  +   +   S P++                + I      +I  IG ++ +VFI CI  A  L ++  K S P      CL                     +N    + H  TD   +R  +     SG+ +P ++H+              + + + N                  PPIP+  L      L+ANDN   SQEYES+DPGQQFTWE+SNLE+N+AKNRYANVIAYDHSR++L  + G++GSDYINANYIDGY++ NAYIATQG L  TFGDFWRMVWEQ +A++VMMTKLEE++RIKCDQYWP++GTE+Y  G I VT+ DT ELA + +RTF +   + S SSE      KRE+RQ+QFTAWPDHGVP+ P P L FL+R++  NP  + P++VHCSAGVGRTG FIVID  LERI+HE TVDI+G V++MR+QRNYMVQTEDQY F+H+ +L+AV   NTEV  +N+ T++QKL + +     +  TG+ELEF++L+  K + +R  SANLP N+ KNRLVNI+PYE  R+CLQPIRG EGSDYINAS+IDGY+  KAYIATQ PL ET EDFWRM+WE+NSTI+VMLTKLREMGREKCH+YWP ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRTVRQFQFT+WPEQGVP ++ E FI+FIGQVHKTKEQFGQ+GPI+VHCSAGVGRTGVF+ LSI LER++ EGV+D+FQ V+ LR QR  MVQ+E++Y+FCY AA +Y+ SFD +
Sbjct:   30 PTDEIGVSGGVASFVCQATGDPKPRVTWNKRG-KKV--NSQRFETIEFDEGAGAVLRIQPLRTPRDENVYECVAQNVHGEEV-----------VSAKLTVLREDQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITW-FKDFLPVDPASSNGRIKQLRSGALQIENSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPVSHEIMPGGNVNITCVAVGSPMPYVKWMVGAEDLTPEDDMPVGRNV------------------LELTNVKESANY--TCVAMSS-LGVIESVAQITVKSLPKAPGTP----VVTETTATSITVTW-----DSGNPDPVSYYVIEYKSKSQDGPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSE--PVVTRTG----EQAPASAP---RNVQARMLSSTTMIIQWEEP-VEPNGQIRGYRVYYTMEPDQPVSSWLKYNVDDSLLTTIGSLLEHETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNFRAEAK--SETSIGLTWSPPRQDSIVKYELNYREGEGVFLQI---RKTFDPATS---------YTVEGLKPNTEYLFRLAARSSHGLGAWTLDIKERTMQ----------SKPSAPPR-NVKCVSSKSTTILVSWLPPPAESQNGVLAGYSVRYSALDSDDTRPKEV-------KDIPPQTTQILLEALEKWTVYRITVVAHTEVGPGPESPPVEIRTDED--VPSAPPRKVEVEVLNSTAIKVF-----------WRSPVQNRQHGQIRGYQV--------HYVRMENGEASGLTLIKDVMLADAQEMVISGLQPETSYSVTVAAYTMK--GDGARSKPKLVTTRGAVPGKPDLFVHQNSDGSLLVEWEPP--RESEGHILGYRLQ-FGRQDVMLLSTLEFGELEKKYLATNIHKGATYVFKMAVKGRVGLS--EEAVKEFIVPEDTPKGFPQLIEKGIVTSMSIQLNWLPPVLAERNGVITKYTLAYRVAGSSEKLQEIDLPSSDNSF----------ILTDLNPNTVYEVKIRAHTRKGPGPYSPTVQYRTFLLDQ--GRNFK-VKMVTKT-SVLLSWEFPENYTSTMLYKIQ----------YNMHAVE-VDGRTTK------------KLITSLRPKTYYNFILTNRGNAMGGLQQTVAARTAPNMLGQ-KPMVTRKPDPDGSIT--VLLPEVETSEI------YYIVVVPLKKSR--DHFLNPLGTYFTGYIHRRSLRHLLHLEFPRPYIAAGFRTLPG-HFTLGDQKIHDGFEN------KALEIGKRYVF--FILAMLEGKMFAASPYSDPIQ----------IDDQDPQPIIDGEEGLIWVIGPVLAVVFIICIVIAILLYKNKRKNSDPRTK---CL---------------------LNNAEIAPHHPTDPVEMRRINFQTPDSGLSSPPSDHE-------------FDFESMLN-----------------HPPIPIADLSEHTEHLKANDNLKLSQEYESVDPGQQFTWEHSNLEVNKAKNRYANVIAYDHSRVILLPVEGIIGSDYINANYIDGYRKQNAYIATQGALPETFGDFWRMVWEQRSATVVMMTKLEEKSRIKCDQYWPSRGTETY--GMIQVTLLDTIELATFCVRTFSL---HKSGSSE------KREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPVVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVPARNLYTYIQKLAQIELG---EHVTGMELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFDHY 1887          

HSP 2 Score: 349.747 bits (896), Expect = 1.883e-96
Identity = 315/1141 (27.61%), Postives = 514/1141 (45.05%), Query Frame = 2
Query:  197 TSGQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVD--SNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNP-PIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPY-YLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGV-SAQLTETTKDENILNEISNLKIWGTNISKDSATIC--WKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLD--QVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVA-----ISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQG--EKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQVSTNRDFPDGKITFKKI 3568
            ++G  P  I + P D    +G     +C+A G+PKP V +   GK  ++     I      GA LR Q ++   + +V +C+A+N  G +  SA +TV+  + ++P+GFP I  GP   + +  + A + C  S +P  ++TW K+    VD  S+N R + + +G+L I+N  ETD G YEC+ATN  G   S    L +R    +             P+        E+  G   N+TC A GSP+P V W   +G  +    ++ P+G      + + LT++ ES +Y C A + +G+I+  AQI VK  P AP     ++  ATS  + W     NP P+  Y +  K  S   P+              ++  +     + I  L   + YE+ V AV N+IG   PS P+  +T E  P+S P ++ A+ +S  ++ + W+ P++ NG+I+GYR+YYT      + +W    V D+    + +L+ + TY V+V A+   GDGP+SD   +    G          VP  P N R  + S TSI + W+ P       +  YEL YR +G+      ++  +P  T Y ++ LKP   Y   LA ++  G+G  +  + E T          N+K     +S  S TI   W     ES+  +     Y + +   +   T       I   Q    +L  L   + Y + V  + +T+      V     S  + I T D D     P  V ++V+NST+ K+ W+ P++     Q++ Y + +  + N   +     +  D+  ++     E +++ L P   Y + V A + KG G+  K +++ T G   VP  P +L + Q+            ++ + W PP+ S G ILGYR+      + L+   EF +  K     + ++T  +K         G TY+F++     V   E A   + +PE+ P   P  +E +G     ++ L W PP +  RNG+ITKY + Y          +     S  + ++T+L  NT Y  KIRA  ++G GP+SP   Y   +       N + K +    + +SW FPE          Q N   V+V       DG+ T K I
Sbjct:   19 STGSKPKFI-KIPTDEIGVSGGVASFVCQATGDPKPRVTWNKRGKKVNSQRFETIEFDEGAGAVLRIQPLRTPRDENVYECVAQNVHGEEVVSAKLTVLRED-QLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKD-FLPVDPASSNGRIKQLRSGALQIENSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVA-------------PRFSILPVSHEIMPGGNVNITCVAVGSPMPYVKW--MVGAEDLTPEDDMPVG-----RNVLELTNVKESANYTCVAMSSLGVIESVAQITVKSLPKAPGTPVVTETTATSITVTW--DSGNPDPVSYYVIEYKSKSQDGPY--------------QIKEDITTTRYSIGGLSPNSEYEIWVSAV-NSIGQGPPSEPVVTRTGEQAPASAPRNVQARMLSSTTMIIQWEEPVEPNGQIRGYRVYYTMEPDQPVSSWLKYNVDDSLLTTIGSLLEHETYTVRVLAFTSVGDGPLSDPIQVKTQQG----------VPGQPMNFRAEAKSETSIGLTWSPPR---QDSIVKYELNYR-EGEGVFLQIRKTFDP-ATSYTVEGLKPNTEYLFRLAARSSHGLGAWTLDIKERTMQSKPSAPPRNVKC----VSSKSTTILVSWLPPPAESQNGVL--AGYSVRYSALDSDDTRPKEVKDIP-PQTTQILLEALEKWTVYRITV--VAHTE------VGPGPESPPVEIRT-DEDVPSAPPRKVEVEVLNSTAIKVFWRSPVQNRQHGQIRGYQVHYVRMENGEASG--LTLIKDVMLADAQ---EMVISGLQPETSYSVTVAAYTMKGDGARSKPKLVTTRG--AVPGKP-DLFVHQN---------SDGSLLVEWEPPRESEGHILGYRLQFGRQDVMLLSTLEFGELEK-----KYLATNIHK---------GATYVFKMAVKGRVGLSEEAVKEFIVPEDTPKGFPQLIE-KGIVTSMSIQLNWLPPVLAERNGVITKYTLAYRVAGSSEKLQEIDLPSSDNSFILTDLNPNTVYEVKIRAHTRKGPGPYSPTVQY--RTFLLDQGRNFKVKMVTKTSVLLSWEFPENYTSTMLYKIQYNMHAVEV-------DGRTTKKLI 1047          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Xenopus
Match: brdt (bromodomain, testis-specific [Source:Xenbase;Acc:XB-GENE-983868])

HSP 1 Score: 951.429 bits (2458), Expect = 0.000e+0
Identity = 707/2128 (33.22%), Postives = 1074/2128 (50.47%), Query Frame = 2
Query:  539 PIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQVV----GTGS-LTIKNVRE-TDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEV-STGQGANLTCNAEGSPIPLVHW--EVQIGNPNSPNPENRPLGDEQ-PSSSTIHL--TDITESGSYVCHAKNKMGL-IKKEAQIIVKKKPMAPTL----VSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDN-WHIRE-VQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVD--NDSVPDKPEA--VSIKVINSTSSKI--SWKGPMKTLDQ--VKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPR---ELRMTQSVKIPSFKGPKRLAVYLAWNPP--QISHGLILGYRVAISLI--GPPEFVKELKPVKIYRNVSTETYKSDEEAK-------IGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAP--PNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPA--PENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQVSTNR----DFPDGKITFKKIVGPFTSTVMEKIYPNH-YFIRVQAIIRDKRIAEWSNIHTLTVFKSKYTERNIKGLNCIGQTNSIKVTWEKPDDYTEIKSFLIELSGYRKFRNIYGAYKIEKIKARTSRIEFFGEEQSTYNYSIPNLEPNTNYDXXXXXXXXXXXXXXXXXXXXXCVTLMEQPKSILSPMPVPLRKVSNEIILRLSRTNEILGMISHYYLIVSPIKETH-------VTPHDVNIDETFTQTKNLKAMNSRYVAAQFTPALFRSKSYV----DFVLGSNSPIESFHSNDWIFLKRLPVKKKTNLKAFLRACVIPEGLTSDLKSIPVERCTSSEWSMTFSTDINREIQVFTA--AVIAGIGSIVFLVFI-CIGFACFLKRSHSKISRPLGSTDPCLKQPLMMQPGLSGGNLPQYTNIVNIGNSSRHGYTDSLRTNSDLCATSGVMTPINNHQPLSVSNPMFEQRSLELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            P D +   G +A   C+ + DP  +VTW K   +KV  N++RF+ +    G G+ L I+ +R   D   YEC+A N  G  +           +++ L  ++E + P     +D   +++V    + A + C A G+P P + W  +    +P S N   + L  E  P    + +  ++ T+ G Y C A N  G+     A + V+ + +AP      VS+  +   +  I  + V S  P   + +  +D + +D     R +                   ++T +K   NY    VA+S+ +G  +    I  ++L   P +P         +  SI VTW      +G       Y  E    + D  + I+E +  T Y +  L  N+ Y + V+A N  G GP S+  P++   G    +  P S P   +N++   LS+T++ I W  P +  + ++ GY + Y ++ D+    + ++         I +L   + Y + +   T  G G  +   +    + +  +  N +      S+ S  + W     +S +   + ++Y      +E++ T + AT+         + +  L+P++ Y                  L   +S  L   T+D    ++  KP A   ++K ++S S+ I  SW  P        +  Y + +  L +     K         K  P    + +L  L     Y+I V+A +  G G       I+T  +  VPS P    E+ +  S  I  F           W  P     HG I GY+V    +  G    +  +K V +    +   ++ D+ A+       + P  +Y   V A      G+ AR    +   R + P  P+    Q    ++ ++W PP      G I  Y++Q F  ++ +L       E +   + TN+ +   YVFK+    + G          +I  E  P   P+ IE   +    I+++W  P  A +   +      + V  S+ +    D P    +F          ++  + PN  Y ++++A  R         +   T    +   +N K +  + +T S+ ++WE P++YT    + I+          Y  + +E +  RT++              I +L P T Y+  +    +++  L+      +   ++ Q K +++  P P   ++  ++L    T+E + +   YY++V P+K++         +P +++++E       +   + R++     P  + +  +      F LG     + F +      K L + K+     F+ A +  EG  + +         +S +S     D      +      +I  IG ++ +VFI CI  A  L ++  K S P                                        T  L  N+++            H P   ++P      +E+++I N Q P ++ +         PPIP+  L      L+ANDN   SQEYES+DPGQQFTWE+SNLE+N+AKNRYANVIAYDHSR++L  + G++GSDYINANYIDGY++ NAYIATQG L  TFGDFWRMVWEQ +A++VMMTKLEE++RIKCDQYWP++GTE+Y  G I VT+ DT ELA + +RTF +   + S SSE      KRE+RQ+QFTAWPDHGVP+ P P L FL+R++  NP  + P++VHCSAGVGRTG FIVID  LERI+HE TVDI+G V++MR+QRNYMVQTEDQY F+H+ +L+AV   NTEV  +N+ T++QKL + +     +  TG+ELEF++L+  K + +R  SANLP N+ KNRLVNI+PYE  R+CLQPIRG EGSDYINAS+IDGY+  KAYIATQ PL ET EDFWRM+WE+NSTI+VMLTKLREMGREKCH+YWP ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRTVRQFQFT+WPEQGVP ++ E FI+FIGQVHKTKEQFGQ+GPI+VHCSAGVGRTGVF+ LSI LER++ EGV+D+FQ V+ LR QR  MVQ+E++Y+FCY AA +Y+ SFD +
Sbjct:   30 PTDEIGVSGGVASFVCQATGDPKPRVTWNKRG-KKV--NSQRFETIEFDEGAGAVLRIQPLRTPRDENVYECVAQNVHGEEV-----------VSAKLTVLREDQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPASSNGRIKQLRSENTPIRGALQIENSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPVSHEIMPGGNVNITCVAVGSPMPYVKWMVGAEDLTPEDDMPVGRNV------------------LELTNVKESANY--TCVAMSS-LGVIESVAQITVKSLPKAPGTP----VVTETTATSITVTW-----DSGNPDPVSYYVIEYKSKSQDGPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSE--PVVTRTG----EQAPASAP---RNVQARMLSSTTMIIQWEEP-VEPNGQIRGYRVYYTMEPDQPVSSWLKYNVDDSLLTTIGSLLEHETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNFRAEAK--SETSIGLTWSPPRQDSIVK--YELNYREGEGGNEIRKTFDPATS---------YTVEGLKPNTEYLF---------------RLAARSSHGLGAWTLDIKERTMQSKPSAPPRNVKCVSSKSTTILVSWLPPPAESQNGVLAGYSVRYSALDSDDTRPKEV-------KDIPPQTTQILLEALEKWTVYRITVVAHTEVGPGPESPPVEIRTDED--VPSAPPRKVEVEVLNSTAIKVF-----------WRSPVQNRQHGQIRGYQVHYVRMENGEASGLTLIKDVML----ADAQWEMDDTAEYEMVISGLQPETSYSVTVAAYTMK--GDGARSKPKLVTTRGAVPGKPDLFVHQNSDGSLLVEWEPP--RESEGHILGYRLQ-FGRQDVMLLSTLEFGELEKKYLATNIHKGATYVFKMAVKGRVGLS--EEAVKEFIVPEDTPKGFPQLIEKGIVTSMSIQLNWLPPVLAERNGVITKYTLAYRVAGSSEKLQEIDLPSSDNSF----------ILTDLNPNTVYEVKIRAHTRKGPGPYSPTVQYRTFLLDQVLPKNFK-VKMVTKT-SVLLSWEFPENYTSTMLYKIQ----------YNMHAVE-VDGRTTK------------KLITSLRPKTYYNFILTNRGNAMGGLQQTVAARTAPNMLGQ-KPMVTRKPDPDGSIT--VLLPEVETSEPVRI---YYIVVVPLKKSRDHFLNPLGSPEEMDLEELIQSIPKVHRRSLRHLLHLEFPRPYIAAGFRTLPGHFTLGDQKIHDGFEN------KALEIGKRYVF--FILAML--EGAEAKM-------FAASPYSDPIQIDDQDPQPIIDGEEGLIWVIGPVLAVVFIICIVIAILLYKNKRKNSDP---------------------------------------RTKCLLNNAEIAP----------HHP---TDP------VEMRRI-NFQTPGMLNH---------PPIPIADLSEHTEHLKANDNLKLSQEYESVDPGQQFTWEHSNLEVNKAKNRYANVIAYDHSRVILLPVEGIIGSDYINANYIDGYRKQNAYIATQGALPETFGDFWRMVWEQRSATVVMMTKLEEKSRIKCDQYWPSRGTETY--GMIQVTLLDTIELATFCVRTFSL---HKSGSSE------KREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPVVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVPARNLYTYIQKLAQIELG---EHVTGMELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFDHY 1903          

HSP 2 Score: 347.821 bits (891), Expect = 9.748e-96
Identity = 319/1153 (27.67%), Postives = 519/1153 (45.01%), Query Frame = 2
Query:  197 TSGQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVD--SNNERFQVVGT------GSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNP-PIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPY-YLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGV-SAQLTETTKDENILNEISNLKIWGTNISKDSATIC--WKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLD--QVKYYIIEWRELSNKSKNSKVFNVTVDINKS----NPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVA-----ISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQG--EKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPY--YISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQVSTNRDFPDGKITFKKI 3568
            ++G  P  I + P D    +G     +C+A G+PKP V +   GK  ++     I      GA LR Q ++   + +V +C+A+N  G +  SA +TV+  + ++P+GFP I  GP   + +  + A + C  S +P  ++TW K+    VD  S+N R + + +      G+L I+N  ETD G YEC+ATN  G   S    L +R    +             P+        E+  G   N+TC A GSP+P V W   +G  +    ++ P+G      + + LT++ ES +Y C A + +G+I+  AQI VK  P AP     ++  ATS  + W     NP P+  Y +  K  S   P+              ++  +     + I  L   + YE+ V AV N+IG   PS P+  +T E  P+S P ++ A+ +S  ++ + W+ P++ NG+I+GYR+YYT      + +W    V D+    + +L+ + TY V+V A+   GDGP+SD   +    G          VP  P N R  + S TSI + W+ P       +  YEL YR +G E G   ++  +P  T Y ++ LKP   Y   LA ++  G+G  +  + E T          N+K     +S  S TI   W     ES+  +     Y + +   +   T       I   Q    +L  L   + Y + V  + +T+      V     S  + I T D D     P  V ++V+NST+ K+ W+ P++     Q++ Y + +  + N   +       V +  +    +    YE +++ L P   Y + V A + KG G+  K +++ T G   VP  P +L + Q+            ++ + W PP+ S G ILGYR+      + L+   EF +  K     + ++T  +K         G TY+F++     V   E A   + +PE+ P   P  +E +G     ++ L W PP +  RNG+ITKY + Y          +     S  + ++T+L  NT Y  KIRA  ++G GP+SP   Y  ++  +    P+N + K +    + +SW FPE          Q N   V+V       DG+ T K I
Sbjct:   19 STGSKPKFI-KIPTDEIGVSGGVASFVCQATGDPKPRVTWNKRGKKVNSQRFETIEFDEGAGAVLRIQPLRTPRDENVYECVAQNVHGEEVVSAKLTVLRED-QLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKD-FLPVDPASSNGRIKQLRSENTPIRGALQIENSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVA-------------PRFSILPVSHEIMPGGNVNITCVAVGSPMPYVKW--MVGAEDLTPEDDMPVG-----RNVLELTNVKESANYTCVAMSSLGVIESVAQITVKSLPKAPGTPVVTETTATSITVTW--DSGNPDPVSYYVIEYKSKSQDGPY--------------QIKEDITTTRYSIGGLSPNSEYEIWVSAV-NSIGQGPPSEPVVTRTGEQAPASAPRNVQARMLSSTTMIIQWEEPVEPNGQIRGYRVYYTMEPDQPVSSWLKYNVDDSLLTTIGSLLEHETYTVRVLAFTSVGDGPLSDPIQVKTQQG----------VPGQPMNFRAEAKSETSIGLTWSPPR---QDSIVKYELNYR-EG-EGGNEIRKTFDP-ATSYTVEGLKPNTEYLFRLAARSSHGLGAWTLDIKERTMQSKPSAPPRNVKC----VSSKSTTILVSWLPPPAESQNGVL--AGYSVRYSALDSDDTRPKEVKDIP-PQTTQILLEALEKWTVYRITV--VAHTE------VGPGPESPPVEIRT-DEDVPSAPPRKVEVEVLNSTAIKVFWRSPVQNRQHGQIRGYQVHYVRMENGEASGLTLIKDVMLADAQWEMDDTAEYEMVISGLQPETSYSVTVAAYTMKGDGARSKPKLVTTRG--AVPGKP-DLFVHQN---------SDGSLLVEWEPPRESEGHILGYRLQFGRQDVMLLSTLEFGELEK-----KYLATNIHK---------GATYVFKMAVKGRVGLSEEAVKEFIVPEDTPKGFPQLIE-KGIVTSMSIQLNWLPPVLAERNGVITKYTLAYRVAGSSEKLQEIDLPSSDNSFILTDLNPNTVYEVKIRAHTRKGPGPYSPTVQYRTFLLDQVL--PKNFKVKMVTKTSVLLSWEFPENYTSTMLYKIQYNMHAVEV-------DGRTTKKLI 1063          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Mouse
Match: Ptprs (protein tyrosine phosphatase, receptor type, S [Source:MGI Symbol;Acc:MGI:97815])

HSP 1 Score: 889.797 bits (2298), Expect = 0.000e+0
Identity = 523/1301 (40.20%), Postives = 735/1301 (56.50%), Query Frame = 2
Query: 2933 PVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETAR--INYTIPEERPSAPPNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQY-FDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVT-DLLSQVNGFHVQVSTNRDFPDGKITFKKIVGPFTSTVMEKIYPN-HYFIRVQAIIRDKRIAEWSNIHTLTVFKSKYTERNIKGLNC------IGQTNSIKVTWEKPDDYTEIKSFLIELSGYRKFRNIYGAYKIEKIKARTSRIEFFGEEQSTYNYSIPNLEPNTNYDXXXXXXXXXXXXXXXXXXXXXCVTLMEQPKSILSPMPVPLRKVSNEIILRLSRTNEILGMISHYYLIVSPIKETHV--------TPHDVNIDETFTQTKNLKAMNSR----------YVAAQFT--PALFRSKSYVDFVLGSNSPIESFHSNDWIFLKRLPVKKKTNLKAFLRACVIPEGLTSDLKSIPVERCTSSEWSMTFSTDINREIQVFT---AAVIAGIGSIVFLVFI-CIGFACFLKRSHSKISRPLGSTDPCLKQPLMMQPGLSGGNLPQYTNIVNIGNSSRHGYTDSLRTNSDLCATSGVMTPINNHQPLSVSNPMFEQRSLELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            P +I  +++T  Y       + P   Y   V A+NS+  G  +   +  T  +   SAP N         T+ ++W  P     NG+I  Y++ Y  + + PV   ++   +      + +L E+  Y  ++ A    GDGP S              P N+  +A ++  I +SW+ P + + +  +LL +      +V    D             P T+ V+E + PN  Y  R+ A           +   L  F +   +R ++ ++       +    S+ ++WE PD+Y     + I+ +G               +  RT++              I +L+P+T Y+  +    SS+  L+      +   ++    S+ +P P         I++ L      +  + +Y++++ P++++          +P D++++E       L+  + R          Y+AA+F+  PA+F   +   +    N  +E  H      L  L    + N   F                       +S +S  F  D N + Q        +I  IG ++ +VFI CI  A  L ++  K S P                                        T  L  N+DL            H P         +  +E+++I N Q P ++ +         PPIP+  +   +  L+AND+   SQEYESIDPGQQFTWE+SNLE N+ KNRYANVIAYDHSR++LQ + G++GSDYINANY+DGY+R NAYIATQGPL  TFGDFWRMVWEQ +A++VMMT+LEE++RIKCDQYWPN+GTE+Y  G I VT+ DT ELA + +RTF +  N SS         +KRE+R +QFTAWPDHGVP+ P P L FL+R++  NP  + PI+VHCSAGVGRTG FIVID  LERI+ E TVD++G V++MR+QRNYMVQTEDQY F+HE +L+AV   NTEV  +++ T++QKL + +     +  TG+ELEF++L+  K + +R  +A+LP N+ KNRLVNILPYE +R+CLQPIRG EGSDYINAS+IDGY+  KAYIATQ PL ET EDFWR +WE+NSTI+VMLTKLREMGREKCH+YWP ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRTVRQFQFT+WPEQG P ++ E FI+FIGQVHKTKEQFGQ+GPI+VHCSAGVGRTGVF+ LSI LER++ EGV+D+FQ V+ LR QR  MVQ+E++Y+FC+ AA +Y+ SFD +
Sbjct:  362 PYQIKEDITTTRYSI---GGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEP--VEPNGLIRGYRVYYTMEPEHPVGNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEAKSETSIGLSWSAPRQESVIKYELLFREGDRGREVGRTFD-------------PTTAFVVEDLKPNTEYAFRLAA----------RSPQGLGAFTAVVRQRTLQAISPKNFKVKMIMKTSVLLSWEFPDNYNSPTPYKIQYNGL-----------TLDVDGRTTK------------KLITHLKPHTFYNFVLTNRGSSLGGLQQTVTARTAFNMLSGKPSV-APKP----DNDGFIVVYLPDGQSPV-TVQNYFIVMVPLRKSRGGQFPVLLGSPEDMDLEELIQDISRLQRRSLRHSRQLEVPRPYIAARFSILPAVFHPGNQKQYGGFDNRGLEPGHRYVLFVLAVL----QKNEPTF----------------------AASPFSDPFQLD-NPDPQPIVDGEEGLIWVIGPVLAVVFIICIVIAILLYKNKRKDSEP---------------------------------------RTKCLLNNADLAP----------HHP---------KDPVEMRRI-NFQTPGMLSH---------PPIPITDMAEHMERLKANDSLKLSQEYESIDPGQQFTWEHSNLEANKPKNRYANVIAYDHSRVILQPLEGIMGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIKCDQYWPNRGTETY--GFIQVTLLDTMELATFCVRTFSLHKNGSS---------EKREVRHFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKTEKTVDVYGHVTLMRSQRNYMVQTEDQYGFIHEALLEAVGCGNTEVPARSLYTYIQKLAQVE---PGEHVTGMELEFKRLASSKAHTSRFITASLPCNKFKNRLVNILPYESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRALWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGAP-KSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKVLRTQRPAMVQTEDEYQFCFQAALEYLGSFDHY 1495          

HSP 2 Score: 263.462 bits (672), Expect = 3.460e-70
Identity = 210/752 (27.93%), Postives = 342/752 (45.48%), Query Frame = 2
Query:  203 GQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVD--SNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNP-PIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPY-YLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPE 2443
             + P      P D    +G     +C+A G+PKP V +   GK  ++     I      GA LR Q ++   + +V +C+A+N +G  T  A +TV+  + ++P GFP I  GP   + +  + A + C  S +P  ++TW K+    VD  ++N R + + +G+L I++  ETD G YEC+ATN  G   S    L +R    +             P+        E+  G   N+TC A GSP+P V W +Q     +P  ++ P+G      + + LTD+ +S +Y C A + +G+I+  AQI VK  P AP     ++  ATS  + W     NP P+  Y +  K  S   P+              ++  +     + I  L   + YE+ V AV N+IG   PS  +  +T E  P+S P ++ A+ +S  ++ V W+ P++ NG I+GYR+YYT      + NW    V D+    + +L+ + TY V+V A+   GDGP+SD   +    G          VP  P NLR  + S TSI + W+ P       +  YEL +R +GD +G+      +P  T +++++LKP   Y   LA ++  G+G    +      +  L  IS        I K S  + W+   D       ++I Y              N   L  D +    ++THL+P + Y+     +     ++L  + + +T+   F       SV  KP+
Sbjct:   29 AEEPPRFIREPKDQIGVSGGVASFVCQATGDPKPRVTWNKKGKKVNSQRFETIDFDESSGAVLRIQPLRTPRDENVYECVAQNSVGEITIHAKLTVLRED-QLPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKD-FLPVDPSASNGRIKQLRSGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVA-------------PRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKW-MQGAEDLTPE-DDMPVG-----RNVLELTDVKDSANYTCVAMSSLGVIEAVAQITVKSLPKAPGTPVVTENTATSITVTW--DSGNPDPVSYYVIEYKSKSQDGPY--------------QIKEDITTTRYSIGGLSPNSEYEIWVSAV-NSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQG----------VPGQPMNLRAEAKSETSIGLSWSAPR---QESVIKYELLFR-EGD-RGREVGRTFDP-TTAFVVEDLKPNTEYAFRLAARSPQGLGAFTAVVR----QRTLQAISPKNFKVKMIMKTSVLLSWEFP-DNYNSPTPYKIQY--------------NGLTLDVDGRTTKKLITHLKPHTFYNF----VLTNRGSSLGGLQQTVTARTAFNMLSGKPSVAPKPD 702          

HSP 3 Score: 69.3218 bits (168), Expect = 8.209e-11
Identity = 90/392 (22.96%), Postives = 158/392 (40.31%), Query Frame = 2
Query: 2402 ISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPR--ELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETAR-INYTIPEERPSAPPNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQVSTNRDFPDGKITFKKI 3568
            ++ +   S+P  P    +    +TS  ++W       D V YY+IE++   +KS++   + +  DI  +       + +  L PN  Y+I V A +  G+G P +  + +T G     S PR  + RM  +  +            + W  P   +GLI GYRV  ++   PE      PV  ++  + +         +   +TY   V A  SV  G  +  I     +  P  P N       + ++ L W  P    R   + KY++ + +             +  T  ++ +L+ NT Y F++ A + +G G ++             +P+N + K +    + +SW FP+  N  T    Q NG  + V       DG+ T K I
Sbjct:  310 VAQITVKSLPKAPGTPVVTENTATSITVTWDS--GNPDPVSYYVIEYK---SKSQDGP-YQIKEDITTT------RYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRT-GEQAPASAPRNVQARMLSATTM-----------IVQWEEPVEPNGLIRGYRVYYTM--EPE-----HPVGNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEAKSETSIGLSWSAP----RQESVIKYELLFREGDR--GREVGRTFDPTTAFVVEDLKPNTEYAFRLAARSPQGLGAFTAVVRQRTLQAI--SPKNFKVKMIMKTSVLLSWEFPDNYNSPTPYKIQYNGLTLDV-------DGRTTKKLI 655          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Mouse
Match: Ptprd (protein tyrosine phosphatase, receptor type, D [Source:MGI Symbol;Acc:MGI:97812])

HSP 1 Score: 884.789 bits (2285), Expect = 0.000e+0
Identity = 405/617 (65.64%), Postives = 500/617 (81.04%), Query Frame = 2
Query: 4880 LELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            +EL+++ N Q P +  +         PPIP+  L   I  L+ANDN  FSQEYESIDPGQQFTWE+SNLE+N+ KNRYANVIAYDHSR+LL  I G+ GSDY+NANYIDGY++ NAYIATQG L  TFGDFWRM+WEQ +A++VMMTKLEER+R+KCDQYWP++GTE++  G + VT+ DT ELA Y +RTF +  N SS         +KRE+RQ+QFTAWPDHGVP++P P L FL+R++  NP  + P++VHCSAGVGRTG FIVID  LERI+HE TVDI+G V++MRAQRNYMVQTEDQY+F+H+ +L+AV   NTEV  +N+  ++QKL + +  TG +  TG+ELEF++L+  K + +R  SANLP N+ KNRLVNI+PYE  R+CLQPIRG EGSDYINAS++DGY+  KAYIATQ PL ET EDFWRM+WEHNSTI+VMLTKLREMGREKCH+YWP ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRTVRQFQFT+WPEQGVP ++ E FI+FIGQVHKTKEQFGQ+GPI+VHCSAGVGRTGVF+ LSI LER++ EGV+D+FQ V+ LR QR  MVQ+E+QY+FCY AA +Y+ SFD +
Sbjct: 1297 VELRRL-NFQTPGMASH---------PPIPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTETH--GLVQVTLLDTVELATYCVRTFALYKNGSS---------EKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIE--TG-ENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAALEYLGSFDHY 1888          

HSP 2 Score: 380.563 bits (976), Expect = 4.521e-106
Identity = 316/1101 (28.70%), Postives = 512/1101 (46.50%), Query Frame = 2
Query:  203 GQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDS--NNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNP-PIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPY-YLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVS-AQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESK--IALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPM--KTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKT-VTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKAN 3472
             ++P   T  P+D T  +G     IC+A G+P+P + +   GK  SN     I      G+ LR Q ++   +  + +C+A N++G  + S  +TV+  + ++P GFP I  GP   + +  + A + C  S +P  ++TW K+    VD+  NN R + + +G+L I+   E+D G YEC+ATN  GT  S    L           Y++ +  P  P+     +  E+  G   N+TC A GSP+P V W   +G  +    ++ P+G      + + L D+ +S +Y C A + +G+I+  AQI VK  P  P     ++  ATS  + W     NP P+  Y +  K  ++++P+  +  IA                 + +  L  Y++YE +VVAV NNIG    S P+  QT E  PSS P D+ A+ +S  +I V WK P + NG+I+GYR+YYT      ++NW    V D+    + NL+   TY VKV A+   GDGP+S    ++   G          VP  P N +    S TSI + WT P       +  YEL YR DGD+ G+  +  IEP  T Y +  LKP   Y+  L+ ++  G+G S A+++  T          ++    T+ S  S  + W+    E +  I   + + Y  + D  + K        + +DT    ++L  L   + Y + V    +TD      V     S  + I T D D     P  V ++ +N+T+ K+SW+ P+  K   Q++ Y + + ++ N     +     V +  +      + I++ L P   Y + V A + KG G+  K +++ T G   VP  PR +              +     + W+PP  + G + GYR+           K+++P+        E + +  +  I  G +Y+F + A N V FGE      ++PEE P+  P  L  +G   T V L W PP +  RNG+ITKY + Y D+  P+L ++     + T+  +T L+ +T Y  K+RA   +G GP+SP   +          +N   KA+    + +SW  PE  N
Sbjct:   20 AETPPRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLRED-QIPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKD-FLPVDTSNNNGRIKQLRSGALQIEQSEESDQGKYECVATNSAGTRYSAPANL-----------YVRVRRVP--PRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKW--MLGAEDLTPEDDMPIG-----RNVLELNDVRQSANYTCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTW--DSGNPEPVSYYIIQHKPKNSEEPYKEIDGIAT--------------TRYSVAGLSPYSDYEFRVVAV-NNIGRGPASEPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTG----------VPGQPLNFKAEPESETSILLSWTPPR---SDTIASYELVYR-DGDQ-GEEQRITIEP-GTSYRLQGLKPNSLYYFRLSARSPQGLGASTAEISARTMQSKPSAPPQDISC--TSPSSTSILVSWQPPPVEKQNGIITEYSLKYAAV-DGEDFK--PHEILGIPSDT--TKYLLEQLEKWTEYRITV--TAHTD------VGPGPESLSVLIRT-DEDVPSGPPRKVEVEAVNATAVKVSWRSPVPNKQHGQIRGYQVHYVKMENGEPKGQPMLKDVMLADAQ-----DMIISGLQPETSYSLTVTAYTTKGDGARSKPKLVSTTG--AVPGKPRLV----------INHTQMNTALIQWHPPVDTFGPLQGYRLKFGR-------KDMEPLTTLEFSEKEDHFTATD--IHKGASYVFRLSARNKVGFGEEMVKEISVPEEIPTGFPQNLHSEGTTSTSVQLSWQPPVLAERNGVITKYTLLYRDINVPLLPMEHLIVPADTSMTLTGLKSDTTYDVKVRAHTSKGPGPYSPSVQFRTLPVDQVFAKNFHVKAVMKTSVLLSWEIPENYN 1023          

HSP 3 Score: 81.2629 bits (199), Expect = 2.000e-14
Identity = 92/389 (23.65%), Postives = 156/389 (40.10%), Query Frame = 2
Query: 2438 PEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEH---ILNNLLPNKYYKIEVLAASRKGKGS-PEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFG-ETARINYTIPEERPSAPPNKLEIQGEKKT-VTLKWHPPPIDYRNGIITKYKIQY--FDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPA--PENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQ-VSTNRDFPDGKITFKKIV 3571
            P  V  ++++ST+  + WK P +   Q++ Y + +             + T  +N    +NV +     + NL+P K Y ++VLA +  G G      ++I   G   VP  P   +     +          ++ L+W PP+     I  Y          E V         + ++ E   S     + P   Y F + A +    G  TA I+    + +PSAPP  +       T + + W PPP++ +NGIIT+Y ++Y   D ++             T  ++  L++ T Y   + A    G GP S       + E  P+  P  +E +A+N   +KVSW  P    Q      Q+ G+ V  V      P G+   K ++
Sbjct:  408 PRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYY-----------TMDPTQHVNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTG---VPGQPLNFKAEPESET---------SILLSWTPPR--SDTIASY----------ELVYRDGDQGEEQRITIEPGTSYRLQGLKPNSLYYFRLSARSPQGLGASTAEISARTMQSKPSAPPQDISCTSPSSTSILVSWQPPPVEKQNGIITEYSLKYAAVDGEDFKPHEILGIPSDTTKYLLEQLEKWTEYRITVTAHTDVGPGPESLSV-LIRTDEDVPSGPPRKVEVEAVNATAVKVSWRSPVPNKQ----HGQIRGYQVHYVKMENGEPKGQPMLKDVM 756          

HSP 4 Score: 65.855 bits (159), Expect = 8.850e-10
Identity = 88/357 (24.65%), Postives = 154/357 (43.14%), Query Frame = 2
Query: 1010 QPSSS-TIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPL--QQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGY--ELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETT 2065
            QP +S ++ +T  T  G     A++K  L+     +     P  P LV  +  +  +A+I+W     +PP+D++  L           G + +     P   L    K+  F  T++    +Y  ++ A  N +G  +  +       E  P+  P +L ++  +  S++++W+PP+  ++NG I  Y L Y +     +   H+    DT   L  L  + TY VKV A+   G GP S +            +TLP       +N    ++  TS+ + W  P        E Y   + +++  D+ GKM +E ++   TQ LI NLKP K+Y   L  +     G+  ++T  T
Sbjct:  769 QPETSYSLTVTAYTTKGD---GARSKPKLVSTTGAV-----PGKPRLV-INHTQMNTALIQW-----HPPVDTFGPL----QGYRLKFGRKDME----PLTTLEFSEKEDHFTATDIHKGASYVFRLSA-RNKVGFGE-EMVKEISVPEEIPTGFPQNLHSEGTTSTSVQLSWQPPVLAERNGVITKYTLLYRDINVPLLPMEHLIVPADTSMTLTGLKSDTTYDVKVRAHTSKGPGPYSPSVQF---------RTLPVD-QVFAKNFHVKAVMKTSVLLSWEIP--------ENYNSAMPFKILYDD-GKMVEE-VDGRATQKLIVNLKPEKSYSFVLTNRGNSAGGLQHRVTAKT 1081          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Mouse
Match: Ptprd (protein tyrosine phosphatase, receptor type, D [Source:MGI Symbol;Acc:MGI:97812])

HSP 1 Score: 884.404 bits (2284), Expect = 0.000e+0
Identity = 405/617 (65.64%), Postives = 500/617 (81.04%), Query Frame = 2
Query: 4880 LELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            +EL+++ N Q P +  +         PPIP+  L   I  L+ANDN  FSQEYESIDPGQQFTWE+SNLE+N+ KNRYANVIAYDHSR+LL  I G+ GSDY+NANYIDGY++ NAYIATQG L  TFGDFWRM+WEQ +A++VMMTKLEER+R+KCDQYWP++GTE++  G + VT+ DT ELA Y +RTF +  N SS         +KRE+RQ+QFTAWPDHGVP++P P L FL+R++  NP  + P++VHCSAGVGRTG FIVID  LERI+HE TVDI+G V++MRAQRNYMVQTEDQY+F+H+ +L+AV   NTEV  +N+  ++QKL + +  TG +  TG+ELEF++L+  K + +R  SANLP N+ KNRLVNI+PYE  R+CLQPIRG EGSDYINAS++DGY+  KAYIATQ PL ET EDFWRM+WEHNSTI+VMLTKLREMGREKCH+YWP ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRTVRQFQFT+WPEQGVP ++ E FI+FIGQVHKTKEQFGQ+GPI+VHCSAGVGRTGVF+ LSI LER++ EGV+D+FQ V+ LR QR  MVQ+E+QY+FCY AA +Y+ SFD +
Sbjct: 1319 VELRRL-NFQTPGMASH---------PPIPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTETH--GLVQVTLLDTVELATYCVRTFALYKNGSS---------EKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIE--TG-ENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAALEYLGSFDHY 1910          

HSP 2 Score: 377.096 bits (967), Expect = 5.593e-105
Identity = 318/1113 (28.57%), Postives = 516/1113 (46.36%), Query Frame = 2
Query:  203 GQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNE------RFQVVG----TGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNP-PIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPY-YLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVS-AQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESK--IALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPM--KTLDQVKYYIIEWRELSNKSKNSK--VFNVTVDINKSNPNNVYEH--ILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKT-VTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKAN 3472
             ++P   T  P+D T  +G     IC+A G+P+P + +   GK  SN     I      G+ LR Q ++   +  + +C+A N++G  + S  +TV+  + ++P GFP I  GP   + +  + A + C  S +P  ++TW K+      SNN       R + +G     G+L I+   E+D G YEC+ATN  GT  S    L +R         ++E    + P+     +  E+  G   N+TC A GSP+P V W   +G  +    ++ P+G      + + L D+ +S +Y C A + +G+I+  AQI VK  P  P     ++  ATS  + W     NP P+  Y +  K  ++++P+  +  IA                 + +  L  Y++YE +VVAV NNIG    S P+  QT E  PSS P D+ A+ +S  +I V WK P + NG+I+GYR+YYT      ++NW    V D+    + NL+   TY VKV A+   GDGP+S    ++   G          VP  P N +    S TSI + WT P       +  YEL YR DGD+ G+  +  IEP  T Y +  LKP   Y+  L+ ++  G+G S A+++  T          ++    T+ S  S  + W+    E +  I   + + Y  + D  + K        + +DT    ++L  L   + Y + V    +TD      V     S  + I T D D     P  V ++ +N+T+ K+SW+ P+  K   Q++ Y + + ++ N     +  + +V +   +   ++  EH  I++ L P   Y + V A + KG G+  K +++ T G   VP  PR +              +     + W+PP  + G + GYR+           K+++P+        E + +  +  I  G +Y+F + A N V FGE      ++PEE P+  P  L  +G   T V L W PP +  RNG+ITKY + Y D+  P+L ++     + T+  +T L+ +T Y  K+RA   +G GP+SP   +          +N   KA+    + +SW  PE  N
Sbjct:   20 AETPPRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLRED-QIPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRSESIGGTPIRGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRE--------LREVRR-VPPRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKW--MLGAEDLTPEDDMPIG-----RNVLELNDVRQSANYTCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTW--DSGNPEPVSYYIIQHKPKNSEEPYKEIDGIAT--------------TRYSVAGLSPYSDYEFRVVAV-NNIGRGPASEPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTG----------VPGQPLNFKAEPESETSILLSWTPPR---SDTIASYELVYR-DGDQ-GEEQRITIEP-GTSYRLQGLKPNSLYYFRLSARSPQGLGASTAEISARTMQSKPSAPPQDISC--TSPSSTSILVSWQPPPVEKQNGIITEYSLKYAAV-DGEDFK--PHEILGIPSDT--TKYLLEQLEKWTEYRITV--TAHTD------VGPGPESLSVLIRT-DEDVPSGPPRKVEVEAVNATAVKVSWRSPVPNKQHGQIRGYQVHYVKMENGEPKGQPMLKDVMLADAQWEFDDTTEHDMIISGLQPETSYSLTVTAYTTKGDGARSKPKLVSTTG--AVPGKPRLV----------INHTQMNTALIQWHPPVDTFGPLQGYRLKFGR-------KDMEPLTTLEFSEKEDHFTATD--IHKGASYVFRLSARNKVGFGEEMVKEISVPEEIPTGFPQNLHSEGTTSTSVQLSWQPPVLAERNGVITKYTLLYRDINVPLLPMEHLIVPADTSMTLTGLKSDTTYDVKVRAHTSKGPGPYSPSVQFRTLPVDQVFAKNFHVKAVMKTSVLLSWEIPENYN 1045          

HSP 3 Score: 81.2629 bits (199), Expect = 1.652e-14
Identity = 92/389 (23.65%), Postives = 156/389 (40.10%), Query Frame = 2
Query: 2438 PEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEH---ILNNLLPNKYYKIEVLAASRKGKGS-PEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFG-ETARINYTIPEERPSAPPNKLEIQGEKKT-VTLKWHPPPIDYRNGIITKYKIQY--FDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPA--PENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQ-VSTNRDFPDGKITFKKIV 3571
            P  V  ++++ST+  + WK P +   Q++ Y + +             + T  +N    +NV +     + NL+P K Y ++VLA +  G G      ++I   G   VP  P   +     +          ++ L+W PP+     I  Y          E V         + ++ E   S     + P   Y F + A +    G  TA I+    + +PSAPP  +       T + + W PPP++ +NGIIT+Y ++Y   D ++             T  ++  L++ T Y   + A    G GP S       + E  P+  P  +E +A+N   +KVSW  P    Q      Q+ G+ V  V      P G+   K ++
Sbjct:  421 PRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYY-----------TMDPTQHVNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTG---VPGQPLNFKAEPESET---------SILLSWTPPR--SDTIASY----------ELVYRDGDQGEEQRITIEPGTSYRLQGLKPNSLYYFRLSARSPQGLGASTAEISARTMQSKPSAPPQDISCTSPSSTSILVSWQPPPVEKQNGIITEYSLKYAAVDGEDFKPHEILGIPSDTTKYLLEQLEKWTEYRITVTAHTDVGPGPESLSV-LIRTDEDVPSGPPRKVEVEAVNATAVKVSWRSPVPNKQ----HGQIRGYQVHYVKMENGEPKGQPMLKDVM 769          

HSP 4 Score: 65.855 bits (159), Expect = 8.083e-10
Identity = 88/357 (24.65%), Postives = 154/357 (43.14%), Query Frame = 2
Query: 1010 QPSSS-TIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPL--QQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGY--ELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETT 2065
            QP +S ++ +T  T  G     A++K  L+     +     P  P LV  +  +  +A+I+W     +PP+D++  L           G + +     P   L    K+  F  T++    +Y  ++ A  N +G  +  +       E  P+  P +L ++  +  S++++W+PP+  ++NG I  Y L Y +     +   H+    DT   L  L  + TY VKV A+   G GP S +            +TLP       +N    ++  TS+ + W  P        E Y   + +++  D+ GKM +E ++   TQ LI NLKP K+Y   L  +     G+  ++T  T
Sbjct:  791 QPETSYSLTVTAYTTKGD---GARSKPKLVSTTGAV-----PGKPRLV-INHTQMNTALIQW-----HPPVDTFGPL----QGYRLKFGRKDME----PLTTLEFSEKEDHFTATDIHKGASYVFRLSA-RNKVGFGE-EMVKEISVPEEIPTGFPQNLHSEGTTSTSVQLSWQPPVLAERNGVITKYTLLYRDINVPLLPMEHLIVPADTSMTLTGLKSDTTYDVKVRAHTSKGPGPYSPSVQF---------RTLPVD-QVFAKNFHVKAVMKTSVLLSWEIP--------ENYNSAMPFKILYDD-GKMVEE-VDGRATQKLIVNLKPEKSYSFVLTNRGNSAGGLQHRVTAKT 1103          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Mouse
Match: Ptprd (protein tyrosine phosphatase, receptor type, D [Source:MGI Symbol;Acc:MGI:97812])

HSP 1 Score: 883.248 bits (2281), Expect = 0.000e+0
Identity = 405/617 (65.64%), Postives = 500/617 (81.04%), Query Frame = 2
Query: 4880 LELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            +EL+++ N Q P +  +         PPIP+  L   I  L+ANDN  FSQEYESIDPGQQFTWE+SNLE+N+ KNRYANVIAYDHSR+LL  I G+ GSDY+NANYIDGY++ NAYIATQG L  TFGDFWRM+WEQ +A++VMMTKLEER+R+KCDQYWP++GTE++  G + VT+ DT ELA Y +RTF +  N SS         +KRE+RQ+QFTAWPDHGVP++P P L FL+R++  NP  + P++VHCSAGVGRTG FIVID  LERI+HE TVDI+G V++MRAQRNYMVQTEDQY+F+H+ +L+AV   NTEV  +N+  ++QKL + +  TG +  TG+ELEF++L+  K + +R  SANLP N+ KNRLVNI+PYE  R+CLQPIRG EGSDYINAS++DGY+  KAYIATQ PL ET EDFWRM+WEHNSTI+VMLTKLREMGREKCH+YWP ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRTVRQFQFT+WPEQGVP ++ E FI+FIGQVHKTKEQFGQ+GPI+VHCSAGVGRTGVF+ LSI LER++ EGV+D+FQ V+ LR QR  MVQ+E+QY+FCY AA +Y+ SFD +
Sbjct:  902 VELRRL-NFQTPGMASH---------PPIPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTETH--GLVQVTLLDTVELATYCVRTFALYKNGSS---------EKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIE--TG-ENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAALEYLGSFDHY 1493          

HSP 2 Score: 271.552 bits (693), Expect = 1.089e-72
Identity = 199/658 (30.24%), Postives = 317/658 (48.18%), Query Frame = 2
Query:  203 GQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNN----ERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNP-PIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPY-YLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKM 2155
             ++P   T  P+D T  +G     IC+A G+P+P + +   GK  SN     I      G+ LR Q ++   +  + +C+A N++G  + S  +TV+  + ++P GFP I  GP   + +  + A + C  S +P  ++TW K+      SNN    ++ +    G+L I+   E+D G YEC+ATN  GT  S    L +R         ++E    + P+     +  E+  G   N+TC A GSP+P V W   +G  +    ++ P+G      + + L D+ +S +Y C A + +G+I+  AQI VK  P  P     ++  ATS  + W     NP P+  Y +  K  ++++P+  +  IA                 + +  L  Y++YE +VVAV NNIG    S P+  QT E  PSS P D+ A+ +S  +I V WK P + NG+I+GYR+YYT      ++NW    V D+    + NL+   TY VKV A+   GDGP+S    ++   G          VP  P N +    S TSI + WT P       +  YEL YR DGD+ G+  +  IEP  T Y +  LKP   Y+  L+ ++  G+G S         +++  +  ++K     + K S  + W++
Sbjct:   20 AETPPRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLRED-QIPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRSESIGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRE--------LREVRR-VPPRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKW--MLGAEDLTPEDDMPIG-----RNVLELNDVRQSANYTCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTW--DSGNPEPVSYYIIQHKPKNSEEPYKEIDGIAT--------------TRYSVAGLSPYSDYEFRVVAV-NNIGRGPASEPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTG----------VPGQPLNFKAEPESETSILLSWTPPR---SDTIASYELVYR-DGDQ-GEEQRITIEP-GTSYRLQGLKPNSLYYFRLSARSPQGLGASTAEISARTMQSMFAKNFHVKA----VMKTSVLLSWEI 623          

HSP 3 Score: 52.373 bits (124), Expect = 9.433e-6
Identity = 84/364 (23.08%), Postives = 142/364 (39.01%), Query Frame = 2
Query: 2402 ISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPS-MPREL--RMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIG---PGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKT-VTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKAN 3472
            I+ +   ++P  P    +    +TS  ++W       + V YYII+     +K KNS+     +D   +       + +  L P   Y+  V+A +  G+G     E + T  + + PS  PR++  RM  S  I            + W  P+  +G I GYRV  ++           P +   N         +   IG   P KTY  +V A  S+  G  +     I +      P   + + E +T + L W PP    R+  I  Y++ Y D  +     +    E  T+  +  L+ N+ Y F++ A + +G G  +           F   +N   KA+    + +SW  PE  N
Sbjct:  308 IAQITVKALPKPPGTPVVTESTATSITLTWDS--GNPEPVSYYIIQ-----HKPKNSEEPYKEIDGIATT-----RYSVAGLSPYSDYEFRVVAVNNIGRGPAS--EPVLTQTSEQAPSSAPRDVQARMLSSTTI-----------LVQWKEPEEPNGQIQGYRVYYTM----------DPTQHVNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGVPGQPLNFKAEPESETSILLSWTPP----RSDTIASYELVYRDGDQ--GEEQRITIEPGTSYRLQGLKPNSLYYFRLSARSPQGLGASTAEISARTMQSMFA--KNFHVKAVMKTSVLLSWEIPENYN 628          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Mouse
Match: Ptprd (protein tyrosine phosphatase, receptor type, D [Source:MGI Symbol;Acc:MGI:97812])

HSP 1 Score: 882.863 bits (2280), Expect = 0.000e+0
Identity = 405/617 (65.64%), Postives = 500/617 (81.04%), Query Frame = 2
Query: 4880 LELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            +EL+++ N Q P +  +         PPIP+  L   I  L+ANDN  FSQEYESIDPGQQFTWE+SNLE+N+ KNRYANVIAYDHSR+LL  I G+ GSDY+NANYIDGY++ NAYIATQG L  TFGDFWRM+WEQ +A++VMMTKLEER+R+KCDQYWP++GTE++  G + VT+ DT ELA Y +RTF +  N SS         +KRE+RQ+QFTAWPDHGVP++P P L FL+R++  NP  + P++VHCSAGVGRTG FIVID  LERI+HE TVDI+G V++MRAQRNYMVQTEDQY+F+H+ +L+AV   NTEV  +N+  ++QKL + +  TG +  TG+ELEF++L+  K + +R  SANLP N+ KNRLVNI+PYE  R+CLQPIRG EGSDYINAS++DGY+  KAYIATQ PL ET EDFWRM+WEHNSTI+VMLTKLREMGREKCH+YWP ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRTVRQFQFT+WPEQGVP ++ E FI+FIGQVHKTKEQFGQ+GPI+VHCSAGVGRTGVF+ LSI LER++ EGV+D+FQ V+ LR QR  MVQ+E+QY+FCY AA +Y+ SFD +
Sbjct:  913 VELRRL-NFQTPGMASH---------PPIPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTETH--GLVQVTLLDTVELATYCVRTFALYKNGSS---------EKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIE--TG-ENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAALEYLGSFDHY 1504          

HSP 2 Score: 269.626 bits (688), Expect = 3.824e-72
Identity = 201/664 (30.27%), Postives = 318/664 (47.89%), Query Frame = 2
Query:  203 GQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNE------RFQVVG----TGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNP-PIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPY-YLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKM 2155
             ++P   T  P+D T  +G     IC+A G+P+P + +   GK  SN     I      G+ LR Q ++   +  + +C+A N++G  + S  +TV+  + ++P GFP I  GP   + +  + A + C  S +P  ++TW K+      SNN       R + +G     G+L I+   E+D G YEC+ATN  GT  S    L +R         ++E    + P+     +  E+  G   N+TC A GSP+P V W   +G  +    ++ P+G      + + L D+ +S +Y C A + +G+I+  AQI VK  P  P     ++  ATS  + W     NP P+  Y +  K  ++++P+  +  IA                 + +  L  Y++YE +VVAV NNIG    S P+  QT E  PSS P D+ A+ +S  +I V WK P + NG+I+GYR+YYT      ++NW    V D+    + NL+   TY VKV A+   GDGP+S    ++   G          VP  P N +    S TSI + WT P       +  YEL YR DGD+ G+  +  IEP  T Y +  LKP   Y+  L+ ++  G+G S         +++  +  ++K     + K S  + W++
Sbjct:   20 AETPPRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLRED-QIPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRSESIGGTPIRGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRE--------LREVRR-VPPRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKW--MLGAEDLTPEDDMPIG-----RNVLELNDVRQSANYTCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTW--DSGNPEPVSYYIIQHKPKNSEEPYKEIDGIAT--------------TRYSVAGLSPYSDYEFRVVAV-NNIGRGPASEPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTG----------VPGQPLNFKAEPESETSILLSWTPPR---SDTIASYELVYR-DGDQ-GEEQRITIEP-GTSYRLQGLKPNSLYYFRLSARSPQGLGASTAEISARTMQSMFAKNFHVKA----VMKTSVLLSWEI 629          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. UniProt/SwissProt
Match: sp|Q64487|PTPRD_MOUSE (Receptor-type tyrosine-protein phosphatase delta OS=Mus musculus OX=10090 GN=Ptprd PE=1 SV=3)

HSP 1 Score: 884.404 bits (2284), Expect = 0.000e+0
Identity = 405/617 (65.64%), Postives = 500/617 (81.04%), Query Frame = 2
Query: 4880 LELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            +EL+++ N Q P +  +         PPIP+  L   I  L+ANDN  FSQEYESIDPGQQFTWE+SNLE+N+ KNRYANVIAYDHSR+LL  I G+ GSDY+NANYIDGY++ NAYIATQG L  TFGDFWRM+WEQ +A++VMMTKLEER+R+KCDQYWP++GTE++  G + VT+ DT ELA Y +RTF +  N SS         +KRE+RQ+QFTAWPDHGVP++P P L FL+R++  NP  + P++VHCSAGVGRTG FIVID  LERI+HE TVDI+G V++MRAQRNYMVQTEDQY+F+H+ +L+AV   NTEV  +N+  ++QKL + +  TG +  TG+ELEF++L+  K + +R  SANLP N+ KNRLVNI+PYE  R+CLQPIRG EGSDYINAS++DGY+  KAYIATQ PL ET EDFWRM+WEHNSTI+VMLTKLREMGREKCH+YWP ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRTVRQFQFT+WPEQGVP ++ E FI+FIGQVHKTKEQFGQ+GPI+VHCSAGVGRTGVF+ LSI LER++ EGV+D+FQ V+ LR QR  MVQ+E+QY+FCY AA +Y+ SFD +
Sbjct: 1319 VELRRL-NFQTPGMASH---------PPIPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTETH--GLVQVTLLDTVELATYCVRTFALYKNGSS---------EKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIE--TG-ENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAALEYLGSFDHY 1910          

HSP 2 Score: 377.096 bits (967), Expect = 3.912e-104
Identity = 318/1113 (28.57%), Postives = 516/1113 (46.36%), Query Frame = 2
Query:  203 GQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNE------RFQVVG----TGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNP-PIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPY-YLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVS-AQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESK--IALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPM--KTLDQVKYYIIEWRELSNKSKNSK--VFNVTVDINKSNPNNVYEH--ILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKT-VTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKAN 3472
             ++P   T  P+D T  +G     IC+A G+P+P + +   GK  SN     I      G+ LR Q ++   +  + +C+A N++G  + S  +TV+  + ++P GFP I  GP   + +  + A + C  S +P  ++TW K+      SNN       R + +G     G+L I+   E+D G YEC+ATN  GT  S    L +R         ++E    + P+     +  E+  G   N+TC A GSP+P V W   +G  +    ++ P+G      + + L D+ +S +Y C A + +G+I+  AQI VK  P  P     ++  ATS  + W     NP P+  Y +  K  ++++P+  +  IA                 + +  L  Y++YE +VVAV NNIG    S P+  QT E  PSS P D+ A+ +S  +I V WK P + NG+I+GYR+YYT      ++NW    V D+    + NL+   TY VKV A+   GDGP+S    ++   G          VP  P N +    S TSI + WT P       +  YEL YR DGD+ G+  +  IEP  T Y +  LKP   Y+  L+ ++  G+G S A+++  T          ++    T+ S  S  + W+    E +  I   + + Y  + D  + K        + +DT    ++L  L   + Y + V    +TD      V     S  + I T D D     P  V ++ +N+T+ K+SW+ P+  K   Q++ Y + + ++ N     +  + +V +   +   ++  EH  I++ L P   Y + V A + KG G+  K +++ T G   VP  PR +              +     + W+PP  + G + GYR+           K+++P+        E + +  +  I  G +Y+F + A N V FGE      ++PEE P+  P  L  +G   T V L W PP +  RNG+ITKY + Y D+  P+L ++     + T+  +T L+ +T Y  K+RA   +G GP+SP   +          +N   KA+    + +SW  PE  N
Sbjct:   20 AETPPRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLRED-QIPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRSESIGGTPIRGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRE--------LREVRR-VPPRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKW--MLGAEDLTPEDDMPIG-----RNVLELNDVRQSANYTCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTW--DSGNPEPVSYYIIQHKPKNSEEPYKEIDGIAT--------------TRYSVAGLSPYSDYEFRVVAV-NNIGRGPASEPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTG----------VPGQPLNFKAEPESETSILLSWTPPR---SDTIASYELVYR-DGDQ-GEEQRITIEP-GTSYRLQGLKPNSLYYFRLSARSPQGLGASTAEISARTMQSKPSAPPQDISC--TSPSSTSILVSWQPPPVEKQNGIITEYSLKYAAV-DGEDFK--PHEILGIPSDT--TKYLLEQLEKWTEYRITV--TAHTD------VGPGPESLSVLIRT-DEDVPSGPPRKVEVEAVNATAVKVSWRSPVPNKQHGQIRGYQVHYVKMENGEPKGQPMLKDVMLADAQWEFDDTTEHDMIISGLQPETSYSLTVTAYTTKGDGARSKPKLVSTTG--AVPGKPRLV----------INHTQMNTALIQWHPPVDTFGPLQGYRLKFGR-------KDMEPLTTLEFSEKEDHFTATD--IHKGASYVFRLSARNKVGFGEEMVKEISVPEEIPTGFPQNLHSEGTTSTSVQLSWQPPVLAERNGVITKYTLLYRDINVPLLPMEHLIVPADTSMTLTGLKSDTTYDVKVRAHTSKGPGPYSPSVQFRTLPVDQVFAKNFHVKAVMKTSVLLSWEIPENYN 1045          

HSP 3 Score: 81.2629 bits (199), Expect = 1.156e-13
Identity = 92/389 (23.65%), Postives = 156/389 (40.10%), Query Frame = 2
Query: 2438 PEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEH---ILNNLLPNKYYKIEVLAASRKGKGS-PEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFG-ETARINYTIPEERPSAPPNKLEIQGEKKT-VTLKWHPPPIDYRNGIITKYKIQY--FDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPA--PENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQ-VSTNRDFPDGKITFKKIV 3571
            P  V  ++++ST+  + WK P +   Q++ Y + +             + T  +N    +NV +     + NL+P K Y ++VLA +  G G      ++I   G   VP  P   +     +          ++ L+W PP+     I  Y          E V         + ++ E   S     + P   Y F + A +    G  TA I+    + +PSAPP  +       T + + W PPP++ +NGIIT+Y ++Y   D ++             T  ++  L++ T Y   + A    G GP S       + E  P+  P  +E +A+N   +KVSW  P    Q      Q+ G+ V  V      P G+   K ++
Sbjct:  421 PRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYY-----------TMDPTQHVNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTG---VPGQPLNFKAEPESET---------SILLSWTPPR--SDTIASY----------ELVYRDGDQGEEQRITIEPGTSYRLQGLKPNSLYYFRLSARSPQGLGASTAEISARTMQSKPSAPPQDISCTSPSSTSILVSWQPPPVEKQNGIITEYSLKYAAVDGEDFKPHEILGIPSDTTKYLLEQLEKWTEYRITVTAHTDVGPGPESLSV-LIRTDEDVPSGPPRKVEVEAVNATAVKVSWRSPVPNKQ----HGQIRGYQVHYVKMENGEPKGQPMLKDVM 769          

HSP 4 Score: 65.855 bits (159), Expect = 5.654e-9
Identity = 88/357 (24.65%), Postives = 154/357 (43.14%), Query Frame = 2
Query: 1010 QPSSS-TIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPL--QQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGY--ELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETT 2065
            QP +S ++ +T  T  G     A++K  L+     +     P  P LV  +  +  +A+I+W     +PP+D++  L           G + +     P   L    K+  F  T++    +Y  ++ A  N +G  +  +       E  P+  P +L ++  +  S++++W+PP+  ++NG I  Y L Y +     +   H+    DT   L  L  + TY VKV A+   G GP S +            +TLP       +N    ++  TS+ + W  P        E Y   + +++  D+ GKM +E ++   TQ LI NLKP K+Y   L  +     G+  ++T  T
Sbjct:  791 QPETSYSLTVTAYTTKGD---GARSKPKLVSTTGAV-----PGKPRLV-INHTQMNTALIQW-----HPPVDTFGPL----QGYRLKFGRKDME----PLTTLEFSEKEDHFTATDIHKGASYVFRLSA-RNKVGFGE-EMVKEISVPEEIPTGFPQNLHSEGTTSTSVQLSWQPPVLAERNGVITKYTLLYRDINVPLLPMEHLIVPADTSMTLTGLKSDTTYDVKVRAHTSKGPGPYSPSVQF---------RTLPVD-QVFAKNFHVKAVMKTSVLLSWEIP--------ENYNSAMPFKILYDD-GKMVEE-VDGRATQKLIVNLKPEKSYSFVLTNRGNSAGGLQHRVTAKT 1103          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. UniProt/SwissProt
Match: sp|P23468|PTPRD_HUMAN (Receptor-type tyrosine-protein phosphatase delta OS=Homo sapiens OX=9606 GN=PTPRD PE=1 SV=2)

HSP 1 Score: 881.322 bits (2276), Expect = 0.000e+0
Identity = 405/617 (65.64%), Postives = 499/617 (80.88%), Query Frame = 2
Query: 4880 LELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            +EL+++ N Q P +  +         PPIP+  L   I  L+ANDN  FSQEYESIDPGQQFTWE+SNLE+N+ KNRYANVIAYDHSR+LL  I G+ GSDY+NANYIDGY++ NAYIATQG L  TFGDFWRM+WEQ +A++VMMTKLEER+R+KCDQYWP++GTE++  G + VT+ DT ELA Y +RTF +  N SS         +KRE+RQ+QFTAWPDHGVP++P P L FL+R++  NP  + P++VHCSAGVGRTG FIVID  LERI+HE TVDI+G V++MRAQRNYMVQTEDQY+F+H+ +L+AV   NTEV  +N+  ++QKL + +  TG +  TG+ELEF++L+  K + +R  SANLP N+ KNRLVNI+PYE  R+CLQPIRG EGSDYINAS+IDGY+  KAYIATQ PL ET EDFWRM+WEHNSTI+VMLTKLREMGREKCH+YWP ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRTVRQFQFT+WPEQGVP ++ E FI+FIGQVHKTKEQFGQ+GPI+VHCSAGVGRTGVF+ LSI LER++ EGV+D+FQ V+ LR QR  MVQ+E+QY+F Y AA +Y+ SFD +
Sbjct: 1319 VELRRL-NFQTPGMASH---------PPIPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTETH--GLVQVTLLDTVELATYCVRTFALYKNGSS---------EKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIE--TG-ENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFSYRAALEYLGSFDHY 1910          

HSP 2 Score: 375.555 bits (963), Expect = 1.136e-103
Identity = 324/1114 (29.08%), Postives = 517/1114 (46.41%), Query Frame = 2
Query:  203 GQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNE------RFQVVG----TGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNP-PIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPY-YLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVS-AQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESK--IALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDK-PEAVSIKVINSTSSKISWKGPM--KTLDQVKYYIIEWRELSNKSKNSK--VFNVTVDINKSNPNNVYEH--ILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKT-VTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKAN 3472
             ++P   T  P+D T  +G     IC+A G+P+P + +   GK  SN     I      G+ LR Q ++   +  + +C+A N++G  + S  +TV+  + ++P GFP I  GP   + +  + A + C  S +P  ++TW K+      SNN       R + +G     G+L I+   E+D G YEC+ATN  GT  S    L +R         ++E    + P+     +  E+  G   N+TC A GSP+P V W   +G  +    ++ P+G      + + L D+ +S +Y C A + +G+I+  AQI VK  P  P     ++  ATS  + W     NP P+  Y +  K  ++++ +  +  +A                 + +  L  Y++YE +VVAV NNIG   PS P+  QT E  PSS P D+ A+ +S  +I V WK P + NG+I+GYR+YYT      ++NW    V D+    + NL+   TY VKV A+   GDGP+S    ++   G          VP  P N +    S TSI + WT P       +  YEL Y+ DG E G+  +  IEP  T Y +  LKP   Y+  LA ++  G+G S A+++  T          ++    T+ S  S  + W+    E +  I   + I Y  + D  + K        + +DT    ++L  L   + Y + V    +TD      V     S  + I T  N+ VP   P  V ++ +NSTS K+SW+ P+  K   Q++ Y + +  + N     +  + +V +   +   ++  EH  I++ L P   Y + V A + KG G+  K +++ T G   VP  PR +              +     + W+PP  + G + GYR+           K+++P+        E + +  +  I  G +Y+F + A N V FGE      +IPEE P+  P  L  +G   T V L W PP +  RNGIITKY + Y D+  P+L +++    + TT  +T L+ +T Y  K+RA   +G GP+SP   +          +N   KA+    + +SW  PE  N
Sbjct:   20 AETPPRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLRED-QIPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRSESIGGTPIRGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRE--------LREVRR-VPPRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKW--MLGAEDLTPEDDMPIG-----RNVLELNDVRQSANYTCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTW--DSGNPEPVSYYIIQHKPKNSEELYKEIDGVAT--------------TRYSVAGLSPYSDYEFRVVAV-NNIGRGPPSEPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTG----------VPGQPLNFKAEPESETSILLSWTPPR---SDTIANYELVYK-DG-EHGEEQRITIEP-GTSYRLQGLKPNSLYYFRLAARSPQGLGASTAEISARTMQSKPSAPPQDISC--TSPSSTSILVSWQPPPVEKQNGIITEYSIKYTAV-DGEDDK--PHEILGIPSDT--TKYLLEQLEKWTEYRITV--TAHTD------VGPGPESLSVLIRT--NEDVPSGPPRKVEVEAVNSTSVKVSWRSPVPNKQHGQIRGYQVHYVRMENGEPKGQPMLKDVMLADAQWEFDDTTEHDMIISGLQPETSYSLTVTAYTTKGDGARSKPKLVSTTG--AVPGKPRLV----------INHTQMNTALIQWHPPVDTFGPLQGYRLKFGR-------KDMEPLTTLEFSEKEDHFTATD--IHKGASYVFRLSARNKVGFGEEMVKEISIPEEVPTGFPQNLHSEGTTSTSVQLSWQPPVLAERNGIITKYTLLYRDINIPLLPMEQLIVPADTTMTLTGLKPDTTYDVKVRAHTSKGPGPYSPSVQFRTLPVDQVFAKNFHVKAVMKTSVLLSWEIPENYN 1045          

HSP 3 Score: 83.1889 bits (204), Expect = 2.885e-14
Identity = 93/389 (23.91%), Postives = 158/389 (40.62%), Query Frame = 2
Query: 2438 PEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEH---ILNNLLPNKYYKIEVLAASRKGKGS-PEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFG-ETARINYTIPEERPSAPPNKLEIQGEKKT-VTLKWHPPPIDYRNGIITKYKIQY--FDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPA--PENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQ-VSTNRDFPDGKITFKKIV 3571
            P  V  ++++ST+  + WK P +   Q++ Y + +             + T  +N    +NV +     + NL+P K Y ++VLA +  G G      ++I   G   VP  P   +     +          ++ L+W PP+     I  Y          E V +       + ++ E   S     + P   Y F + A +    G  TA I+    + +PSAPP  +       T + + W PPP++ +NGIIT+Y I+Y   D ++             T  ++  L++ T Y   + A    G GP S       ++E  P+  P  +E +A+N   +KVSW  P    Q      Q+ G+ V  V      P G+   K ++
Sbjct:  421 PRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYY-----------TMDPTQHVNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTG---VPGQPLNFKAEPESET---------SILLSWTPPR--SDTIANY----------ELVYKDGEHGEEQRITIEPGTSYRLQGLKPNSLYYFRLAARSPQGLGASTAEISARTMQSKPSAPPQDISCTSPSSTSILVSWQPPPVEKQNGIITEYSIKYTAVDGEDDKPHEILGIPSDTTKYLLEQLEKWTEYRITVTAHTDVGPGPESLSV-LIRTNEDVPSGPPRKVEVEAVNSTSVKVSWRSPVPNKQ----HGQIRGYQVHYVRMENGEPKGQPMLKDVM 769          

HSP 4 Score: 62.003 bits (149), Expect = 8.405e-8
Identity = 87/357 (24.37%), Postives = 153/357 (42.86%), Query Frame = 2
Query: 1010 QPSSS-TIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPL--QQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGY--ELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETT 2065
            QP +S ++ +T  T  G     A++K  L+     +     P  P LV  +  +  +A+I+W     +PP+D++  L           G + +     P   L    K+  F  T++    +Y  ++ A  N +G  +  +       E  P+  P +L ++  +  S++++W+PP+  ++NG I  Y L Y +     +    +    DT   L  L  + TY VKV A+   G GP S +            +TLP       +N    ++  TS+ + W  P        E Y   + +++  D+ GKM +E ++   TQ LI NLKP K+Y   L  +     G+  ++T  T
Sbjct:  791 QPETSYSLTVTAYTTKGD---GARSKPKLVSTTGAV-----PGKPRLV-INHTQMNTALIQW-----HPPVDTFGPL----QGYRLKFGRKDME----PLTTLEFSEKEDHFTATDIHKGASYVFRLSA-RNKVGFGE-EMVKEISIPEEVPTGFPQNLHSEGTTSTSVQLSWQPPVLAERNGIITKYTLLYRDINIPLLPMEQLIVPADTTMTLTGLKPDTTYDVKVRAHTSKGPGPYSPSVQF---------RTLPVD-QVFAKNFHVKAVMKTSVLLSWEIP--------ENYNSAMPFKILYDD-GKMVEE-VDGRATQKLIVNLKPEKSYSFVLTNRGNSAGGLQHRVTAKT 1103          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. UniProt/SwissProt
Match: sp|A7MBJ4|PTPRF_BOVIN (Receptor-type tyrosine-protein phosphatase F OS=Bos taurus OX=9913 GN=PTPRF PE=2 SV=1)

HSP 1 Score: 880.167 bits (2273), Expect = 0.000e+0
Identity = 402/591 (68.02%), Postives = 482/591 (81.56%), Query Frame = 2
Query: 4958 PPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            PPIP+  L   I  L+AND   FSQEYESIDPGQQFTWENSNLE+N+ KNRYANVIAYDHSR++L  I+GV GSDYINANYIDGY++ NAYIATQGPL  T GDFWRMVWEQ TA++VMMT+LEE++R+KCDQYWP +GTE+Y  G I VT+ DT ELA YT+RTF +   Y S SSE      KRE+RQ+QF AWPDHGVP+ P P+L FL+R++A NPL + P++VHCSAGVGRTG FIVID  LER++HE TVDI+G V+ MRAQRNYMVQTEDQYVF+HE +L+A    +TEV  +N+  H+QKL +       +  T +ELEF+ L+  K + +R  SANLP N+ KNRLVNI+PYE  R+CLQPIRG EGSDYINAS++DGY+  KAYIATQ PL E+ EDFWRM+WEHNSTIIVMLT+LREMGREKCH+YWP ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRT+RQFQFT+WPEQGVP +  E FI+FIGQVHKTKEQFGQ+GPITVHCSAGVGRTGVF+ LSI LER++ EGV+D+FQ V+ LR QR  MVQ+E+QY+ CY AA +Y+ SFD +
Sbjct: 1321 PPIPITDLADNIERLKANDGLKFSQEYESIDPGQQFTWENSNLEVNKPKNRYANVIAYDHSRVILTSIDGVPGSDYINANYIDGYRKQNAYIATQGPLPETMGDFWRMVWEQRTATVVMMTRLEEKSRVKCDQYWPARGTETY--GLIQVTLLDTVELATYTVRTFAL---YKSGSSE------KRELRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKTVDIYGHVTCMRAQRNYMVQTEDQYVFIHEALLEAAMCGHTEVPARNLYAHIQKLGQVPPG---ESVTAMELEFKLLANSKAHTSRFISANLPCNKFKNRLVNIMPYELTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTRLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVP-KTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFDHY 1896          

HSP 2 Score: 339.347 bits (869), Expect = 1.824e-92
Identity = 300/1124 (26.69%), Postives = 488/1124 (43.42%), Query Frame = 2
Query:  203 GQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGAS--LR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVD--SNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYY--LNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPM--KTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEE----AKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKTVT-LKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPE----NIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQV 3520
            G S  +  + P D T  +G     +C+A G PKP + +   GK  S  S R  +  FD GA   LR Q +++  +  + +C A N LG    SA ++V++   ++P GFP I  GP   + +  + A + C    +P  +++W K+    VD  ++N R + + +G+L I++  E+D G YEC+ATN  GT  S    L +R    +             P+     S  EV  G   NLTC A G+P+P V W   +G       +  P+G      + + L+++  S +Y C A + +G+I+  AQ+ VK  P  P  +  ++  ATS  + W    S P +  Y +  +    + P   +  +A                 + I  L  ++ Y  +V+AV N+IG   PS  +R +T E  PSSPP  + A+ +S  ++ V W+PP + NG ++GYR+YYT      +  WH +   D      + +L+   TY ++V A+   GDGP S    +    G          VP  P + +    S T IQ+ W  P      ++  YEL Y    DE G+  K   +P  + Y +++LKP   Y   LA +++ GVGV     E    ++  +     K+   ++   +  + W     +S+  +  +  Y + ++  + +    +  + I         L  L   + Y +WV+   +TD      V     SS + + T D D     P  V ++ +NST+ ++SWK P+  K   Q++ Y + +  L N           V + ++      E  ++ L P   Y I V A + KG G+  K +I+ T G   VP  P  +  T ++              L W+PP+   G +LGYR+            E +P       ST  +  D++      +  G TY+F + A N    GE      T PE+ PS  P  L + G   + T L W PP +  RNG IT Y + Y D+       +     + T   ++ L+ +T Y  K+RA   +G GP SP     I S   P  +    N   +A     + +SW  P+            NG  V+V
Sbjct:   29 GDSKPVFVKVPEDQTGLSGGVASFVCQATGEPKPRITWMKKGKKVS--SQRFEVIEFDDGAGSVLRIQPLRVQRDEAIYECTATNSLGEINTSAKLSVLEEE-QLPLGFPSIDMGPQLKVVEKARTATMLCAAGGNPDPEISWFKD-FLPVDPAASNGRIKQLRSGALQIESSEESDQGKYECVATNSAGTRYSAPANLYVRVRRVA-------------PRFSIPPSSQEVMPGGSVNLTCVAVGAPMPYVKW--MMGAEELTKEDEMPVG-----RNVLELSNVVRSANYTCVAISSLGMIEATAQVTVKALPKPPIDLVVTETTATSVTLTWDSGNSEP-VSYYGIQYRPAGAEGPFQEVDGVAT--------------TRYSIGGLSPFSEYAFRVLAV-NSIGRGPPSEAVRARTGEQAPSSPPRRVQARMLSASTMLVQWEPPEEPNGLVRGYRVYYTPDSRRPLSAWH-KHNTDAGLLTTVGSLLPGITYSLRVLAFTAVGDGPPSPTIQVKTQQG----------VPAQPADFQAEVDSDTRIQLSWLLPP---QERIVKYELVYWAAEDE-GQQHKVTFDP-TSSYTVEDLKPDTLYRFQLAARSELGVGVFTPTIEARTAQSTPSAPPQ-KVTCVSVGSTTVRVSWVPPPADSRNGVITQ--YSVAYEAVDGEDRGRHVVDGIGREHSSWD-LVGLEKWTEYRVWVR--AHTD------VGPGPESSPVLVRT-DEDVPSGPPRKVEVEPLNSTAVRVSWKLPVPSKQHGQIRGYQVTYVRLENGEPRGAPIIQDVMLAEAQ-----ETTISGLTPETTYSITVAAYTTKGDGARSKPKIVTTTG--AVPGRPTMMVSTTAMN----------TALLQWHPPKELPGELLGYRLQY------RRADEARP-------STIDFGKDDQHFTVTGLHKGATYIFRLTAKNRAGLGEEFEKEITTPEDVPSGFPQNLRVIGLTTSTTELIWDPPVLAERNGRITNYTVVYRDINS---QQELQNVTADTHLTLSGLKPDTTYDIKVRARTSKGAGPLSPS----IQSRTMPVEQVFAKNFRVEAAMKTSVLLSWEVPDSYKSAVPFRILYNGQSVEV 1046          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. UniProt/SwissProt
Match: sp|A2A8L5|PTPRF_MOUSE (Receptor-type tyrosine-protein phosphatase F OS=Mus musculus OX=10090 GN=Ptprf PE=1 SV=1)

HSP 1 Score: 879.396 bits (2271), Expect = 0.000e+0
Identity = 401/591 (67.85%), Postives = 481/591 (81.39%), Query Frame = 2
Query: 4958 PPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            PPIP+  L   I  L+AND   FSQEYESIDPGQQFTWENSN E+N+ KNRYANVIAYDHSR+LL  I+GV GSDYINANYIDGY++ NAYIATQGPL  T GDFWRMVWEQ TA++VMMT+LEE++R+KCDQYWP +GTE+Y  G I VT+ DT ELA YT+RTF +   + S SSE      KRE+RQ+QF AWPDHGVP+ P P+L FL+R++A NPL + P++VHCSAGVGRTG FIVID  LER++HE TVDI+G V+ MR+QRNYMVQTEDQYVF+HE +L+A    +TEV  +N+  H+QKL +       +  T +ELEF+ L+  K + +R  SANLP N+ KNRLVNI+PYE  R+CLQPIRG EGSDYINAS++DGY+  KAYIATQ PL E+ EDFWRM+WEHNSTIIVMLTKLREMGREKCH+YWP ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRT+RQFQFT+WPEQGVP +  E FI+FIGQVHKTKEQFGQ+GPITVHCSAGVGRTGVF+ LSI LER++ EGV+D+FQ V+ LR QR  MVQ+E+QY+ CY AA +Y+ SFD +
Sbjct: 1321 PPIPITDLADNIERLKANDGLKFSQEYESIDPGQQFTWENSNSEVNKPKNRYANVIAYDHSRVLLTSIDGVPGSDYINANYIDGYRKQNAYIATQGPLPETMGDFWRMVWEQRTATVVMMTRLEEKSRVKCDQYWPVRGTETY--GLIQVTLVDTVELATYTMRTFAL---HKSGSSE------KRELRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFIHEALLEAAMCGHTEVLARNLYAHIQKLGQVPPG---ESVTAMELEFKLLANSKAHTSRFVSANLPCNKFKNRLVNIMPYELTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVP-KTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFDHY 1896          

HSP 2 Score: 343.584 bits (880), Expect = 8.722e-94
Identity = 300/1122 (26.74%), Postives = 487/1122 (43.40%), Query Frame = 2
Query:  203 GQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGAS--LR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVD--SNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPY-YLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPM--KTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEE---AKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKTVT-LKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPE----NIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQV 3520
            G S  +  + P D T  +G     +C+A G PKP + +   GK  S  S R  +  FD GA   LR Q +++  +  + +C A N LG    SA ++V++ + ++P+GFP I  GP   + + G+ A + C    +P  +++W K+    VD  ++N R + + +G+L I++  E+D G YEC+ATN  GT  S    L +R    +             P+     S  EV  G   NLTC A G+P+P V W   +G       +  P+G      + + L+++  S +Y C A + +G+I+  AQ+ VK  P  P  +  ++  ATS  + W    +  P+  Y +  +      P   +  +A+                + I  L  ++ Y  +V+AV N+IG   PS  +R +T E  PSSPP  + A+ +S  ++ V W+PP + NG ++GYR+YYT      +  WH           + +L+   TY ++V A+   GDGP S    +    G          VP  P + +  + S T IQ+ W  P      ++  YEL Y    DE G+  K   +P  + Y +++LKP   YH  LA ++  GVGV     E    ++  +     K+   +    +  + W     +S+  +     Y + ++  + +    +  + I+       +L  L   + Y +WV+   +TD      V     SS + + T D D     P  V ++ +NST+  +SWK P+  K   Q++ Y + +  L N     +     V + ++      E  ++ L P   Y I V A + KG G+  K +++ T G   VP  P  +  T ++              L W+PP+   G +LGYR+            E +P  I      +  K D+      +  G TY+F + A N    GE      T PE+ PS  P  L + G   + T L W PP +  RNG IT Y + Y D+   +     T     T   +  L+ +T Y  K+RA   +G GP SP     I S   P  +    N    A     + +SW  P+            NG  V+V
Sbjct:   29 GDSKPVFVKVPEDQTGLSGGVASFVCQATGEPKPRITWMKKGKKVS--SQRFEVIEFDDGAGSVLRIQPLRVQRDEAIYECTATNSLGEINTSAKLSVLEED-QLPSGFPTIDMGPQLKVVEKGRTATMLCAAGGNPDPEISWFKD-FLPVDPAASNGRIKQLRSGALQIESSEESDQGKYECVATNSAGTRYSAPANLYVRVRRVA-------------PRFSIPPSSQEVMPGGSVNLTCVAVGAPMPYVKW--MMGAEELTKEDEMPVG-----RNVLELSNVMRSANYTCVAISSLGMIEATAQVTVKALPKPPIDLVVTETTATSVTLTW-DSGNTEPVSFYGIQYRAAGTDGPFQEVDGVAS--------------TRYSIGGLSPFSEYAFRVLAV-NSIGRGPPSEAVRARTGEQAPSSPPRRVQARMLSASTMLVQWEPPEEPNGLVRGYRVYYTPDSRRPLSAWHKHNTDAGLLTTVGSLLPGITYSLRVLAFTAVGDGPPSPTIQVKTQQG----------VPAQPADFQANAESDTRIQLSWLLPP---QERIVKYELVYWAAEDE-GQQHKVTFDP-TSSYTLEDLKPDTLYHFQLAARSDLGVGVFTPTVEARTAQSTPSAPPQ-KVTCVSTGSTTVRVSWVPPPADSRNGII--TQYSVAYEAVDGEDRKRHVVDGISREHSSWDLLG-LEKWTEYRVWVR--AHTD------VGPGPESSPVLVRT-DEDVPSGPPRKVEVEPLNSTAVHVSWKLPVPNKQHGQIRGYQVTYVRLENGEPRGQPIIQDVMLAEAQ-----ETTISGLTPETTYSITVAAYTTKGDGARSKPKVVTTTG--AVPGRPTMMVSTTAMH----------TALLQWHPPKELPGELLGYRLQY------RRADEARPNTI------DFGKDDQHFTVTGLHKGATYVFRLAAKNRAGPGEEFEKEITTPEDVPSGFPQNLRVTGLTTSTTELTWDPPVLAERNGHITNYTVVYRDINSQLELQNVTNDTHLT---LLGLKPDTTYDIKVRAHTSKGAGPLSPS----IQSRTMPVEQVFAKNFRVAAAMKTSVLLSWEVPDSYKSAVPFKILYNGQSVEV 1046          

HSP 3 Score: 124.405 bits (311), Expect = 1.015e-26
Identity = 234/1136 (20.60%), Postives = 434/1136 (38.20%), Query Frame = 2
Query:  521 PIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQVV----GTGS-LTIKNVR-ETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEV-STGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGL-IKKEAQIIVKKKPMAPTLV----SYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKG--YRLYYTERLWSAIDNWHIREVQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSAT-ICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVI----NSTSSKISWKGPMKTLDQ--VKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLP-NKY--YKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWN--PPQISHGLILGYRVAISLIGPPEFVK----ELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPW---SPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQVST--NRDFPDGKITFKKIVGPFTSTVMEKIYPNHYFIRVQAIIRDKRIAEWSNIHTLTVFKSKYTERNIKGLNCIGQTNSIKVTWEKPDDYTEIKSFLIELSG 3823
            P+    P D     G +A   C+ + +P  ++TW+K   +KV S  +RF+V+    G GS L I+ +R + D   YEC ATN +G +           N ++ L  ++E + P     +D   +++V   G+ A + C A G+P P + W  +   P  P   N  +   +  +  I  ++ ++ G Y C A N  G      A + V+ + +AP       S   +   S  +  + V +  P   + +  ++ + +D     R +                   +++ +    NY    VA+S+ +G  + +  +  + L      PP DL     +  S+ +TW     +     G  YR   T+  +  +D      V  T Y +  L   + Y  +V A N  G GP S+A   +    G+   + P      P+ ++   LS +++ + W  P    +  + GY + Y  D       + +H         + +L PG  Y + +   T  G G  +   +    + +  + ++ +    N   D+   + W +   E        + Y L++  +E     E   + +T      + L  L+PD+ Y             +  +  +      +F  TV+  +    P A   KV      ST+ ++SW  P        +  Y + +  +  + +   V +    I++       EH   +LL   K+  Y++ V A +  G G      +++T  +  VPS P      + V++         AV+++W    P   HG I GY+V         +V+    E +   I ++V     +    + + P  TY   V A  +   G  ++             P  +       T  L+WHPP      G +  Y++QY    E          +      +T L +   YVF++ A N+ G G        TP  + S F   P+N+    L     +++W+ P        +L++ NG H+   T   RD  + ++  + +      T++       Y I+V+A           +I + T+   +   +N +         S+ ++WE PD Y     F I  +G
Sbjct:   33 PVFVKVPEDQTGLSGGVASFVCQATGEPKPRITWMKKG-KKVSS--QRFEVIEFDDGAGSVLRIQPLRVQRDEAIYECTATNSLGEI-----------NTSAKLSVLEEDQLPSGFPTIDMGPQLKVVEKGRTATMLCAAGGNPDPEISW-FKDFLPVDPAASNGRIKQLRSGALQIESSEESDQGKYECVATNSAGTRYSAPANLYVRVRRVAPRFSIPPSSQEVMPGGSVNLTCVAVGAPMPYVKWMMGAEELTKEDEMPVGRNV------------------LELSNVMRSANY--TCVAISS-LGMIEATAQVTVKAL----PKPPIDLVVTETTATSVTLTWDSGNTEPVSFYGIQYRAAGTDGPFQEVDG-----VASTRYSIGGLSPFSEYAFRVLAVNSIGRGPPSEA---VRARTGEQAPSSP------PRRVQARMLSASTMLVQW-EPPEEPNGLVRGYRVYYTPDSRRPLSAWHKHNTDAGLLTTVGSLLPGITYSLRVLAFTAVGDGPPSPTIQVKTQQGVPAQPADFQ---ANAESDTRIQLSWLLPPQE------RIVKYELVYWAAE----DEGQQHKVTFDPTSSYTLEDLKPDTLY-------------HFQLAARSDLGVGVFTPTVEARTAQSTPSAPPQKVTCVSTGSTTVRVSWVPPPADSRNGIITQYSVAYEAVDGEDRKRHVVD---GISR-------EHSSWDLLGLEKWTEYRVWVRAHTDVGPGPESSPVLVRTDED--VPSGP-----PRKVEVEPLNS---TAVHVSWKLPVPNKQHGQIRGYQVT--------YVRLENGEPRGQPIIQDVMLAEAQETTISGLTPETTYSITVAAYTTKGDGARSKPKVVTTTGAVPGRPTMMVSTTAMHTALLQWHPP--KELPGELLGYRLQYRRADE-ARPNTIDFGKDDQHFTVTGLHKGATYVFRLAAKNRAGPGEEFEKEITTPEDVPSGF---PQNLRVTGLTTSTTELTWDPP--------VLAERNG-HITNYTVVYRDI-NSQLELQNVTNDTHLTLLGLKPDTTYDIKVRAHTSKGAGPLSPSIQSRTMPVEQVFAKNFR--VAAAMKTSVLLSWEVPDSYKSAVPFKILYNG 1041          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. UniProt/SwissProt
Match: sp|F1NWE3|PTPRS_CHICK (Receptor-type tyrosine-protein phosphatase S OS=Gallus gallus OX=9031 GN=PTPRS PE=1 SV=3)

HSP 1 Score: 878.626 bits (2269), Expect = 0.000e+0
Identity = 411/631 (65.13%), Postives = 502/631 (79.56%), Query Frame = 2
Query: 4859 PMFEQRSLELKKISNTQAPDL-VQNALSI------SNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            P   +  +E+++I N Q PD  + + LS       S    PPIPV  L      L+ANDN   SQEYESIDPGQQFTWE+SNLE+N+ KNRYANVIAYDHSR++L  I G++GSDYINANYIDGY++ NAYIATQGPL  TFGDFWRMVWEQ +A+IVMMTKLEE++RIKCDQYWP +GT++Y  G I VT+ DT ELA + +RTF +  N SS         +KRE+RQ+QFTAWPDHGVP+ P P L FL+R++  NP  + PI+VHCSAGVGRTG FIVID  LERI+HE TVDI+G V++MR+QRNYMVQTEDQY F+H+ +L+AV   NTEV  +N+ T++QKL + +     +  TG+ELEF++L+  K + +R  SANLP N+ KNRLVNI+PYE  R+CLQPIRG EGSDYINAS+IDGY+  KAYIATQ PL ET EDFWRM+WEHNSTI+VMLTKLREMGREKCH+YWP ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRTVRQFQFT+WPEQGVP ++ E FI+FIGQVHKTKEQFGQ+GPI+VHCSAGVGRTGVF+ LSI LER++ EGV+D+FQ V+ LR QR  MVQ+E++Y+FCY AA +Y+ SFD +
Sbjct:  900 PHHPKDPVEMRRI-NFQTPDSGLSSPLSDPEFDFESMLSHPPIPVSELAEHTEHLKANDNLKLSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVILLPIEGIVGSDYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTKLEEKSRIKCDQYWPGRGTDTY--GMIQVTLLDTIELATFCVRTFSLHKNGSS---------EKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVPARNLYTYIQKLAQIEVG---EHVTGMELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYETTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFDHY 1514          

HSP 2 Score: 255.373 bits (651), Expect = 8.232e-67
Identity = 197/712 (27.67%), Postives = 334/712 (46.91%), Query Frame = 2
Query:  203 GQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVD--SNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNP-PIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPY-YLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDL 2323
             +SP +  + P+D    +G     +C+A G+PKP V +   GK  ++     I      GA LR Q ++   + ++ +C+A+N  G  T  A +TV+  + ++P GFP I  GP   + +  + A + C  S +P  ++TW K+    VD  ++N R + + +G L I++  ETD G YEC+A+N  G   S    L +R         ++E    + P+        E+  G   N+TC A GSP+P V W +Q     +P  ++ P+G      + + LTD+ +S +Y C A + +G+I+  AQI VK  P AP     ++  ATS  I W     NP P+  Y +  K  S   P+              ++  +     + I  L   + YE+ V AV N+IG   PS  +  +T E  P+S P ++  + +S  ++ + W+ P++ NG+I+GYR+YYT      + NW    V D+    + +L+ + TY V+V A+   GDGP+SD   +    G          VP  P N R  + + TSI + W+ P       +  YEL ++ +GD  G+    + EP  T + ++ LKP   Y   LA ++  G+G           ++IL +   +K+    ++K S  + W+   +       ++I Y              N  N+  D +    ++T+L+P + Y+ 
Sbjct:   28 AESPPVFIKKPVDQIGVSGGVASFVCQATGDPKPRVTWNKKGKKVNSQRFETIEFDESAGAVLRIQPLRTPRDENIYECVAQNPHGEVTVHAKLTVLRED-QLPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKD-FLPVDPSTSNGRIKQLRSGGLQIESSEETDQGKYECVASNSAGVRYSSPANLYVRE--------LREVRR-VAPRFSILPVSHEIMPGGNVNITCVAVGSPMPYVKW-MQGAEDLTPE-DDMPVG-----RNVLELTDVKDSANYTCVAMSSLGVIEAVAQITVKSLPKAPGTPVVTETTATSITITW--DSGNPDPVSYYVIEYKSKSQDGPY--------------QIKEDITTTRYSIGGLSPNSEYEIWVSAV-NSIGQGPPSESVVTRTGEQAPASAPRNVQGRMLSSTTMIIQWEEPVEPNGQIRGYRVYYTMEPDQPVSNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQG----------VPGQPMNFRAEAKTETSIVLSWSPPR---QEIIVKYELLFK-EGDH-GREVPRNFEP-TTSFTVEGLKPNTEYVFRLAARSALGLGAFTPEVRERTLQSILPKNFKVKM----VTKTSVLLSWEFP-ENYNSPTPYKIQY--------------NGLNVDVDGRTTKKLITNLKPHTFYNF 669          

HSP 3 Score: 78.9518 bits (193), Expect = 5.626e-13
Identity = 97/392 (24.74%), Postives = 159/392 (40.56%), Query Frame = 2
Query: 2402 ISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPREL--RMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETAR-INYTIPEERPSAPPNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQVSTNRDFPDGKITFKKI 3568
            ++ +   S+P  P    +    +TS  I+W       D V YY+IE++   +KS++   + +  DI  +       + +  L PN  Y+I V A +  G+G P +  + +T G     S PR +  RM  S             + + W  P   +G I GYRV  ++       +  +PV  ++  + +         +   +TY   V A  SV  G  +  I     +  P  P N       + ++ L W PP    R  II KY++ + +             E  T+  +  L+ NT YVF++ A +  G G ++P           P  +N + K +    + +SW FPE  N  T    Q NG +V V       DG+ T K I
Sbjct:  313 VAQITVKSLPKAPGTPVVTETTATSITITWDS--GNPDPVSYYVIEYK---SKSQDGP-YQIKEDITTTR------YSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRT-GEQAPASAPRNVQGRMLSST-----------TMIIQWEEPVEPNGQIRGYRVYYTM-------EPDQPVSNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNFRAEAKTETSIVLSWSPP----RQEIIVKYELLFKEGDH--GREVPRNFEPTTSFTVEGLKPNTEYVFRLAARSALGLGAFTPEVRERTLQSILP--KNFKVKMVTKTSVLLSWEFPENYNSPTPYKIQYNGLNVDV-------DGRTTKKLI 658          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. TrEMBL
Match: A0A2T7NQE6 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_16668 PE=4 SV=1)

HSP 1 Score: 1246.88 bits (3225), Expect = 0.000e+0
Identity = 804/2181 (36.86%), Postives = 1175/2181 (53.87%), Query Frame = 2
Query:  254 AGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVI---DSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQ--IANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYY--LNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNL-DESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGP--PEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKT-VTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSW---NFPEKANQVTDLLSQVNGFHV--QVSTNRDFPDGKITFKKIVGPFTSTVMEKIYPNH-YFIRVQAIIRDKRIAEWSNIHTLTVFKSKYTERNIKGLNCIGQ-TNSIKVTWEKPDDYTEIKSFLIELSGYRKFRNIYGAYKIEKIKARTSRIEFFGEEQSTYNYSIPNLEPNTNYDXXXXXXXXXXXXXXXXXXXXXCVTLMEQPKSILSPMPVPLRKVSNEIILRLSRTNEILGMISHYYLIVSPIKETHVT--PHDVNIDETFTQTKNLKAMNSR-YVAAQFTPALFRSKSYVDFVLGSNSPIESFHSNDWIFLKRLPVKKKTNLKAFLRACVIPEGLTSDLKSIPVERCTSSEWSMTFSTDINREIQVFTAAVIAGIGSIVFLVFICIGFACFLKRSHSKISRPLGSTDPCLKQPLMMQPGLSGGNLPQYTNIVNIGNSSRHGYTDSLRTNSDLCATSGVMTPINNHQPLSVSNPMFEQRSLELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            A FF    CKA GNP P++ ++  GK   +   R  I      + LR + V+    + +  C+A N LG    +AT+ V    + N E P+G+P I   P     + G    ++CE + +P   + W+K+ +  VD ++ R Q++ +G L I N +E+D  +YEC+A N++G   S   M+           Y+K +  P  P+         V  G   NLTC A GSP+PLV W  + G  +  + +N P+G      + + L D+ ES +Y C A + +G I+   Q+IV+  P +PT ++ S+V A+S  + W    S  P+ SY +  K   +       ++  + N+Y                +T LKA+T+Y+ +VVAVSN I  S PS P+   T EL P +PP ++ A+A S  +I V+W  P   NG I+GY+++YT +    +  W  +EV++      ++ L  N TY + + AY+  G GP+S    +L   G          VP  P NL   ++S   I + W  P   D   +  YEL Y      +   F  H  P  + Y +++L P   YHI ++ K+  G G     T   K    + E     + G  I +    + WK  + ++   AL     Y + F  +E   T  +A     D+     +L  L   + Y +WV              + D  +S   +   D D VP +P  V ++ INST   + W  P +   +++ Y + + E++  S +  +       + +   +  E ++  L P+  Y I+V   +RKG G      II T G   VP+ PR L +    + P        +V + W  P+ ++G +  Y++   + GP    + +++    +Y  V++          +  G TY F V A N+V++GE A      P+  PS  P      G  +T V L W  P  + RNG I  Y+I Y  + + +       T++     I  L+ +T+Y+FKI+A    G GPWS    +       P P+N++ +  +   I+V+W   NFP    ++   +      +V  Q+ T               GP+T   +  + P+  Y +RVQA   D R    S   T  V K    +  ++  +   + TN ++++W  P +   +  +L++ SG + +R      ++++I      +   G+  S   +++ NL+P   ++ +I +++        +  TT   TL+  P  + +P+   +      I+L+L R +E  G ISHY+++V P+K   V   P D  +D+       +    SR Y+AA+F       +    F LG+     +F +         P+ K    + FL                   R  S +  +  S+D + EI +   +  + + +         G    L R      +     D  L    ++ P  SG  L     I+ I   +   Y    R N    + S +M P    + L V  P +    +E+++  + Q P ++ +         PPIP+ RL   I  L+A DN  FSQEYESI+PGQQFTW+NSNLE+N+ KNRYANVIAYDHSR++LQ I+GV GSDYINANY+DGY++ NAYIATQGPL  TFGDFWRMVWEQ +A++VMMTKLEER+RIKCDQYWP++G E+Y  G + V + +  ELA YTIRTF +S  Y       C   +KRE+RQ+QFTAWPDHGVPD+P PLLMF++R++  NP  +  +IVHCSAGVGRTGAFIVID  LERI+HE TVDI+G V+ +RAQRNYMVQTEDQY+F+H+ +L+AV+  NTEV  +N++ H+QKL + +     +  TG+ELEF++L+  K +  R  SANLPVN+ KNRLVNILPYE  R+CLQPIRG +GSDYINAS+IDGY+  KAY+ATQ PL ET EDFWRM+WEHNSTIIVMLTKLREMGREKCH+YWP+ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRT+RQFQFT+WPEQGVP ++ E FI+FIGQVHKTKEQFGQEGPITVHCSAGVGRTGVF+ LSI LER++ EGV+D+FQ V+ LR QR  MVQ+E+Q++FCY AA +Y+ SFD +
Sbjct:   32 ASFF----CKASGNPAPSIAWEKRGKTIVSRRTRYEIVDVPHMSVLRIKPVRAAREDGLYTCVATNSLGEARANATLYVYKKDEVNGEFPSGYPRILLHPKLKSVEKGLSTIMQCEAAGEPDPTIMWLKD-YVPVDLSDPRIQLLESGYLQIHNSQESDEATYECLAENELGVAYSYPAMM-----------YVKVRRVP--PRFSILPEDQNVMPGSDVNLTCVAVGSPMPLVKW--RQGAYDLTDEDNVPVG-----KNVLELKDVRESKNYTCEASSDLGNIEHVVQVIVEALPGSPTRLTASEVTASSVKLSW-DSGSREPVYSYIIQFKPKHDAAADYTEKRNIVHNVY---------------TVTNLKAFTDYQFRVVAVSN-IARSTPSAPLEVTTGELAPGTPPRNIRARAASSTTIVVSWDEPEIPNGIIQGYKVFYTLKPEDPVFFWEQQEVKNDNRLTTISGLEPNQTYTISILAYSSIGPGPMSHPIQVLTTQG----------VPYQPLNLHAEAISPNEIVVKWDAPQEAD--SIISYELYYNDSHTRQNVRFSIH--PPVSSYRLEDLTPDTVYHIQVSAKSSRGEGPRTP-TVQVKTHAFVPEAPPQDVSGRPIDEHQIKVSWKPPIANKQNGALA---GYKIYFVANEAGKTDNDAIMKNVDSSSLSSILDGLSTWTEYKIWVVAY---------TAVGDGPASPPIVVQTDED-VPGEPRKVKVEAINSTGIFVEWTEPKEPNGKIRGYQVYYIEVN--SNDEPIPGRAERYHDTFSGSTKEAVITGLDPDTRYLIQVAGYTRKGDGMRSNPRIITTKG--AVPTPPRNLHVNLIQEDPP-------SVKVTWQRPRDTYGSLENYKI---IWGPQGERYEEKIMSADVYSYVTS---------TLDRGTTYEFRVSAKNNVDYGERAVDTIRTPDGAPSGAPQNFTATGLTETSVRLTWDLPARNLRNGDIVMYQITYHKLADAINEEDLNITDTFVD--IVGLEMDTDYIFKIKAYTSRGAGPWSNRLHFRTFGRMPPPPQNVKVRRTSSTSIEVTWDEPNFPVAGYKIYYNMFATPAMYVWQQMET---------------GPYTVADIGGLEPHTVYAVRVQAKSVDGRFGNLSETVTTDV-KEVQRDNVVQNFHVTQRLTNLVRLSW-SPSEKPGVNIYLLKYSGVKTYRE---NGQVKQINQDPQEVRIPGQMTS---WTVKNLQPKMKFEFNISVIFQDGETGPDVHITTE--TLINAPPYVEAPVVSAVE--GGTIVLKLERASEKNGPISHYHIVVVPLKSGSVNKMPSDFTMDDLIYDNMGMDKPASRPYIAARFEAQALPPQ----FYLGNGQEYGAFVNR--------PLDKDDKYRVFL-------------------RAYSVDPRLYKSSDYSDEIDISGVSGSSNVRTTSTAGSNGSGKVSTLPRGQE--VQDFDEKDMLLT---IVAPTCSGAVL-----IICI--CAAITYLMMRRKNK---SKSVMMEP--EAKALMVDVPPYLVDPVEMRR-QHYQTPAMISH---------PPIPIERLGEHIEMLKAADNLKFSQEYESIEPGQQFTWDNSNLEVNKPKNRYANVIAYDHSRVILQPIDGVPGSDYINANYMDGYRKQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTKLEERSRIKCDQYWPSRGAETY--GLMHVQLVEVTELATYTIRTFHLS-RYG------CP--EKREVRQFQFTAWPDHGVPDHPTPLLMFMRRVKVSNPPDTGSMIVHCSAGVGRTGAFIVIDAMLERIKHEKTVDIYGHVTCLRAQRNYMVQTEDQYIFIHDALLEAVQCGNTEVPARNLAAHIQKLTQPEPG---ETVTGMELEFKRLANVKASPNRFISANLPVNKFKNRLVNILPYESTRVCLQPIRGVDGSDYINASFIDGYRYKKAYVATQGPLAETTEDFWRMLWEHNSTIIVMLTKLREMGREKCHQYWPSERSARYQYFVVDPMTEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTVKMLRTQRPAMVQTEDQFQFCYRAALEYLGSFDHY 2017          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. TrEMBL
Match: A0A4Y2FZ72 (Tyrosine-protein phosphatase Lar OS=Araneus ventricosus OX=182803 GN=Lar_6 PE=4 SV=1)

HSP 1 Score: 1220.3 bits (3156), Expect = 0.000e+0
Identity = 784/2212 (35.44%), Postives = 1154/2212 (52.17%), Query Frame = 2
Query:  188 SCQTSGQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGN--PNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYY-LNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLDQ--VKYYIIEWRELSNKS---KNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFV-KELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKT-VTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQVST-------NRDFPDGKITFKKIVGPFTSTVMEKIYPNHYFIRVQAIIRDKRIAEWSNIHTLTVFKSKYTERNIKGLNCIGQTNSIKVTWEKPDDYTEIKSFLIELSGYRKFRNIYGAYKIEKIKARTSRIEFFGEEQSTYNYSIPNLEPNTNYDXXXXXXXXXXXXXXXXXXXXXCVTLMEQPKSILSPMPVPLRKVSNEIILRLSRTNEILGMISHYYLIVSPIKETHVTPHDVNIDETFTQTKNLKAMNSRYVAAQFTPALFRSKSYVDFVLGSNSPIESF------HSNDWIFLKRLPVKKKTNLKAFLRACVIPEGLTSDLKSI-----PVERCTSSEWSMTFSTDINREIQVFTAAVIAGIGSIVFLVFICIG-FACFLKRSHSKISRPLGSTDPCLKQPLMMQPGLSGGNLPQYTNIVNIGNSSRHGYTDSLRTNSDLCATSGVMTPINNHQPLSVSNPMFEQRSLELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTF-IISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            +C+ S + P  I  +P D T  +G     +C A GNP P ++++ NGK  +   +  I      G+ LR + V+   ++   +C+AEN +G   ++    V+     +P GFP     P     + G+ A + C+   DP   + W+KN    +D +  R+ +    SL I +  E D G+YECMA N  G+ +S    L +R         ++ +            +  EV  G   N+TC A GSP+P V W   + +  P+   P  R         + + LTDI ES +Y C A +K+G ++  AQ++V+  P  PT V  S V ATS  + W     +  I  Y +  K       +  +  I  +++               + +L  YT YE  V+AV N IG   PS P+   T E  P S P ++ A+ +S  ++ + W PP + NG++ GY++YYT R       W+ + V +     +++L     Y +++ A+   G GP S    +    G          VP  P NLR  + S+T++ + W+ P+   + K+ GY+L +    D   +       P    + + +L P   Y++ +A +++ G G +    +   D+ +       ++ G  ++  S  + WK    E +      I Y + +  +E       A  +  +     +++  L   + Y +WV  I  T+       + D   S   I   D D VP +P  V +  INST+  + WK P        ++ Y I  +E++N+       K ++V  +       N  E+ +  L P   Y ++V A +RKG G+  + + +KT G   VP+ P EL      + P+      L   + W+ P   +G ++ Y++        +   + + P+     +            +  G  + F +   N+V +G+ A      PE  P+APP  L  + +  T V + W PP   +RNG IT Y I++    +           ++T  + +NL ENT Y F++ A  K+G GPWSP        +  PAP N++  A +D  ++V W   +      D+L      ++Q          N+  P   +T+   +    S  M       Y IRV A  R   +   S + T+ V  +      ++  +    T+S+ ++W +P     IK + I    +++F +  G  +   I   T  ++      ST NYS+ NL P T+Y ++I  + +  +       T    T M  PK ++ P    ++    EI + L + +E  G ISHY+L+V P +E    P +  IDE  T T + +     Y+AA+F   L RS   + F LG       +      H   +    R  V   T  K+   +    + L+ D+  I      ++        +   + IN +     A +I  +G ++ L+ I     A FL +              C                  Y N  ++    +   T    T   L     +MT      P   ++P      +E++++ N Q P ++ +         PPIP+  L + I  L+ANDN  FSQEYESI+PGQQFTWENSNLEIN+ KNRYANVIAYDHSR++LQ ++ + GSDYINANY DGY++ NAYIATQGPL  TFGDFWRM+WEQ +A+IVMMTKLEERTRIKCDQYWP +GTE+Y  G + V ++D +E+A Y IRT  I+  N            ++RE+RQ+QFTAWPDHGVPD+P P LMFL+R+R+ NP  S P+IVHCSAGVGRTG F+VID+ LER++HE TVDI+G V+ +RAQRNYMVQTEDQYVF+H+ VL+AV A NTEV  +N+  H+Q+LM+     G    TG+ELEF+KL+  K  +++  SANLPVN+ KNRL+NILPYE  R+CLQPIRG +GSDYINAS+IDGY+   AYIATQ PL ET EDFWRM+WEHNS I+VMLTKL+EMGREKCH+YWP ERS R+ Y+VVDP+ EYNMP ++L+EFKVTDARDGQSRT+RQF FT+WPEQGVP ++ + FIEFIGQVHKTKEQFGQEGPITVHCSAGVGR+GVF+ LSI LER++ EGV+D+FQ VR LR QR  MVQ+E+QY+FCY A+ +Y+ SFD +
Sbjct:   20 ACE-SAEDPPAIETYPQDQTVASGGIAVFVCTAVGNPNPQIEWRKNGKRVTTQRYAAI--DMPNGSVLRIEPVRAGRDDATYECVAENGVGEPVRALADLVVLPEDSLPPGFPRFVKQPNMQGIEKGRSAILPCQSEGDPEPNIKWLKNMI-PLDMSIPRYSLHQGSSLQISDAEEEDQGNYECMAENIHGSALSVMATLFVRVRRVPPYFSIRPE------------NLYEVMPGSSLNITCVAVGSPMPFVKWRKGLMDITPDHTIPIGR---------NVLVLTDINESANYTCIAASKLGTLETTAQVVVQALPRPPTNVRISDVTATSVRLSWSYDIGSENIIYYVIQYKPKQANQEYSEISGITTMFY--------------TVRDLSPYTEYEFYVIAV-NGIGRGSPSTPVVATTGETEPGSAPRNVQARPLSSSTVVIQWDPPKEPNGQVTGYKVYYTTRPNLPTSAWNTQPVDNNQLTTISDLTPQTIYTIRIQAFTSRGPGPHSAPVQVKTQQG----------VPSQPSNLRVLATSSTTVHVSWSKPSHSGE-KVIGYDLYW---NDTFTQQQYHQSLPDTDSFTLTDLYPDTLYYVWVAARSRQGEGAATPPAQVRTDQYVPGAPPQ-EVRGNAVNSRSLQVTWKPPPREQQNGAI--IYYKIKYLKAEYGDDLIKAQEIRVEADQLSYIIGGLEKWTEYRVWV--IAGTE-------VGDGPPSLPIILRTDED-VPGEPRQVKVAAINSTAITVRWKPPANKDRNGLIRGYQIHVQEVTNEGDLVNEPKRYDVADE-------NAEEYNVTKLQPETLYAVQVAAVTRKGDGTRSRVKTVKTLGG--VPTRP-ELTAQLIQEEPN------LVAQIQWSRPTNIYGQLVNYKLRYGRADTQQMEERTINPLDQVHQI----------PNLDRGARFEFYLSGKNNVGWGQEAYTYLDTPEGVPTAPPQNLSRRLQSPTGVVITWSPPVQQFRNGQITHYGIKFHKSSD---GSVMERNTTETRMVFSNLDENTEYTFQVNAFTKKGAGPWSPRMTVQTPGDVPPAPTNVQAVATSDQSVEVWW---DPVPYFLDILG-YEVLYIQAPVEDLDKWCNKSVP---LTWSAELTGLDSHAM-------YAIRVAARTRTD-LGRLSELITVRVAPTD-VPTQLRAQDVT--THSMSLSWRRPSKLDPIK-YKISYGAHKEFYDSQGNLQKLPIPTHTVFVD-----ASTTNYSVDNLMPFTSYQVNITAVPADETFRPPAKIT--VTTAMAAPKPMVKPDSFGVKN-GWEITVILPKASEEYGPISHYFLVVVPTEEATKDPGEFTIDE-LTATPSDQV--GPYIAAKF---LHRSMPEI-FPLGDGKMYNGYLNRRLLHDQKYSIFVRAVVD--TPQKSLYTSSPFSDPLSLDMTPIRGPTPAIDPGIRDRNDLPDMSQINSDSD--KAQIIWIVGPVIALILITFFVIAVFLMKRRQ-----------C------------------YRNFPHLYRRRQMAKTPGGETTMKL-----LMTTAERELPTHPTDP------VEIRRM-NYQTPAMINH---------PPIPITELANHIEMLKANDNLKFSQEYESIEPGQQFTWENSNLEINKPKNRYANVIAYDHSRVVLQTLDAISGSDYINANYCDGYRKQNAYIATQGPLPETFGDFWRMIWEQRSATIVMMTKLEERTRIKCDQYWPTRGTETY--GVMQVALSDVQEVATYCIRTLHIMRLNQGVT--------EQREVRQFQFTAWPDHGVPDHPTPFLMFLRRVRSMNPPESGPMIVHCSAGVGRTGCFVVIDSMLERLKHESTVDIYGHVTCLRAQRNYMVQTEDQYVFIHDAVLEAVIAGNTEVPARNLFAHIQQLMQVTPVEG---CTGMELEFKKLANMKTQSSKFVSANLPVNKFKNRLMNILPYESTRVCLQPIRGVDGSDYINASFIDGYKYRNAYIATQGPLPETTEDFWRMLWEHNSNIVVMLTKLKEMGREKCHQYWPNERSQRYLYYVVDPITEYNMPQYILREFKVTDARDGQSRTIRQFHFTDWPEQGVP-KSGDGFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRSGVFITLSIVLERMQYEGVVDVFQTVRTLRTQRPGMVQTEDQYQFCYRASLEYLGSFDHY 2033          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. TrEMBL
Match: A0A4Y2FW63 (Tyrosine-protein phosphatase Lar OS=Araneus ventricosus OX=182803 GN=Lar_6 PE=4 SV=1)

HSP 1 Score: 1217.99 bits (3150), Expect = 0.000e+0
Identity = 782/2213 (35.34%), Postives = 1152/2213 (52.06%), Query Frame = 2
Query:  188 SCQTSGQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGN--PNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYY-LNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLDQ--VKYYIIEWRELSNKS---KNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFV-KELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKT-VTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQVST-------NRDFPDGKITFKKIVGPFTSTVMEKIYPNHYFIRVQAIIRDKRIAEWSNIHTLTVFKSKYTERNIKGLNCIGQTNSIKVTWEKPDDYTEIKSFLIELSGYRKFRNIYGAYKIEKIKARTSRIEFFGEEQSTYNYSIPNLEPNTNYDXXXXXXXXXXXXXXXXXXXXXCVTLMEQPKSILSPMPVPLRKVSNEIILRLSRTNEILGMISHYYLIVSPIKETHVTPHDVNIDETFTQTKNLKAMNSRYVAAQFTPALFRSKSYVDFVLGSNSPIESF------HSNDWIFLKRLPVKKKTNLKAFLRACVIPEGLTSDLKSI-----PVERCTSSEWSMTFSTDINREIQVFTAAVIAGIGSIVFLVFICIG-FACFLKRSHSKISR-PLGSTDPCLKQPLMMQPGLSGGNLPQYTNIVNIGNSSRHGYTDSLRTNSDLCATSGVMTPINNHQPLSVSNPMFEQRSLELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTF-IISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            +C+ S + P  I  +P D T  +G     +C A GNP P ++++ NGK  +   +  I      G+ LR + V+   ++   +C+AEN +G   ++    V+     +P GFP     P     + G+ A + C+   DP   + W+KN    +D +  R+ +    SL I +  E D G+YECMA N  G+ +S    L +R         ++ +            +  EV  G   N+TC A GSP+P V W   + +  P+   P  R         + + LTDI ES +Y C A +K+G ++  AQ++V+  P  PT V  S V ATS  + W     +  I  Y +  K       +  +  I  +++               + +L  YT YE  V+AV N IG   PS P+   T E  P S P ++ A+ +S  ++ + W PP + NG++ GY++YYT R       W+ + V +     +++L     Y +++ A+   G GP S    +    G          VP  P NLR  + S+T++ + W+ P+     K+ GY+L +    D   +       P    + + +L P   Y++ +A +++ G G +    +   D+ +       ++ G  ++  S  + WK    E +      I Y + +  +E       A  +  +     +++  L   + Y +WV  I  T+       + D   S   I   D D VP +P  V +  INST+  + WK P        ++ Y I  +E++N+       K ++V  +       N  E+ +  L P   Y ++V A +RKG G+  + + +KT G   VP+ P EL      + P+      L   + W+ P   +G ++ Y++        +   + + P+     +            +  G  + F +   N+V +G+ A      PE  P+APP  L  + +  T V + W PP   +RNG IT Y I++    +           ++T  + +NL ENT Y F++ A  K+G GPWSP        +  PAP N++  A +D  ++V W   +      D+L      ++Q          N+  P   +T+   +    S  M       Y IRV A  R   +   S + T+ V  +      ++  +    T+S+ ++W +P     IK + I    +++F +  G  +   I   T  ++      ST NYS+ NL P T+Y ++I  + +  +       T    T M  PK ++ P    ++    EI + L + +E  G ISHY+L+V P +E    P +  IDE  T T + +     Y+AA+F   L RS   + F LG       +      H   +    R  V   T  K+   +    + L+ D+  I      ++        +   + IN +     A +I  +G ++ L+ I     A FL +   ++++ P G T   L                                               +MT      P   ++P      +E++++ N Q P ++ +         PPIP+  L + I  L+ANDN  FSQEYESI+PGQQFTWENSNLEIN+ KNRYANVIAYDHSR++LQ ++ + GSDYINANY DGY++ NAYIATQGPL  TFGDFWRM+WEQ +A+IVMMTKLEERTRIKCDQYWP +GTE+Y  G + V ++D +E+A Y IRT  I+  N            ++RE+RQ+QFTAWPDHGVPD+P P LMFL+R+R+ NP  S P+IVHCSAGVGRTG F+VID+ LER++HE TVDI+G V+ +RAQRNYMVQTEDQYVF+H+ VL+AV A NTEV  +N+  H+Q+LM+     G    TG+ELEF+KL+  K  +++  SANLPVN+ KNRL+NILPYE  R+CLQPIRG +GSDYINAS+IDGY+   AYIATQ PL ET EDFWRM+WEHNS I+VMLTKL+EMGREKCH+YWP ERS R+ Y+VVDP+ EYNMP ++L+EFKVTDARDGQSRT+RQF FT+WPEQGVP ++ + FIEFIGQVHKTKEQFGQEGPITVHCSAGVGR+GVF+ LSI LER++ EGV+D+FQ VR LR QR  MVQ+E+QY+FCY A+ +Y+ SFD +
Sbjct:   20 ACE-SAEDPPAIETYPQDQTVASGGIAVFVCTAVGNPNPQIEWRKNGKRVTTQRYAAI--DMPNGSVLRIEPVRAGRDDATYECVAENGVGEPVRALADLVVLPEDSLPPGFPRFVKQPNMQGIEKGRSAILPCQSEGDPEPNIKWLKNMI-PLDMSIPRYSLHQGSSLQISDAEEEDQGNYECMAENIHGSALSVMATLFVRVRRVPPYFSIRPE------------NLYEVMPGSSLNITCVAVGSPMPFVKWRKGLMDITPDHTIPIGR---------NVLVLTDINESANYTCIAASKLGTLETTAQVVVQALPRPPTNVRISDVTATSVRLSWSYDIGSENIIYYVIQYKPKQANQEYSEISGITTMFY--------------TVRDLSPYTEYEFYVIAV-NGIGRGSPSTPVVATTGETEPGSAPRNVQARPLSSSTVVIQWDPPKEPNGQVTGYKVYYTTRPNLPTSAWNTQPVDNNQLTTISDLTPQTIYTIRIQAFTSRGPGPHSAPVQVKTQQG----------VPSQPSNLRVLATSSTTVHVSWSKPSH-SGEKVIGYDLYW---NDTFTQQQYHQSLPDTDSFTLTDLYPDTLYYVWVAARSRQGEGAATPPAQVRTDQYVPGAPPQ-EVRGNAVNSRSLQVTWKPPPREQQNGAI--IYYKIKYLKAEYGDDLIKAQEIRVEADQLSYIIGGLEKWTEYRVWV--IAGTE-------VGDGPPSLPIILRTDED-VPGEPRQVKVAAINSTAITVRWKPPANKDRNGLIRGYQIHVQEVTNEGDLVNEPKRYDVADE-------NAEEYNVTKLQPETLYAVQVAAVTRKGDGTRSRVKTVKTLGG--VPTRP-ELTAQLIQEEPN------LVAQIQWSRPTNIYGQLVNYKLRYGRADTQQMEERTINPLDQVHQI----------PNLDRGARFEFYLSGKNNVGWGQEAYTYLDTPEGVPTAPPQNLSRRLQSPTGVVITWSPPVQQFRNGQITHYGIKFHKSSD---GSVMERNTTETRMVFSNLDENTEYTFQVNAFTKKGAGPWSPRMTVQTPGDVPPAPTNVQAVATSDQSVEVWW---DPVPYFLDILG-YEVLYIQAPVEDLDKWCNKSVP---LTWSAELTGLDSHAM-------YAIRVAARTRTD-LGRLSELITVRVAPTD-VPTQLRAQDVT--THSMSLSWRRPSKLDPIK-YKISYGAHKEFYDSQGNLQKLPIPTHTVFVD-----ASTTNYSVDNLMPFTSYQVNITAVPADETFRPPAKIT--VTTAMAAPKPMVKPDSFGVKN-GWEITVILPKASEEYGPISHYFLVVVPTEEATKDPGEFTIDE-LTATPSDQV--GPYIAAKF---LHRSMPEI-FPLGDGKMYNGYLNRRLLHDQKYSIFVRAVVD--TPQKSLYTSSPFSDPLSLDMTPIRGPTPAIDPGIRDRNDLPDMSQINSDSD--KAQIIWIVGPVIALILITFFVIAVFLMKRRRQMAKTPGGETTMKL-----------------------------------------------LMTTAERELPTHPTDP------VEIRRM-NYQTPAMINH---------PPIPITELANHIEMLKANDNLKFSQEYESIEPGQQFTWENSNLEINKPKNRYANVIAYDHSRVVLQTLDAISGSDYINANYCDGYRKQNAYIATQGPLPETFGDFWRMIWEQRSATIVMMTKLEERTRIKCDQYWPTRGTETY--GVMQVALSDVQEVATYCIRTLHIMRLNQGVT--------EQREVRQFQFTAWPDHGVPDHPTPFLMFLRRVRSMNPPESGPMIVHCSAGVGRTGCFVVIDSMLERLKHESTVDIYGHVTCLRAQRNYMVQTEDQYVFIHDAVLEAVIAGNTEVPARNLFAHIQQLMQVTPVEG---CTGMELEFKKLANMKTQSSKFVSANLPVNKFKNRLMNILPYESTRVCLQPIRGVDGSDYINASFIDGYKYRNAYIATQGPLPETTEDFWRMLWEHNSNIVVMLTKLKEMGREKCHQYWPNERSQRYLYYVVDPITEYNMPQYILREFKVTDARDGQSRTIRQFHFTDWPEQGVP-KSGDGFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRSGVFITLSIVLERMQYEGVVDVFQTVRTLRTQRPGMVQTEDQYQFCYRASLEYLGSFDHY 2021          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. TrEMBL
Match: A0A0V1BCC0 (Tyrosine-protein phosphatase Lar-like OS=Trichinella spiralis OX=6334 GN=ptp-3 PE=4 SV=1)

HSP 1 Score: 1041.18 bits (2691), Expect = 0.000e+0
Identity = 750/2253 (33.29%), Postives = 1148/2253 (50.95%), Query Frame = 2
Query:  233 PLDTTAQAGFFIFLICKAQGNPKPT-VQFKINGKVQSNDSHRKIIRSFD--FGASLRQQVQMDNNNDVVQCI---AENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQV--VGT-GSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYY-LNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALT--HRISYMLIFDISELKSTSENATNLITDTQCCCH--------VLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKS---KNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGL-ILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPN--KLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWS-PGTPYYIS------SEFFPAPENIETKALND-------YQIKVSWNFPEKANQVTDLL--------SQVNGFHVQVS---TNRDFPDGKITFKKIVGPFTSTVM-EKIYPN-HYFIRVQAIIRDKRIAEWSNIHTLTVFKSKYTERNIKGLNCIGQTNSIKVTWEKPDDYTEIKSFLIELSGYRKFRNIYGAYKIEKIKARTSRIEFFGEEQSTYNYSIPNLEPNTNYDXXXXXX-XXXXXXXXXXXXXXXCVTLMEQPKSILSPMPVPLRKV-SNEIILRLSRTNEILGMISHYYLIVSPIKETHVTPHDVNIDETFTQTKNLKAMNSRYVAAQFTPALFRSKSYVDFVLGSNSPIESFHSNDWIFLKRLPVKKKTNLKAFLRACVIPEGLTSDLKSIPVERCTSSEWSMTFSTDINREIQVFTAAVIAGIGSIVFLVFI--CIGFACFLKRSHSKISR-----------PLGSTDPCLKQPLMMQPGLSGGNLPQYTNIVNIGNSSRHGYTDSLRTNSDLCATSGVMTPINNHQPLSVSNPMFEQRSLELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGR-------------------EKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            P D+       I  IC+ + + +   +++  NG   S    R ++ + D    A L + V+  +NN  + C    A++   +   +A + V+D     P GFP +  GP     + G  A + C V  DP   + W+KN+   V+  N R+ +  +G  GSL I+N  E+D G YEC+A N  G   SQS  L ++  +       + +            S+ +V  G   NL+C A G P+P V W    G  +  +    P G      + + LT + ++ +Y C A + +G I+    + VK     P+ +   K  + S  + W PV + P  D+  +L      +  +  +     L     K+ ++++     +T L+ YT YE  V +V+  +G+S PS P+   T E PP  PP ++ ++A+S  SI V W+PP + NG I  Y +YYT +       W  +EV +     + +L  N  Y V+V A N AG GPVS+  P+ VV       T P  +P  PQN++ +++    I + W  P    D  + GY L+Y     +     +E +   +T+ +++NL P   Y   +  K++ G G+ ++      + ++ +      +    +S     + W+  L   +  L   +RI++  + +  +     +   +  +      H        V+  L P + Y + V             V      S+  I+   +D VP  P  + +  +N++S+ ++W+ P+     +  Y +   EL +     ++ ++F      +  N   VY+     L+PN  Y   + A +RKG G   K  ++        PS PR+L    SV++   + P +L   L WN P+ ++   +L YR+  + +       E +    + N+++   ++     +  G++Y F V A N   FG + ++  T P   PS  P   + EI    K +   W PP +D RNG IT Y+ +   +  P       E    T   +   +    Y F +RA N  G GPWS P T    S      S +   P   E + L +        Q++V  N   +A   T  L         +V G+ V  +   ++R + D     K+I+ P    ++ E + P  HY   V+ I+ D  + E S  +   V + KY   ++        ++ +++ WE   D  +  SF ++  G ++++     +K   I   T+  E     Q   N  + NL P TNY   + ++  +   +   + +T   VT    P  I +P  V L  + S E++LRL    E  G +S+Y+L+V P +   + P  +   E              YVAA+ T     +     F LG       F           P+  K + K FLRA +  E   SD    P +  TSS +S  FS          +++ +  +G I+ L+ +   IG  CF   + +K ++            LG   P     L+     + GN    T +VN    + + Y+ S   N    A +G                  EQ  +E++ +   Q P  V      S S   PIPV    + I+ L+ANDN +FS+EYESI+ GQQ TW++SN + N+ KNRYANV+AYDHSR++L  +  + GSDYINANYIDGY R  AYIATQGP+  TF DFWRMVWE+ +A++VM+TKLEERTRIKCDQYWP++G+  Y  G + V + DT ELA+YT+R F IS    S         + RE+R  QFTAWPDHGVP++P P L+FLKR++A NP  S PIIVHCSAGVGRTGA+IV+DT L+R+R+E T+DI+G V+ +R+QRNYMVQTE+QYVF+H+ VLDAV++  TEV +  +  H++ L++       + ATG+ELEF+ LS  K  NA+ T+AN P N+LKNRLVN++PY+++R+CL P+   +GSDYINAS++DGY+  K YIATQ P+  T+ DFWRM+WEHNSTIIVMLTKLRE+GR                   EKC +YWP++++ ++ + +V+P+ EYNMP +VL+EFK+TD+R+GQS+T+R FQ+TEWPEQGVP ++++  I+FIGQVHKT+EQFGQEGPITVHCS GV RTGVF+ALSI LER++ E V+D+F VV+ LR QR NMVQSE+QY+F + AA +Y+ SFD F
Sbjct:   22 PQDSVVLLNSKIGFICQVKSSDQLVKIEWLRNGS--SMHPARYMVEAVDDTTSALLIEPVRERDNNTEIGCALLDADDGQLLAKATARLGVVDMRRLAP-GFPKVVEGPKLRTVEKGGSATLTCRVVGDPKPSILWLKNAL-PVNMTNRRYSISTLGNPGSLVIQNADESDEGRYECVARNHNGVTHSQSAHLYVKVRVFPPFFSRRPE------------SRYQVMPGGSVNLSCVAVGHPMPRVFWRRGSGE-DLEDAFKAPYG-----RNVLTLTAVDKTENYSCVAFSSLGNIESSTTVEVKALAYPPSNLRVLKQNSNSVELAWDPVIAAP--DNNIVLYYLIEYRPKYADMSDFFTL-----KVVNQTET---NVTNLQPYTQYEFHVRSVTA-VGHSRPSRPVETTTHEAPPQGPPKNVHSRAVSVSSIMVQWEPPEKPNGFIVAYMVYYTSQPTEPFSVWSTKEVGNERLTTVGDLQPNVVYTVRVQARNSAGFGPVSE--PVSVV-------TQP-GIPGQPQNVKASAIGARRILLTWESPLFSSD--ITGYVLRYNSTSTDH---VEEEVGGSKTERVVENLTPNTDYSFQVYAKSQRGKGLFSRAVSQRTNPSVPSGAPE-SVVVEALSSRQLRVIWEPPLKSQQNGLITGYRINWEPLINADDDADDEDGDDDDDSAVGTVEHSADKQRSVVIDKLMPYTDYQITVA---------ARTVKGYGPPSEPAIARTHDD-VPGAPLNLKVTPLNASSAHVAWQEPINKNGILVGYSVHIEELDHLGLPLQSGRMFPAQRVASDKNETVVYD-----LIPNTNYSFRLNAYNRKGDGLFTKALVVSMPS--LPPSEPRDL----SVELIQREMPVKL--LLKWNEPEKTYAKPVLRYRIRYATLDNFNHTVETQ----FTNLTSFILQN-----LKNGRSYEFAVAAENEQGFGLSKKLVVTTPTAAPSGAPYDVRYEIDPSAKRLQFSWEPPLLDERNGEITGYETR---LSIPSRNDIVREIHESTVSFLMG-EVGVRYGFAVRAKNSRGYGPWSEPVTVETQSDSCETGSRYRTPPMTSEERRLINSSPCFLVTQMEVK-NVTAQAMSTTSALVVWKPVNERRVRGYKVLYTAEPSDRAWRD-----KEILNPAADRLLIENLMPKVHYAFCVKTILIDGAVTECSE-NAFEVIQPKYVVHDVSVEKL--HSSFVQLRWEY--DGPKPASFYVKYRGKKRYKTQIDEWKELSIDGLTTETE-----QQVLN--VTNLRPYTNYTFDVGVVWLNDTHQHYYLPQTVDIVTKKSVPPFITAP--VVLESLNSKEVLLRLEAATEEYGPVSYYWLVVVPAEFPRI-PDKIENKEVLHAKTYHPMPGDLYVAARLTRREILAMKGGLFTLGDGLRYADF--------TNFPLNNKIHYKTFLRAFLDDEA-ESDFNE-PSQ--TSSMYSAEFSPLTMTASPKMSSSSLWIVGPIIALIVVGFIIGIVCFFVFNLNKKNKLPTKQGSVNKVTLGPVGPTETSRLLKD---AHGN----TTVVN--GPAVNAYSSSKMPNMYCGAGTG------------------EQ--MEMQSVFYPQPPPTVA-----SGSPHSPIPVIEFAAHIDHLKANDNLMFSREYESIETGQQQTWDHSNFDYNKPKNRYANVVAYDHSRVVLSKLADIPGSDYINANYIDGYHRSKAYIATQGPMPETFNDFWRMVWEENSATVVMLTKLEERTRIKCDQYWPSRGSALY--GLVNVAMKDTTELAHYTLRVFQISLQGQS---------EVREVRHLQFTAWPDHGVPEHPTPFLIFLKRVKAVNPAESGPIIVHCSAGVGRTGAYIVVDTMLDRLRYENTIDIYGCVTAIRSQRNYMVQTEEQYVFIHDAVLDAVQSGCTEVPVSKLFLHIENLLQYQ---AMENATGMELEFRHLSTLKFPNAKFTAANRPCNKLKNRLVNVVPYDWSRVCLAPLPHVDGSDYINASFVDGYRLRKMYIATQGPMTNTVNDFWRMLWEHNSTIIVMLTKLRELGREVCPECHKYKSIDLKPLQVEKCCQYWPSDQAEKYDHLLVEPIAEYNMPQYVLREFKLTDSRNGQSKTIRHFQYTEWPEQGVP-KSSDFLIDFIGQVHKTREQFGQEGPITVHCSTGVSRTGVFIALSILLERIRFECVVDIFTVVKLLRAQRPNMVQSEDQYKFLHQAAMEYLGSFDHF 2107          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. TrEMBL
Match: V4BDH7 (Uncharacterized protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_128794 PE=4 SV=1)

HSP 1 Score: 997.653 bits (2578), Expect = 0.000e+0
Identity = 713/2091 (34.10%), Postives = 1058/2091 (50.60%), Query Frame = 2
Query:  584 CEVSADPSAKVTWIKNSHEKVDSNNERFQVVGTGSLTIKNV----RETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMT-PQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTS-------NKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYL--IDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVP----DKPEAVSIKVINSTSSKISWKGPMKT-----LDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRN---VST----ETYKSDEEAKI----GPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLE---IQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDL-LSQVNGFHVQVSTNRDFPDGKITFKKIVGPFTSTVMEKIYPNHYFIRVQAIIRDKRIAEWSNIHTLTVFKSKYTERNIKGLNCIGQTNSIKVTWEKPDDYTEIKSFLIELSGYRKFRNIYGAYKIEKIKARTSRIEFFGEEQSTYNYSIPNLEPNTNYDXXXXXXXXXXXXXXXXXXXXXCVTLMEQPKSILSPMPVPLRKVSNEIILRLSRTNEILGMISHYYLIVSPIKETHVT---PHDVNIDETFTQTKNLKAMNSR-YVAAQFTPALFRSKSYVDFVLGSNSPIESFHSNDWIFLKRLPVKKKTNLKAFLRACVIPEGLTSDLKSIPVERCTSSEWSMTFSTDINREIQVFTAAVIAGIGSIVFLVFICIGFACFLKRSHSKISRPLGSTDPCLKQPLMMQPGLSGGNLPQYTNIVNIGNSSRHGYTDSLRTNSDLCATSGVMTPINNHQPLSVSNPMFEQRSLELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            C+ S +P+    W K  + K++    R+ +  +  LT+  +     + D   + C+A N +G   + + +   R+        M + + P+  P+IV   S   V  G  A + C  EG+P P V+W       +  +P    L         I L+   ++G Y C A+N +G+    A ++  K    P                  P  S PP D+  L   D +       +  P++  RQ A    P + L     +   Q+ +++   NY       S+++GN +    +    +E  PS PP  L A  I+  S+K+ W+ P  ++  +  Y + Y               +  T Y LN+L    TY +++ A N  G    S +     V  G+     P S P   +N+R  + S+T+I + W  PA + +  ++GY++ Y L   EK   F E+ E      +  I +L+P   Y I++   +  G G  +   +    + +  +  NLK     IS +   + W    ++ KI      SY L ++ S ++     + +   +     + L  L PD+ Y             ++ +  K          TV   + P      P+AVS + +N+   ++SWK P +      L+  K Y ++  E  N   +  V  +  D++         +I+  L     YKI+V A +R G G   +  ++KT  +  VP  PR++         + +      +++ W PP  ++G+I GY+V                V++ RN   +S+    +TY  D+   +     P    +  V A      G  +R      +     PP  L    IQ +   + + W  P   + N  +  YK+ +    E    +++     K + +  +L + T Y F++ A N    G  +  T          AP+N     L++  ++++W+ P +  +  D+ + Q+    +    N +  +   T+  I G   +T         Y  +++A    +    WSN      F  K   RN +    +   N++K++W+ P+                K RN       ++I      ++  G+      +++ NL+P   ++ +I  L+     +       S  TL+E  K++        R     I LRL R +E  G +SHY ++V P  E H     P D  +D    + +++    S  Y+AA+F           +F LG+     +F      F +RL     T    FLRA  +   L            TSS++S   S                 +G I + V +  G         +  +R +  +D      L++ P  +GG L      + I    +               + G M  +     + +  P F    +E+++  + Q P ++ +         PPIP+ RL   I+ L+ NDN  FS EYESI+PGQQFTW+NSNLE+N+ KNRYANVIAYDHSR++LQ I+GV GSDYIN NY+DGY++ NAYIATQGPL  TFGDFWRMVWEQ   ++VMMTKLEER+RIKCDQYWP++GTE+Y  G + + + D  EL+ YT+RTF +S  Y       C   +KREIRQ+QFTAWPDHGVPD+P PLLMF++R++  NP  + P++VHCSAGVGRTGAFIVID  LERI+HE TVDI+G V+ +RAQRNYMVQTEDQY+F+H+ +L+AV+  NTEV  +N++ H+QKL + +     +  TG+ELEF++L+  K +  R  SANLP N+ KNRLVNILPYE  R+CLQPIRG +GSDYINAS+IDGY+  KAYIATQ PL ET EDFWRM+WEHNSTIIVMLTKLREMGREKCH+YWP+ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRT+RQFQFT+WPEQGVP ++ E FI+FIGQVHKTKEQFGQEGPITVHCSAGVGRTG F+ LSI LER++ EGV+D+FQ V+ LR QR  MVQ+E+QY+FCY AA +Y+ SFD +
Sbjct:   23 CKASGNPAPSFHWEK-GNRKINPRRNRYIIEESPHLTVLRIDPVKSKKDDAVFTCVADNGLGEARANATLQVFRK--------MADTDIPVGYPRIVVNPSLKSVEKGHNALMKCEVEGNPEPTVYWLKDYLPVDMSDPRITLLDS---GYLQIKLSQEQDAGKYECVAENDVGVAYSYAAMLYVKVRRVP------------------PHFSIPPEDTKVLPGADVNLTCVAVGSPMPYVKWRQGAEELTPEEDLPI--GRNILQLEDVRESKNY---TCVASSDLGNIESIAKV---IVEATPS-PPVQLTASEITATSVKLMWENPNPRS--VLSYVVQYKINTEQGNRYKEKTNIGQTEYILNHLKAYTTYNIRIVAVNDIGRSSPSKS---TQVTTGELA---PGSEP---RNVRARAASSTTIVVSWNPPA-IPNGAIQGYKVFYTLT-PEKPIFFWENQEVTDNNVVTTISDLEPNVTYTITVLAYSNIGQGPMSHPIQVLTTQGVPFQPLNLK--ADAISPNEILVMWDAPQEKEKID-----SYQLYYNDSHMRQNIRISISPPEEK----YKLVDLTPDTVY-------------HIQVSAKSARGEGPKTPTVQAQTQPFVPGASPQAVSGRPLNAHEIEVSWKPPPRDKRNGRLEGYKLYYMK-NEEGNIETDGIVKRLRPDVDS--------YIIKELSTWTEYKIQVRAHTRVGDGPLSQPILVKTDED--VPGEPRKV---------TIEVINSTTIFVEWQPPANANGIIRGYQVYY--------------VEVNRNDEPISSAPYYDTYSGDKREAVITGLNPDTRIMVNVAAYTRKGDGIRSRSKLITTKGAVPTPPRNLHLELIQEDPPRIKVTWQRPRDTHGN--VENYKVIWGRFGE--RYVEKILPAEKYSFVTYSLDKGTKYEFRVLAKNDVDYGERAVETLSTPDGAPAGAPQNFTAIGLSETSVRLTWDLPARNLRNGDIGMYQITYHKLSDPVNEEDLNITDTYMDIQGLEMNT--------DYIFKIKAYT-SRGSGPWSNRLHFRTFDRKDVVRNFR--VTMRTPNTVKLSWDPPE----------------KKRNYRENGVTKQIFQDKEEVQIPGQ---LTMWTLQNLQPKMRFNFNISALFHDEPGIPGPDVHISTETLIEG-KTVT-------RIYRGTITLRLQRASEKNGPLSHYIVVVVP--EQHSVAKYPQDFIMDNLIKEKQSVDQPASHPYIAARFDSDALPD----EFDLGNEQEYGAF------FNRRL--DPDTEYMVFLRAYTVDPRL-----------YTSSDYSDKLS-----------------LGDIEYGVNVVQG-------GSNDNNRIVEESDDGNTLLLIVAPACAGGVLLILFCALVIFFMKK-------------GKSKGAM--LEPESKVLIDAPPFLVDPIEMRR-QHYQTPGMISH---------PPIPIERLAEHIDNLKNNDNLKFSHEYESIEPGQQFTWDNSNLEVNKPKNRYANVIAYDHSRVILQPIDGVPGSDYINGNYMDGYRKQNAYIATQGPLPETFGDFWRMVWEQRCTTVVMMTKLEERSRIKCDQYWPSRGTETY--GLMHIQLVDVTELSTYTVRTFHLS-RYG------CP--EKREIRQFQFTAWPDHGVPDHPTPLLMFMRRVKCSNPPDAGPMVVHCSAGVGRTGAFIVIDAMLERIKHEKTVDIYGHVTCLRAQRNYMVQTEDQYIFIHDALLEAVQCGNTEVPARNLAAHIQKLTQPEPG---ETVTGMELEFKRLANMKASPNRFVSANLPANKFKNRLVNILPYESTRVCLQPIRGVDGSDYINASFIDGYRYRKAYIATQGPLAETTEDFWRMLWEHNSTIIVMLTKLREMGREKCHQYWPSERSARYQYFVVDPMTEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQEGPITVHCSAGVGRTGGFITLSIVLERMRYEGVVDMFQTVKMLRTQRPAMVQTEDQYQFCYRAALEYLGSFDHY 1872          

HSP 2 Score: 348.977 bits (894), Expect = 5.449e-93
Identity = 320/1184 (27.03%), Postives = 530/1184 (44.76%), Query Frame = 2
Query:  212 PAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVID--SNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNP-PIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYY--LNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSK--NSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKT-VTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQVSTNRDFPDGKITFKKIVGPFTSTVMEKIYPNHYF-IRVQAIIRDKRIAEWSNIH--TLTVFKSKYTERNIKG 3727
            P  IT+ P +        +   CKA GNP P+  ++   +  +   +R II        LR   V+   ++ V  C+A+N LG    +AT+ V    ++ ++P G+P I   P     + G  A ++CEV  +P   V W+K+ +  VD ++ R  ++ +G L IK  +E D G YEC+A N VG   S + ML           Y+K +  P  P         +V  G   NLTC A GSP+P V W  Q     +P  E+ P+G      + + L D+ ES +Y C A + +G I+  A++IV+  P  P  ++ S++ ATS  + W     NP  + SY +  K  + +          N Y    K  +   +  + +  LKAYT Y +++VAV N+IG S PS   +  T EL P S P ++ A+A S  +I V+W PP   NG I+GY+++YT      I  W  +EV D      +++L  N TY + V AY+  G GP+S    +L   G          VP  P NL+  ++S   I +MW  P   +  K++ Y+L Y  +     +  +  I P + +Y + +L P   YHI ++ K+  G G     T   + +  +   S   + G  ++     + WK    + +        Y L +  +E  +   +            +++  L   + Y + V+      D  L        S  + + T  ++ VP +P  V+I+VINST+  + W+ P      ++ Y + + E++   +  +S  +  T   +K       E ++  L P+    + V A +RKG G   + ++I T G   VP+ PR L + + ++    + P R+ V   W  P+ +HG +  Y+V     G   +V+++ P + Y  V   TY  D+      G  Y F V A N V++GE A    + P+  P+  P      G  +T V L W  P  + RNG I  Y+I Y  + +PV       T++     I  L+ NT+Y+FKI+A    G GPWS    ++ + +      N          +K+SW+ PEK     +     NG   Q+  +++         +I G  T   ++ + P   F   + A+  D+      ++H  T T+ + K   R  +G
Sbjct:    1 PPRITQQPKNQKVLEDEKVSFFCKASGNPAPSFHWEKGNRKINPRRNRYIIEESPHLTVLRIDPVKSKKDDAVFTCVADNGLGEARANATLQVFRKMADTDIPVGYPRIVVNPSLKSVEKGHNALMKCEVEGNPEPTVYWLKD-YLPVDMSDPRITLLDSGYLQIKLSQEQDAGKYECVAENDVGVAYSYAAML-----------YVKVRRVP--PHFSIPPEDTKVLPGADVNLTCVAVGSPMPYVKWR-QGAEELTPE-EDLPIG-----RNILQLEDVRESKNYTCVASSDLGNIESIAKVIVEATPSPPVQLTASEITATSVKLMW--ENPNPRSVLSYVVQYKINTEQ---------GNRY----KEKTNIGQTEYILNHLKAYTTYNIRIVAV-NDIGRSSPSKSTQVTTGELAPGSEPRNVRARAASSTTIVVSWNPPAIPNGAIQGYKVFYTLTPEKPIFFWENQEVTDNNVVTTISDLEPNVTYTITVLAYSNIGQGPMSHPIQVLTTQG----------VPFQPLNLKADAISPNEILVMWDAPQ--EKEKIDSYQLYY--NDSHMRQNIRISISPPEEKYKLVDLTPDTVYHIQVSAKSARGEGPKTP-TVQAQTQPFVPGASPQAVSGRPLNAHEIEVSWKPPPRDKRNGRLE--GYKLYYMKNEEGNIETDGIVKRLRPDVDSYIIKELSTWTEYKIQVRAHTRVGDGPL--------SQPILVKT--DEDVPGEPRKVTIEVINSTTIFVEWQPPANANGIIRGYQVYYVEVNRNDEPISSAPYYDTYSGDKR------EAVITGLNPDTRIMVNVAAYTRKGDGIRSRSKLITTKG--AVPTPPRNLHL-ELIQ----EDPPRIKV--TWQRPRDTHGNVENYKVIWGRFG-ERYVEKILPAEKYSFV---TYSLDK------GTKYEFRVLAKNDVDYGERAVETLSTPDGAPAGAPQNFTAIGLSETSVRLTWDLPARNLRNGDIGMYQITYHKLSDPVNEEDLNITDTYMD--IQGLEMNTDYIFKIKAYTSRGSGPWS-NRLHFRTFDRKDVVRNFRVTMRTPNTVKLSWDPPEKKRNYRE-----NGVTKQIFQDKE-------EVQIPGQLTMWTLQNLQPKMRFNFNISALFHDEPGIPGPDVHISTETLIEGKTVTRIYRG 1080          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Cavefish
Match: ptprsa (protein tyrosine phosphatase receptor type S [Source:NCBI gene;Acc:103028538])

HSP 1 Score: 897.116 bits (2317), Expect = 0.000e+0
Identity = 528/1274 (41.44%), Postives = 715/1274 (56.12%), Query Frame = 2
Query: 2993 IGPGKTYLFEVQALNSVNFGETAR-INYTIPEERPSAPPNKLEIQG-EKKTVTLKWHPPPIDYRNGIITKYKIQY-FDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQVSTNRDFPDGKITFKKIVGPFTSTVMEKIYPNHYFIRVQAIIRDKRIAEWSNIHTLTVFKSKYTERNI-KGLNC-IGQTNSIKVTWEKPDDYTEIKSFLIELSGYRKFRNIYGAYKIEKIKARTSRIEFFGEEQSTYNYSIPNLEPNTNYDXXXXXXXXXXXXXXXXXXXXXCVTLMEQPKSILSPMPVPLRKVSNEIILRLSRTNEILGMISHYYLIVSPIKETH---VTPHDVNIDETFTQTKNLKAMNSR-------------YVAAQFTPALFRSKSYVDFVLGSNSPIESFHSN------DWIFLKRLPVKKKTNLKAFLRACVIPEGLTSDLKSIPVERCTSSEWSMTFSTDINREIQVFTAAVIAGIGSIVFLVFI-CIGFACFLKRSHSKISRPLGSTDPCLKQPLMMQPGLSGGNLPQYTNIVNIGNSSRHGYTDSLRTNSDLCATSGVMTPINNHQPLSVSNPMFEQRSLELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            + P   Y   V A N++  G  +  +     E+ P++PP  ++ +   + T+ ++W  P  +  NG I  Y++ +  D  +PV   +           I NL  +  Y  ++ A    GDGP+S      +       P   +   + D  I+++W   EK       L    G    + T            K   P +S ++E +  N  +    A + +K I  ++N         K ++ N+ K     +    ++ +TW+  D                +FR  Y   KIE  + + +      +E       I NL PN+ Y+  I     S                +   K  L     P   ++  IIL   +  E   MI   Y++V P+K+       P ++++DE F    N+K  + R             Y+AA F P    S     F LG+      F +       +++F   L     T  K F+ +      + SD+   P+E                         +I  +G ++ +VFI CI  A  L                                   Y N  +         T  L  N+D+       TP   H P   ++P      +E+++I N Q P ++ +         PPIP+  L      L+ANDN   SQEYESIDPGQQFTWE+SNLE+N+ KNRYANVIAYDHSR++L  I G+ GSDYINANYIDGY++ NAYIATQGPL  TFGDFWRMVWEQ +A++VMMT+LEE++RIKCDQYWP++GTE+Y  G   VT+ DT ELA + +RTF +  N SS         +KRE+RQ+QFTAWPDHGVP+ P P L FL+R++  NP  + PII HCSAGVGRTG FIVID  LERI+HE TVDI+G V++MRAQRNYMVQTEDQY F+H+ +L+AV   NTEV+ +++ +++QKL + +     +  TG+ELEF++L+  K + +R  SANLP N+ KNRLVNI+PYE  R+CLQPIRG EGSDYIN+S+IDGY+  KAYIATQ PL ET EDFWRM+WE+NSTI+VMLTKLREMGREKCH+YWP ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRTVRQFQFT+WPEQGVP ++ E FI+FIGQVHKTKEQFGQ+GPI+VHCSAGVGRTGVF+ LSI LER++ EGV+D+FQ V+ LR QR  MVQ+E++Y+FCY AA +Y+ SFD +
Sbjct:  380 LSPNTEYEIRVAAFNTIGQGPASEPVEARTGEQAPASPPRNIQARIISQSTMMVRWEEP--EEPNGQIKGYRVFFTMDPSQPVSMWQIHNVHDSVITTIQNLVASETYTIRVLAFTSVGDGPFSDPIHVKVLQGVPGQPSKFQIGEVTDTTIELTWEPFEKEGITRYELHYKEGSQGSMVT------------KTFSPSSSYMVEGLRANTEYFFSLAAVSNKGIGAFTN-----EISQKTSQANVPKNFTVKLATRTTVLLTWKFSDS---------------RFRQPYSC-KIEYNRQKVNIDARMTKEL------ITNLRPNSTYEFHISCPLDSSDGGSRHRLVARTAPSIPVNKPELDTQREPDNTIT--IILPPLQNRE---MIKSVYVVVVPLKKGRGPMRNPEEMDLDELFKDV-NIKQRHVRTARQLRQIDMKKPYIAASFRPTSMPST----FTLGNQMVYNGFENRMLEPGLEYVFFI-LAELNSTGTKMFVSSTFTESIVVSDVDPQPMETGGD--------------------GLIWVVGPVLAVVFIICIVIAILL-----------------------------------YKNKPDSKRKESEPRTKCLLNNADI-------TP---HHP---TDP------VEVRRI-NFQTPGMMNH---------PPIPITELAEHTELLKANDNLKLSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVILAPIEGITGSDYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIKCDQYWPSRGTETY--GMTQVTLLDTIELATFCVRTFSLHKNGSS---------EKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIIAHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYSFIHDALLEAVACGNTEVAARSLFSYIQKLAQVE---PGEHVTGMELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINSSFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFDHY 1502          

HSP 2 Score: 250.751 bits (639), Expect = 2.471e-66
Identity = 196/720 (27.22%), Postives = 336/720 (46.67%), Query Frame = 2
Query:  221 ITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGAS--LR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVD--SNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQP-SSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNP-PIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPY-YLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGV-SAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVK-PIPNTD 2350
             T+ P+D    +G  +  +C+A G+PKP V +   GK    +S R     FD GA   LR Q ++   + ++ +C+AEN  G  +  A +T+I  +  +P GFP I  GP   + +  + A + C  S +P  ++TW K+    +D  ++N R + + +G+L I+N  ETD G YEC+A+N  G   S    L           Y++ +  P  P+     +  E+  G   N+TC A GSP+P V W +        N E+    D+ P   + + L  + ES +Y C A + +G+I+  +QIIVK  P  P     ++  ATS  I W     NP P+  Y +  +  +       +  I                  + I  L   T YE++V A  N IG    S P+  +T E  P+SPP ++ A+ IS  ++ V W+ P + NG+IKGYR+++T      +  W I  V D+    + NL+ + TY ++V A+   GDGP SD   + V+ G          VP  P   +   ++ T+I++ W      +   +  YEL Y+ +G + G M  +   P  + Y+++ L+    Y  SLA  +  G+G  + ++++ T   N+    + +K+     ++ +  + WK +    +   + +I Y              N   +  D +    ++T+LRP+S Y+  +  P+ ++D
Sbjct:   36 FTKVPVDMIGVSGGVVSFVCQATGDPKPRVSWNKKGK--RVNSQRIETIEFDEGAGAVLRIQPLRAPRDENIYECVAENSEGEVSVQAKLTIIREDL-LPPGFPNIDMGPQLKVVERTRTANMLCAASGNPDPEITWFKD-FLPIDPSASNGRIKQLRSGALQIENTEETDQGKYECVASNVEGVRYSSPANL-----------YVRVRRVP--PRFSILPASHEIMPGGSVNITCVAVGSPMPYVKWML--------NSEDLTPEDDMPVGRNVLELNSVRESANYTCVAMSSLGIIEAVSQIIVKSLPKPPGTPIVTETTATSITITW--DSGNPEPVSHYIIQYRAKTLDSKFETMDSITT--------------TRYSIGGLSPNTEYEIRVAAF-NTIGQGPASEPVEARTGEQAPASPPRNIQARIISQSTMMVRWEEPEEPNGQIKGYRVFFTMDPSQPVSMWQIHNVHDSVITTIQNLVASETYTIRVLAFTSVGDGPFSDPIHVKVLQG----------VPGQPSKFQIGEVTDTTIELTWEP---FEKEGITRYELHYK-EGSQ-GSMVTKTFSP-SSSYMVEGLRANTEYFFSLAAVSNKGIGAFTNEISQKTSQANVPKNFT-VKL----ATRTTVLLTWKFSDSRFRQPYSCKIEY--------------NRQKVNIDARMTKELITNLRPNSTYEFHISCPLDSSD 678          

HSP 3 Score: 55.0694 bits (131), Expect = 1.309e-6
Identity = 82/358 (22.91%), Postives = 147/358 (41.06%), Query Frame = 2
Query: 2402 ISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELR---MTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETAR-INYTIPEERPSAPPNKLEIQGE--KKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNF 3457
            +S +   S+P  P    +    +TS  I+W       + V +YII++R  +  SK   + ++T             + +  L PN  Y+I V A +  G+G P    +    G     S PR ++   ++QS  +            + W  P+  +G I GYRV  ++  P + V   +   ++ +V T          +   +TY   V A  SV  G  +  I+  + +  P   P+K +I GE    T+ L W P    +    IT+Y++ Y +  +   ++        ++ M+  L+ NT Y F + AV+ +G G ++       S      P+N   K      + ++W F
Sbjct:  311 VSQIIVKSLPKPPGTPIVTETTATSITITWDS--GNPEPVSHYIIQYRAKTLDSKFETMDSITTT----------RYSIGGLSPNTEYEIRVAAFNTIGQG-PASEPVEARTGEQAPASPPRNIQARIISQSTMM------------VRWEEPEEPNGQIKGYRVFFTM-DPSQPVSMWQIHNVHDSVITTI------QNLVASETYTIRVLAFTSVGDGPFSDPIHVKVLQGVPGQ-PSKFQI-GEVTDTTIELTWEP----FEKEGITRYELHYKEGSQ--GSMVTKTFSPSSSYMVEGLRANTEYFFSLAAVSNKGIGAFTNEISQKTSQA--NVPKNFTVKLATRTTVLLTWKF 626          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Cavefish
Match: PTPRD (protein tyrosine phosphatase receptor type D [Source:HGNC Symbol;Acc:HGNC:9668])

HSP 1 Score: 892.878 bits (2306), Expect = 0.000e+0
Identity = 412/617 (66.77%), Postives = 501/617 (81.20%), Query Frame = 2
Query: 4880 LELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            +EL+++ N Q P +  +         PPIP+  L   +  L+ANDN  FSQEYESIDPGQQFTWE+SNLE+N+AKNRYANVIAYDHSR+LL  I+G+ GSDYINANYIDGY++ NAYIATQG L  TFGDFWRMVWEQ +A+IVMMTKLEER+R+KCDQYWP +GTE+Y  G I VT+ DT ELA Y +RTF +  N SS         +KRE+RQ+QFTAWPDHGVP++P P L FL+R++A NP  + P++VHCSAGVGRTG FIVID  LERI+HE TVDI+G V++MRAQRNYMVQTEDQYVF+H+ +L+AV   NTEV  +N+  ++QKL + +  TG +  TG+ELEF++L+  K + +R  SANLP N+ KNRLVNI+PYE  R+CLQPIRG EGSDYINAS+IDGY+  KAYIATQ PL ET EDFWRM+WEHNSTI+VMLTKLREMGREKCH+YWP ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRTVRQFQFT+WPEQGVP ++ E FI+FIGQVHKTKEQFGQ+GPI+VHCSAGVGRTGVF+ LSI LER++ EGV+D+FQ V+ LR QR  MVQ+E+QY+FCY A  +Y+ SFD +
Sbjct:  889 VELRRL-NFQTPGMASH---------PPIPIMDLADHLERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKAKNRYANVIAYDHSRVLLSAIDGIPGSDYINANYIDGYRKQNAYIATQGSLPETFGDFWRMVWEQRSANIVMMTKLEERSRVKCDQYWPTRGTETY--GLIQVTLLDTVELATYCVRTFALYKNGSS---------EKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIE--TG-ENVTGMELEFKRLANTKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAGLEYLGSFDHY 1480          

HSP 2 Score: 260.766 bits (665), Expect = 1.429e-69
Identity = 187/635 (29.45%), Postives = 305/635 (48.03%), Query Frame = 2
Query:  209 SPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHE-KVDSNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNP-PIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYY-LNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMV-DDHKLEGYELKY-RLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVG-----VSAQLTETTKDENI 2080
            SP      P D T   G     IC+A G+P+P + +   GK  SN     I      G+ LR Q ++   +  + +C+A N +G  + +  +TV+  + ++PAGFP I  GP   + +  + A + C  S +P   ++W K+       +NN R + + +G+L I+   E+D G YEC+ATN  GT  S    L           Y++ +  P  P+     +  E+  G   N+TC A GSP+P V W   +G+ +    ++ P+G      + + LTD+ +S +Y C A + +G+I+  AQI VK  P  P ++  ++  ATS  + W     NP P+  Y +  K   ++D +  +  +A                 + +  L  Y++YE +VVAV NNIG    S  I  +T E  PS+ P  +  + +S  +  + W+ P + NG+I GYR+YYT      ++ W  + V++  +  +  L  N TYY+KV AY   GDGP+S    I+   G          VP  P + +  + S TSI + W  P     D+++ GYEL Y R D  E+ ++  E      T YL+ +L+P   Y   LA +++ G+G     +SA+  +T   +N 
Sbjct:   12 SPPKFLRTPNDQTGVQGGVASFICQATGDPRPKIVWNKKGKRVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNTVGEISATTRLTVLRED-QLPAGFPTIDMGPQLKVVERTRTATMLCAASGNPDPDISWFKDFLPVNTTNNNGRIKQLRSGALQIEQSEESDQGKYECVATNNDGTRYSAPANL-----------YVRVRRVP--PRFSIPPTDSEIMPGGSVNITCVAVGSPMPYVKW--MLGSEDLTPEDDMPIG-----RNVLELTDVRQSANYTCVAMSTLGVIEAVAQITVKALPKPPGVLVVTERTATSITLTW--DSGNPEPVSYYIIQHKSKYSEDSYKEIDGVAT--------------TRYSVGGLSPYSDYEFRVVAV-NNIGRGPASEAIEDKTAEQAPSTAPRQVRGRMLSATTAIIHWEEPEEANGQIMGYRVYYTMDPSQHVNQWEKQIVRNANFLTIQGLTPNKTYYIKVLAYTSVGDGPLSSDLQIIAKTG----------VPSQPMDFKAEAKSETSILLSWVAPPQSGQDNQITGYELLYKRKDEKEEKRVSFEST----TTYLLKDLRPFTTYSFQLAARSRHGIGAYTNEISAETPQTLFAKNF 594          

HSP 3 Score: 62.7734 bits (151), Expect = 4.959e-9
Identity = 96/397 (24.18%), Postives = 168/397 (42.32%), Query Frame = 2
Query: 2402 ISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPS-MPRELR---MTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKTVT---LKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDL-LSQVNGFHVQVSTNRDFPDGKITFKKI 3568
            ++ +   ++P  P  + +    +TS  ++W       + V YYII+     +KSK S+     +D   +       + +  L P   Y+  V+A +  G+G     E I+     + PS  PR++R   ++ +  I            + W  P+ ++G I+GYRV  ++  P + V + +  +I RN +  T +      + P KTY  +V A  SV  G  +     I   +   P   ++ + E K+ T   L W  PP   ++  IT Y++ Y    E     K    ES TT ++ +L+  T Y F++ A ++ G G ++           F   +N   KA     + ++W  P+  N      +   NG  V+V       DGK+T K I
Sbjct:  291 VAQITVKALPKPPGVLVVTERTATSITLTWDS--GNPEPVSYYIIQ-----HKSKYSEDSYKEIDGVATT-----RYSVGGLSPYSDYEFRVVAVNNIGRGPAS--EAIEDKTAEQAPSTAPRQVRGRMLSATTAI------------IHWEEPEEANGQIMGYRVYYTM-DPSQHVNQWEK-QIVRNANFLTIQG-----LTPNKTYYIKVLAYTSVGDGPLSSDLQII--AKTGVPSQPMDFKAEAKSETSILLSWVAPPQSGQDNQITGYELLYKRKDE--KEEKRVSFESTTTYLLKDLRPFTTYSFQLAARSRHGIGAYTNEISAETPQTLF--AKNFHVKAAMKTSVLLTWEIPDNYNPAQPFTILYDNGQSVEV-------DGKLTQKLI 641          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Cavefish
Match: PTPRD (protein tyrosine phosphatase receptor type D [Source:HGNC Symbol;Acc:HGNC:9668])

HSP 1 Score: 890.952 bits (2301), Expect = 0.000e+0
Identity = 412/617 (66.77%), Postives = 501/617 (81.20%), Query Frame = 2
Query: 4880 LELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            +EL+++ N Q P +  +         PPIP+  L   +  L+ANDN  FSQEYESIDPGQQFTWE+SNLE+N+AKNRYANVIAYDHSR+LL  I+G+ GSDYINANYIDGY++ NAYIATQG L  TFGDFWRMVWEQ +A+IVMMTKLEER+R+KCDQYWP +GTE+Y  G I VT+ DT ELA Y +RTF +  N SS         +KRE+RQ+QFTAWPDHGVP++P P L FL+R++A NP  + P++VHCSAGVGRTG FIVID  LERI+HE TVDI+G V++MRAQRNYMVQTEDQYVF+H+ +L+AV   NTEV  +N+  ++QKL + +  TG +  TG+ELEF++L+  K + +R  SANLP N+ KNRLVNI+PYE  R+CLQPIRG EGSDYINAS+IDGY+  KAYIATQ PL ET EDFWRM+WEHNSTI+VMLTKLREMGREKCH+YWP ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRTVRQFQFT+WPEQGVP ++ E FI+FIGQVHKTKEQFGQ+GPI+VHCSAGVGRTGVF+ LSI LER++ EGV+D+FQ V+ LR QR  MVQ+E+QY+FCY A  +Y+ SFD +
Sbjct: 1316 VELRRL-NFQTPGMASH---------PPIPIMDLADHLERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKAKNRYANVIAYDHSRVLLSAIDGIPGSDYINANYIDGYRKQNAYIATQGSLPETFGDFWRMVWEQRSANIVMMTKLEERSRVKCDQYWPTRGTETY--GLIQVTLLDTVELATYCVRTFALYKNGSS---------EKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIE--TG-ENVTGMELEFKRLANTKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAGLEYLGSFDHY 1907          

HSP 2 Score: 351.288 bits (900), Expect = 4.838e-97
Identity = 307/1144 (26.84%), Postives = 520/1144 (45.45%), Query Frame = 2
Query:  203 GQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHE-KVDSNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNP-PIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYY-LNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMV-DDHKLEGYELKY-RLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVG-----VSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPM--KTLDQVKYYIIEWRELSNKS--KNSKVFNVTVDINK--SNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQ-GEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYY---ISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDL-LSQVNGFHVQVSTNRDFPDGKITFKKI 3568
             ++P      P D T   G     IC+A G+P+P + +   GK  SN     I      G+ LR Q ++   +  + +C+A N +G  + +  +TV+  + ++PAGFP I  GP   + +  + A + C  S +P   ++W K+       +NN R + + +G+L I+   E+D G YEC+ATN  GT  S    L           Y++ +  P  P+     +  E+  G   N+TC A GSP+P V W   +G+ +    ++ P+G      + + LTD+ +S +Y C A + +G+I+  AQI VK  P  P ++  ++  ATS  + W     NP P+  Y +  K   ++D +  +  +A                 + +  L  Y++YE +VVAV NNIG    S  I  +T E  PS+ P  +  + +S  +  + W+ P + NG+I GYR+YYT      ++ W  + V++  +  +  L  N TYY+KV AY   GDGP+S    I+   G          VP  P + +  + S TSI + W  P     D+++ GYEL Y R D  E+ ++  E      T YL+ +L+P   Y   LA +++ G+G     +SA+ T  T+      E++      TNI      + WK    E +  +   I Y + +  +E + T+    + I   +   ++L +L   + Y + V    +TD       L  L  +       + D     P  V ++ +NS+S K+ W+ P+  +   Q++ Y + +  + N     +  + ++ +D  +   + +  YE +L +L     Y + V A + KG G+  K +++ T G   VP  PR +        P+  G       L W+PP  +HG + GYR+           K+++P+ +      E + + +E  I  G +Y F + A N V FGE      +  E+ PS  P  +  +     T+ + W P  +  RNGII KY +QY D+  P    +      ++T ++  L+ +T Y  K+ A   +G GP+SP   +    +    F   +N   KA     + ++W  P+  N      +   NG  V+V       DGK+T K I
Sbjct:   25 AETPPKFLRTPNDQTGVQGGVASFICQATGDPRPKIVWNKKGKRVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNTVGEISATTRLTVLRED-QLPAGFPTIDMGPQLKVVERTRTATMLCAASGNPDPDISWFKDFLPVNTTNNNGRIKQLRSGALQIEQSEESDQGKYECVATNNDGTRYSAPANL-----------YVRVRRVP--PRFSIPPTDSEIMPGGSVNITCVAVGSPMPYVKW--MLGSEDLTPEDDMPIG-----RNVLELTDVRQSANYTCVAMSTLGVIEAVAQITVKALPKPPGVLVVTERTATSITLTW--DSGNPEPVSYYIIQHKSKYSEDSYKEIDGVAT--------------TRYSVGGLSPYSDYEFRVVAV-NNIGRGPASEAIEDKTAEQAPSTAPRQVRGRMLSATTAIIHWEEPEEANGQIMGYRVYYTMDPSQHVNQWEKQIVRNANFLTIQGLTPNKTYYIKVLAYTSVGDGPLSSDLQIIAKTG----------VPSQPMDFKAEAKSETSILLSWVAPPQSGQDNQITGYELLYKRKDEKEEKRVSFEST----TTYLLKDLRPFTTYSFQLAARSRHGIGAYTNEISAE-TPQTQPSAPPQEVTCSSPSSTNI-----LVSWKPPPVELQNGII--IKYTIQYAATEGEDTTTREISEIP-PENVQYLLENLEKWTEYRVTV--TAHTDVGPGPESLPQLIRT-------EEDVPSGPPRKVEVEAVNSSSVKVLWRSPVPNRQHGQIRGYQVHYVRMFNGEPVGHPVIKDILIDDAQWEYDDSTEYEMVLTDLQAETTYSVTVAAYTTKGDGARSKPKLVTTMG--AVPEKPRLMVS------PTNMG----TALLQWHPPPNTHGPLQGYRLRFGR-------KDVEPLTVIEFPERENHYTTKE--IHKGASYTFRLSARNKVGFGEETVKEISTSEDTPSGFPQSIVAESATTTTIQVSWQPVLLAERNGIIIKYALQYKDINSPRSPSELFIAAPESTVILDGLKADTTYDIKMCAFTSKGPGPYSPSIQFRTQPLDQAVF--AKNFHVKAAMKTSVLLTWEIPDNYNPAQPFTILYDNGQSVEV-------DGKLTQKLI 1068          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Cavefish
Match: PTPRD (protein tyrosine phosphatase receptor type D [Source:HGNC Symbol;Acc:HGNC:9668])

HSP 1 Score: 890.567 bits (2300), Expect = 0.000e+0
Identity = 412/617 (66.77%), Postives = 501/617 (81.20%), Query Frame = 2
Query: 4880 LELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            +EL+++ N Q P +  +         PPIP+  L   +  L+ANDN  FSQEYESIDPGQQFTWE+SNLE+N+AKNRYANVIAYDHSR+LL  I+G+ GSDYINANYIDGY++ NAYIATQG L  TFGDFWRMVWEQ +A+IVMMTKLEER+R+KCDQYWP +GTE+Y  G I VT+ DT ELA Y +RTF +  N SS         +KRE+RQ+QFTAWPDHGVP++P P L FL+R++A NP  + P++VHCSAGVGRTG FIVID  LERI+HE TVDI+G V++MRAQRNYMVQTEDQYVF+H+ +L+AV   NTEV  +N+  ++QKL + +  TG +  TG+ELEF++L+  K + +R  SANLP N+ KNRLVNI+PYE  R+CLQPIRG EGSDYINAS+IDGY+  KAYIATQ PL ET EDFWRM+WEHNSTI+VMLTKLREMGREKCH+YWP ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRTVRQFQFT+WPEQGVP ++ E FI+FIGQVHKTKEQFGQ+GPI+VHCSAGVGRTGVF+ LSI LER++ EGV+D+FQ V+ LR QR  MVQ+E+QY+FCY A  +Y+ SFD +
Sbjct: 1319 VELRRL-NFQTPGMASH---------PPIPIMDLADHLERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKAKNRYANVIAYDHSRVLLSAIDGIPGSDYINANYIDGYRKQNAYIATQGSLPETFGDFWRMVWEQRSANIVMMTKLEERSRVKCDQYWPTRGTETY--GLIQVTLLDTVELATYCVRTFALYKNGSS---------EKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIE--TG-ENVTGMELEFKRLANTKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAGLEYLGSFDHY 1910          

HSP 2 Score: 352.829 bits (904), Expect = 1.501e-97
Identity = 306/1141 (26.82%), Postives = 519/1141 (45.49%), Query Frame = 2
Query:  203 GQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHE-KVDSNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNP-PIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYY-LNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMV-DDHKLEGYELKY-RLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVG-----VSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPM--KTLDQVKYYIIEWRELSNKS--KNSKVFNVTVDINK--SNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQ-GEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDL-LSQVNGFHVQVSTNRDFPDGKITFKKI 3568
             ++P      P D T   G     IC+A G+P+P + +   GK  SN     I      G+ LR Q ++   +  + +C+A N +G  + +  +TV+  + ++PAGFP I  GP   + +  + A + C  S +P   ++W K+       +NN R + + +G+L I+   E+D G YEC+ATN  GT  S    L +R         ++E    + P+     +  E+  G   N+TC A GSP+P V W   +G+ +    ++ P+G      + + LTD+ +S +Y C A + +G+I+  AQI VK  P  P ++  ++  ATS  + W     NP P+  Y +  K   ++D +  +  +A                 + +  L  Y++YE +VVAV NNIG    S  I  +T E  PS+ P  +  + +S  +  + W+ P + NG+I GYR+YYT      ++ W  + V++  +  +  L  N TYY+KV AY   GDGP+S    I+   G          VP  P + +  + S TSI + W  P     D+++ GYEL Y R D  E+ ++  E      T YL+ +L+P   Y   LA +++ G+G     +SA+ T  T+      E++      TNI      + WK    E +  +   I Y + +  +E + T+    + I   +   ++L +L   + Y + V    +TD       L  L  +       + D     P  V ++ +NS+S K+ W+ P+  +   Q++ Y + +  + N     +  + ++ +D  +   + +  YE +L +L     Y + V A + KG G+  K +++ T G   VP  PR +        P+  G       L W+PP  +HG + GYR+           K+++P+ +      E + + +E  I  G +Y F + A N V FGE      +  E+ PS  P  +  +     T+ + W P  +  RNGII KY +QY D+  P    +      ++T ++  L+ +T Y  K+ A   +G GP+SP   +          +N   KA     + ++W  P+  N      +   NG  V+V       DGK+T K I
Sbjct:   25 AETPPKFLRTPNDQTGVQGGVASFICQATGDPRPKIVWNKKGKRVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNTVGEISATTRLTVLRED-QLPAGFPTIDMGPQLKVVERTRTATMLCAASGNPDPDISWFKDFLPVNTTNNNGRIKQLRSGALQIEQSEESDQGKYECVATNNDGTRYSAPANLYVRE--------LREVRR-VPPRFSIPPTDSEIMPGGSVNITCVAVGSPMPYVKW--MLGSEDLTPEDDMPIG-----RNVLELTDVRQSANYTCVAMSTLGVIEAVAQITVKALPKPPGVLVVTERTATSITLTW--DSGNPEPVSYYIIQHKSKYSEDSYKEIDGVAT--------------TRYSVGGLSPYSDYEFRVVAV-NNIGRGPASEAIEDKTAEQAPSTAPRQVRGRMLSATTAIIHWEEPEEANGQIMGYRVYYTMDPSQHVNQWEKQIVRNANFLTIQGLTPNKTYYIKVLAYTSVGDGPLSSDLQIIAKTG----------VPSQPMDFKAEAKSETSILLSWVAPPQSGQDNQITGYELLYKRKDEKEEKRVSFEST----TTYLLKDLRPFTTYSFQLAARSRHGIGAYTNEISAE-TPQTQPSAPPQEVTCSSPSSTNI-----LVSWKPPPVELQNGII--IKYTIQYAATEGEDTTTREISEIP-PENVQYLLENLEKWTEYRVTV--TAHTDVGPGPESLPQLIRT-------EEDVPSGPPRKVEVEAVNSSSVKVLWRSPVPNRQHGQIRGYQVHYVRMFNGEPVGHPVIKDILIDDAQWEYDDSTEYEMVLTDLQAETTYSVTVAAYTTKGDGARSKPKLVTTMG--AVPEKPRLMVS------PTNMG----TALLQWHPPPNTHGPLQGYRLRFGR-------KDVEPLTVIEFPERENHYTTKE--IHKGASYTFRLSARNKVGFGEETVKEISTSEDTPSGFPQSIVAESATTTTIQVSWQPVLLAERNGIIIKYALQYKDINSPRSPSELFIAAPESTVILDGLKADTTYDIKMCAFTSKGPGPYSPSIQFRTQPLDQVFAKNFHVKAAMKTSVLLTWEIPDNYNPAQPFTILYDNGQSVEV-------DGKLTQKLI 1071          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Cavefish
Match: PTPRD (protein tyrosine phosphatase receptor type D [Source:HGNC Symbol;Acc:HGNC:9668])

HSP 1 Score: 889.797 bits (2298), Expect = 0.000e+0
Identity = 408/596 (68.46%), Postives = 492/596 (82.55%), Query Frame = 2
Query: 4943 SNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            S +  PPIP+  L   +  L+ANDN  FSQEYESIDPGQQFTWE+SNLE+N+AKNRYANVIAYDHSR+LL  I+G+ GSDYINANYIDGY++ NAYIATQG L  TFGDFWRMVWEQ +A+IVMMTKLEER+R+KCDQYWP +GTE+Y  G I VT+ DT ELA Y +RTF +  N SS         +KRE+RQ+QFTAWPDHGVP++P P L FL+R++A NP  + P++VHCSAGVGRTG FIVID  LERI+HE TVDI+G V++MRAQRNYMVQTEDQYVF+H+ +L+AV   NTEV  +N+  ++QKL + +  TG +  TG+ELEF++L+  K + +R  SANLP N+ KNRLVNI+PYE  R+CLQPIRG EGSDYINAS+IDGY+  KAYIATQ PL ET EDFWRM+WEHNSTI+VMLTKLREMGREKCH+YWP ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRTVRQFQFT+WPEQGVP ++ E FI+FIGQVHKTKEQFGQ+GPI+VHCSAGVGRTGVF+ LSI LER++ EGV+D+FQ V+ LR QR  MVQ+E+QY+FCY A  +Y+ SFD +
Sbjct: 1341 SMASHPPIPIMDLADHLERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKAKNRYANVIAYDHSRVLLSAIDGIPGSDYINANYIDGYRKQNAYIATQGSLPETFGDFWRMVWEQRSANIVMMTKLEERSRVKCDQYWPTRGTETY--GLIQVTLLDTVELATYCVRTFALYKNGSS---------EKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIE--TG-ENVTGMELEFKRLANTKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAGLEYLGSFDHY 1921          

HSP 2 Score: 351.673 bits (901), Expect = 4.016e-97
Identity = 307/1144 (26.84%), Postives = 520/1144 (45.45%), Query Frame = 2
Query:  203 GQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHE-KVDSNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNP-PIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYY-LNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMV-DDHKLEGYELKY-RLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVG-----VSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPM--KTLDQVKYYIIEWRELSNKS--KNSKVFNVTVDINK--SNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQ-GEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYY---ISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDL-LSQVNGFHVQVSTNRDFPDGKITFKKI 3568
             ++P      P D T   G     IC+A G+P+P + +   GK  SN     I      G+ LR Q ++   +  + +C+A N +G  + +  +TV+  + ++PAGFP I  GP   + +  + A + C  S +P   ++W K+       +NN R + + +G+L I+   E+D G YEC+ATN  GT  S    L           Y++ +  P  P+     +  E+  G   N+TC A GSP+P V W   +G+ +    ++ P+G      + + LTD+ +S +Y C A + +G+I+  AQI VK  P  P ++  ++  ATS  + W     NP P+  Y +  K   ++D +  +  +A                 + +  L  Y++YE +VVAV NNIG    S  I  +T E  PS+ P  +  + +S  +  + W+ P + NG+I GYR+YYT      ++ W  + V++  +  +  L  N TYY+KV AY   GDGP+S    I+   G          VP  P + +  + S TSI + W  P     D+++ GYEL Y R D  E+ ++  E      T YL+ +L+P   Y   LA +++ G+G     +SA+ T  T+      E++      TNI      + WK    E +  +   I Y + +  +E + T+    + I   +   ++L +L   + Y + V    +TD       L  L  +       + D     P  V ++ +NS+S K+ W+ P+  +   Q++ Y + +  + N     +  + ++ +D  +   + +  YE +L +L     Y + V A + KG G+  K +++ T G   VP  PR +        P+  G       L W+PP  +HG + GYR+           K+++P+ +      E + + +E  I  G +Y F + A N V FGE      +  E+ PS  P  +  +     T+ + W P  +  RNGII KY +QY D+  P    +      ++T ++  L+ +T Y  K+ A   +G GP+SP   +    +    F   +N   KA     + ++W  P+  N      +   NG  V+V       DGK+T K I
Sbjct:   25 AETPPKFLRTPNDQTGVQGGVASFICQATGDPRPKIVWNKKGKRVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNTVGEISATTRLTVLRED-QLPAGFPTIDMGPQLKVVERTRTATMLCAASGNPDPDISWFKDFLPVNTTNNNGRIKQLRSGALQIEQSEESDQGKYECVATNNDGTRYSAPANL-----------YVRVRRVP--PRFSIPPTDSEIMPGGSVNITCVAVGSPMPYVKW--MLGSEDLTPEDDMPIG-----RNVLELTDVRQSANYTCVAMSTLGVIEAVAQITVKALPKPPGVLVVTERTATSITLTW--DSGNPEPVSYYIIQHKSKYSEDSYKEIDGVAT--------------TRYSVGGLSPYSDYEFRVVAV-NNIGRGPASEAIEDKTAEQAPSTAPRQVRGRMLSATTAIIHWEEPEEANGQIMGYRVYYTMDPSQHVNQWEKQIVRNANFLTIQGLTPNKTYYIKVLAYTSVGDGPLSSDLQIIAKTG----------VPSQPMDFKAEAKSETSILLSWVAPPQSGQDNQITGYELLYKRKDEKEEKRVSFEST----TTYLLKDLRPFTTYSFQLAARSRHGIGAYTNEISAE-TPQTQPSAPPQEVTCSSPSSTNI-----LVSWKPPPVELQNGII--IKYTIQYAATEGEDTTTREISEIP-PENVQYLLENLEKWTEYRVTV--TAHTDVGPGPESLPQLIRT-------EEDVPSGPPRKVEVEAVNSSSVKVLWRSPVPNRQHGQIRGYQVHYVRMFNGEPVGHPVIKDILIDDAQWEYDDSTEYEMVLTDLQAETTYSVTVAAYTTKGDGARSKPKLVTTMG--AVPEKPRLMVS------PTNMG----TALLQWHPPPNTHGPLQGYRLRFGR-------KDVEPLTVIEFPERENHYTTKE--IHKGASYTFRLSARNKVGFGEETVKEISTSEDTPSGFPQSIVAESATTTTIQVSWQPVLLAERNGIIIKYALQYKDINSPRSPSELFIAAPESTVILDGLKADTTYDIKMCAFTSKGPGPYSPSIQFRTQPLDQAVF--AKNFHVKAAMKTSVLLTWEIPDNYNPAQPFTILYDNGQSVEV-------DGKLTQKLI 1068          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Sea Lamprey
Match: ptpra (protein tyrosine phosphatase receptor type A [Source:ZFIN;Acc:ZDB-GENE-020107-1])

HSP 1 Score: 558.14 bits (1437), Expect = 2.658e-176
Identity = 275/599 (45.91%), Postives = 390/599 (65.11%), Query Frame = 2
Query: 4943 SNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQ-QFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQG--PLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            +N   PP+ V RLE + N   A+DN LF +E+ S+     Q T E ++ E N+ KNRY N++ YD+ R+ L  + GV  SDYINA+Y++GY+  N +IA QG  P   T  D+WRM+WE  TA+IVM+T L+ER   KC QYWP++G  +Y  G + V++ D   L  YTIR F+I         +  + K  R I Q+ FT+WPD GVP  P+ +L FLK+++  NP  + PI+VHCSAGVGRTG FIVID  L+ I+ E  VD+FG V+ +RAQR  MVQT+ QYVF+++ +L+     +TE+ + ++ +H+QKL   +  TG    TG+E EF+KL+  K  N +  + NLP N  KNR++ I+PY+FNR+ +   RG E +DYIN S+IDGY+   A++A Q PL +T+EDFWRM+WE  S  IVMLT+L E G+EKC RYWPTE +  +   +++   E +  ++ +++F V++ R+ +SR +RQF F  WPE G+P +  +  I  I  V K ++  G   PITVHCSAG GRTG F AL   LER+K EG+LD+FQ V++LR QR +MVQ+ EQY FCY   Q+Y+ +F  +
Sbjct:  160 TNRKYPPLAVDRLEEEFNRRSADDNKLFREEFNSLPSCPIQATCEAASKEENKEKNRYVNILPYDNFRVHLTSLEGVPDSDYINASYVNGYQEKNKFIAAQGKGPKEETLNDYWRMIWELNTATIVMVTNLKERKECKCAQYWPDQGCWTY--GNLRVSVEDVTVLVDYTIRKFLIQV-----VGDIPNKKPPRLITQFHFTSWPDFGVPFAPIGMLKFLKKVKTCNPPYAGPIVVHCSAGVGRTGTFIVIDAMLDMIQTERKVDVFGFVTRIRAQRCQMVQTDMQYVFIYQALLEFQLYGDTELEVTSLESHLQKLYNKNTPTG---CTGLEDEFKKLTTVKIQNEKMRTGNLPANMKKNRVLQIIPYDFNRVIIPMKRGEEFTDYINGSFIDGYRQKDAFLAGQGPLQQTVEDFWRMVWEWRSCSIVMLTELEERGQEKCARYWPTEGTITYGDIIIELKQENSHDSYTVRDFSVSNTRENKSRQIRQFHFHGWPEIGIP-EDGKGMISLIAAVQKQQQHTGNH-PITVHCSAGAGRTGTFCALCTILERVKTEGILDVFQTVKSLRTQRPHMVQTLEQYEFCYKVVQEYIEAFSDY 746          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Sea Lamprey
Match: ptprsa (protein tyrosine phosphatase receptor type Sa [Source:ZFIN;Acc:ZDB-GENE-020107-3])

HSP 1 Score: 518.079 bits (1333), Expect = 4.428e-164
Identity = 254/461 (55.10%), Postives = 329/461 (71.37%), Query Frame = 2
Query: 4889 KKISNTQAPDLVQ----NALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRA--GNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQN-VKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGR 6250
            K   ++ + D VQ    N  +    + PPIPV      +  L+ANDN LFSQEYESIDPGQQFTW++SNLEIN+ KNRYANV+AYDHSR++L  I+GV GSDYINANYIDGY+R NAYIA+QGPL++T  DFWRMVWEQ +++IVMMTKLEER R+KCDQYWPN+G+ESY  G + VT+TDT ELA Y+ R+F ++ +  +         ++R++RQ+QFTAWPDHGVP+ P P+L FL+R+RA  G+     P+IVHC       G F V     E     +TV ++ QV+ MRAQRNYMVQTE+QY FVH  +++AV +  TE   +++  H+Q+L ++   T   R TG+ LEFQ+L   K   +   S  LP N+LKNRL+ ++P + +R+ LQ IRG +GSDYINASYIDGY++  +AYIATQ PL ET ED WRM+WE NSTI+VMLTKLREMGR
Sbjct:  151 KDTGHSGSADPVQMRRLNHQTPGMEMHPPIPVSEFAGHVERLKANDNMLFSQEYESIDPGQQFTWDHSNLEINKHKNRYANVVAYDHSRVILHTIDGVPGSDYINANYIDGYRRHNAYIASQGPLADTVADFWRMVWEQRSSTIVMMTKLEERARVKCDQYWPNRGSESY--GLVQVTLTDTVELATYSTRSFTLTRSGCT---------ERRDVRQFQFTAWPDHGVPEFPTPVLAFLRRVRAAWGSSADGGPLIVHCRQRSDVCGCFFVGLFMQEGHYGCITVSLYLQVTCMRAQRNYMVQTEEQYAFVHTALVEAVSSGCTETPARSLHAHLQRLSQSVSHT-EPRTTGLHLEFQRLQMSKLRVSTAPSGALPCNKLKNRLLTVIPPDSSRVALQAIRGTQGSDYINASYIDGYRSQQRAYIATQGPLPETTEDLWRMLWEQNSTIVVMLTKLREMGR 599          

HSP 2 Score: 184.882 bits (468), Expect = 5.613e-49
Identity = 97/244 (39.75%), Postives = 133/244 (54.51%), Query Frame = 2
Query: 5987 ANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNS 6718
            +NL +N+ KNR  N++ Y+ +R+ L  I G  GSDYINA+YIDGY+   AYIA+Q PL +T+ DFWRM+WE  S+ IVM+TKL E  R KC +YWP   S  +    V       +  +  + F +T +   + R VRQFQFT WP+ GVP   T   + F+ +V          GP+ VHC       G F       E       + L+  V  +R QR  MVQ+EEQY F + A  + V+S
Sbjct:  218 SNLEINKHKNRYANVVAYDHSRVILHTIDGVPGSDYINANYIDGYRRHNAYIASQGPLADTVADFWRMVWEQRSSTIVMMTKLEERARVKCDQYWPNRGSESYGLVQVTLTDTVELATYSTRSFTLTRSGCTERRDVRQFQFTAWPDHGVPEFPT-PVLAFLRRVRAAWGSSADGGPLIVHCRQRSDVCGCFFVGLFMQEGHYGCITVSLYLQVTCMRAQRNYMVQTEEQYAFVHTALVEAVSS 460          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Sea Lamprey
Match: ca16b (carbonic anhydrase XVI b [Source:ZFIN;Acc:ZDB-GENE-080818-1])

HSP 1 Score: 405.216 bits (1040), Expect = 4.839e-123
Identity = 234/610 (38.36%), Postives = 332/610 (54.43%), Query Frame = 2
Query: 4964 IPVHRLESQINELRANDNFLFSQEYESI-----DPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYING--VLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANY----SSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHC--SAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQ------RATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPT-ERSSRFQYFVV-----DPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNS 6718
            +PV      + E+       FSQE+E +     D G   T E+SN   N+ KNRY N++AYDHSR+ L+ + G     SDYINANY+DGY R  AYIA QGPL  TF DFWRMVWEQ T  IVM+T L E+ R KCDQYWP++  E Y  G I VT+  T+ LA YT+R F I        +S  S     +++R + Q+ +T WPD G PD  +P+L F+++  A       P++VHC  SAGVGRTG +IV+D+ L++IR   TV++ G +  +R QRNY+VQ ++QY F+HE +L+AV    TEV+   +  +   ++    T  T+        T +E +F+ ++Q     +   SA    N+ KNR  +I+P E +R+ L  + G EG+DYINASYI GY     +I TQ PL  T  DFWRMIW+HN+ IIVML   + +  ++   YWP  E +     F V     D +   N    V+ +F +   +D     VR +Q   WP+   P       I  I +   T+     +GP  +H   G    G F AL+  L +L+ +  +D+FQV + +   R  +    EQY F Y AA   + +
Sbjct:   71 LPVKLFARHVGEMHEGALHSFSQEFEEVQRCTADLG--ITAEHSNHPENKHKNRYVNIVAYDHSRVRLRPLPGKDSKHSDYINANYVDGYNRQKAYIAAQGPLKATFADFWRMVWEQNTGIIVMITNLVEKGRRKCDQYWPSESNEEY--GNILVTLKSTRTLACYTVRHFTIRNTKLRKGTSQKSSARGRQNERLVVQFHYTQWPDMGTPDYALPVLTFVRKSSATRTDLMGPVVVHCRRSAGVGRTGTYIVLDSMLQQIRDSGTVNVLGFLKHIRTQRNYLVQPQEQYTFIHESLLEAVLTGETEVAPGQLHAYYTSILSPAATDVTRPVVTATENTHLEKQFRLVTQCSVRQSEFFSATKHCNKEKNRNSSIVPVERSRVGLSSLSGLEGTDYINASYITGYYRSNEFIVTQHPLPHTTRDFWRMIWDHNAQIIVMLPDGQGLAEDES-VYWPGREEAMNCDDFTVTLINEDRLCLANEEQLVIHDFILECLQDDYVLEVRHYQCPRWPDTEGPLSNAFEIINVIREEATTR-----DGPTILHDEFGGVSAGTFCALTTLLHQLEEQESVDVFQVCKMVNLMRPGVFTDIEQYHFVYRAALSLIGT 670          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Sea Lamprey
Match: ptprk (protein tyrosine phosphatase receptor type K [Source:ZFIN;Acc:ZDB-GENE-030131-9834])

HSP 1 Score: 395.201 bits (1014), Expect = 5.000e-113
Identity = 221/601 (36.77%), Postives = 345/601 (57.40%), Query Frame = 2
Query: 4943 SNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKP--NNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMP-NFVLQEFKVTDA---RDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHC---SAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNS 6718
            +  + P + V  L   I +++  + + F +EYES   GQ   W+ +  + NRAKNRY N+IAYDHSR++L  ++    SDYINANY+DGY R + YIATQGPL +T G FWRM+W++ +ASI+M+T L E  RIKC +YWP+ G++ Y D  I VT+ DT+ L+ Y IRTF +         E    +D RE+RQ+ FT WPDHGVP +   LL F++RI+A +P  + P++VHCSAG GRTG ++VID  L+    E  +DI+  V  +R +R  MVQTE+QYVF+H+ +L+A    +T +   +      +++R D  + +     I+ EFQ L+   P      C+ A LP N  KNR  ++LP +     L  I G + S+YINA+ +D Y+   A+I TQ PL  T++DFWR++++++ T IVML +L     + C +YWP E         V+  V +NM  + + + F++ +    +DG  R V QF +  WP       +  +F+  +    + +E++G +G   VHC      +    +   ++ A   +    + +L + + A+ Y+   +V  + QY+FCY  A +Y+ +
Sbjct:  891 TGRLHPAVRVADLLEHIGQMKTGEGYGFKEEYESFFEGQSAPWDVAKRDENRAKNRYGNIIAYDHSRVMLNVLDEEQNSDYINANYVDGYYRTHHYIATQGPLPDTVGGFWRMIWQERSASIIMVTNLVEVGRIKCCKYWPD-GSDVYGD--IKVTLADTEMLSEYIIRTFRV---------ERAGQEDIREVRQFHFTGWPDHGVPYHATGLLAFIRRIKALDPPHAGPLVVHCSAGAGRTGCYMVIDIMLDMAESEGVIDIYNCVRELRTRRVNMVQTEEQYVFIHDAMLEACLCGDTCIPAGDFRAAYAEMLRPDPQSSSNH---IKDEFQTLNMVTPPLRVEDCSIALLPRNHEKNRYHDVLPPDRCLPFLITING-DSSNYINAALMDSYRQPSAFIVTQHPLPNTVKDFWRLVFDYHCTSIVMLNELDS--NKYCPQYWPEEGMLCHGPIQVE-FVAFNMEGDIITRTFRICNVARPQDG-CRMVEQFHYLGWPAGREVPTSRHSFLRLVLAAERWREEYGMDGRTVVHCLNPPPRLLSLPLLSLMATANNHMYQIIITELVEKIMAI-YK--GLVNLQSQYQFCYDVALEYLET 1468          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002738.1 (pep scaffold:Pmarinus_7.0:GL477626:22501:55781:-1 gene:ENSPMAG00000002497.1 transcript:ENSPMAT00000002738.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 370.933 bits (951), Expect = 5.156e-113
Identity = 214/583 (36.71%), Postives = 324/583 (55.57%), Query Frame = 2
Query: 4958 PPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYID--GYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHC--SAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKP--NNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEG--SDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTD---ARDGQSRT--VRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFG-QEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQ 6664
            P I V  L   I ++++ +   F +EYES   GQ   W+ +  + NR +NRY N+IA  HS+ L      VL  DY  A Y++  GY++   YIATQGPL  T  DFWRMVW++ ++SIVM+T L E  R+KC +YWP+   ++   G I VT+  T+ LA Y IRTF +               D  E+RQ+ FT WPDHGVP     LL F++R++A NP  + PII HC  SAG GRTG ++VID  LE    E  +D++  V  +R QR  MVQTE+QYVF+H+V+L+A    +T +   N  +   +L R D  T    +T ++ EF  L+   P      C+ A LP N  KNR+   LP +    CL  +   EG  S+YINA+ +D Y    A+I TQ PL  T++DFWR++++++ T ++ML ++R    E C +YWP E S ++    V+ +      + + + F++ +    +DG      V+  Q+  WP       +  +F+   G+V +   +   +EG   VHC +G GR+G + A+S+  + +K + V+D+F  V+ LR  + +MV+
Sbjct:    1 PAIRVADLLQHIGQMKSTEGCGFKEEYESFLDGQSAPWQVAKKDENRGRNRYGNIIALKHSQKLKVRKQRVLSQDYTEA-YVEQHGYQKQRQYIATQGPLQETAVDFWRMVWQEKSSSIVMVTNLVEVGRVKCFKYWPD---DTQQLGDIAVTLLHTELLAEYVIRTFSVKRK---------GYFDALEVRQFHFTGWPDHGVPAFATGLLSFVRRVKASNPPEAGPIITHCRDSAGAGRTGCYVVIDVMLEMAGREGVIDVYNCVRELRLQRVNMVQTEEQYVFIHDVLLEACLCGDTAIPAANFRSAYLELTRLDPQT---HSTPLKEEFMTLNTVTPALRAEDCSIALLPRNSSKNRVKEALPPDR---CLPFLLTLEGDSSNYINAALLDSYHRPSAFIVTQHPLPNTVKDFWRLVFDYHCTSVIMLNEMRP--SETCPQYWPEEGSLQYGAVHVETLSCCRDGDIISRIFRIHNISRPQDGHREVQHVQHLQYLGWPSHRDAPASPLSFLRVAGRVRRWHAELAEEEGRTLVHCLSGGGRSGTYCAVSVLCDMVKGQSVVDVFTAVKTLRNNKPDMVE 562          

HSP 2 Score: 166.392 bits (420), Expect = 4.197e-43
Identity = 94/234 (40.17%), Postives = 133/234 (56.84%), Query Frame = 2
Query: 6002 NRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYID--GYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHC--SAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCY 6691
            NR +NR  NI+  + ++      +     DY  A Y++  GYQ  + YIATQ PL ET  DFWRM+W+  S+ IVM+T L E+GR KC +YWP + + +     V  +    +  +V++ F V       +  VRQF FT WP+ GVP  AT   + F+ +V  +     + GPI  HC  SAG GRTG ++ + + LE    EGV+D++  VR LR QR NMVQ+EEQY F +
Sbjct:   46 NRGRNRYGNIIALKHSQKLKVRKQRVLSQDYTEA-YVEQHGYQKQRQYIATQGPLQETAVDFWRMVWQEKSSSIVMVTNLVEVGRVKCFKYWPDD-TQQLGDIAVTLLHTELLAEYVIRTFSVKRKGYFDALEVRQFHFTGWPDHGVPAFAT-GLLSFVRRVKASNPP--EAGPIITHCRDSAGAGRTGCYVVIDVMLEMAGREGVIDVYNCVRELRLQRVNMVQTEEQYVFIH 274          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Yeast
Match: PTP1 (Phosphotyrosine-specific protein phosphatase; dephosphorylates a broad range of substrates in vivo, including Fpr3p; localized to the cytoplasm and the mitochondria; proposed to be a negative regulator of filamentation [Source:SGD;Acc:S000002389])

HSP 1 Score: 134.42 bits (337), Expect = 2.096e-34
Identity = 101/290 (34.83%), Postives = 146/290 (50.34%), Query Frame = 2
Query: 5996 PVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYID---GYQNVKA--YIATQAPLMETIEDFWRMIWEH---NSTIIVMLTKLREMGREKCHRYWP------TER-SSRFQ---------YFVVDPMVEYNMPNFVLQEFKVTDAR-------DGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIAL----------------ERLKNEGVLDLF-QVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSF 6721
            P N  +NR VNI+PYE NR+ L+ +    G+DYINASY+      Q+++   YIATQ P  +T + FW+M + +   ++ +IVM+T L E  REKC++YWP      T R +S+++          F  D  +E+   + V   + VTD +        G  +TV  F F  W +   P +     +E     H       +  PI VHCSAGVGRTG F+AL   +                +R   E   DL  Q+V  LR QR  MVQ+++Q+ F Y AA+ Y+NS 
Sbjct:   50 PRNDARNRYVNIMPYERNRVHLKTL---SGNDYINASYVKVNVPGQSIEPGYYIATQGPTRKTWDQFWQMCYHNCPLDNIVIVMVTPLVEYNREKCYQYWPRGGVDDTVRIASKWESPGGANDMTQFPSDLKIEFVNVHKVKDYYTVTDIKLTPTDPLVGPVKTVHHFYFDLWKDMNKPEEVV-PIMELCAHSHSLN---SRGNPIIVHCSAGVGRTGTFIALDHLMHDTLDFKNITERSRHSDRATEEYTRDLIEQIVLQLRSQRMKMVQTKDQFLFIYHAAK-YLNSL 331          

HSP 2 Score: 126.331 bits (316), Expect = 1.238e-31
Identity = 88/278 (31.65%), Postives = 132/278 (47.48%), Query Frame = 2
Query: 5093 NRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYID-----GYKRPNAYIATQGPLSNTFGDFWRMVWEQ---GTASIVMMTKLEERTRIKCDQYWPNKGTESY--------ADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNK----DKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSR--PIIVHCSAGVGRTGAFIVIDTTL----------ERIRH------EMTVDIFGQVSI-MRAQRNYMVQTEDQYVFVHE 5809
            N A+NRY N++ Y+ +R+ L+ ++G   +DYINA+Y+          P  YIATQGP   T+  FW+M +         IVM+T L E  R KC QYWP  G +          + G          +L    +    +   Y+    +           + +  + F  W D   P+  +P++         + L+SR  PIIVHCSAGVGRTG FI +D  +          ER RH      E T D+  Q+ + +R+QR  MVQT+DQ++F++ 
Sbjct:   52 NDARNRYVNIMPYERNRVHLKTLSG---NDYINASYVKVNVPGQSIEPGYYIATQGPTRKTWDQFWQMCYHNCPLDNIVIVMVTPLVEYNREKCYQYWPRGGVDDTVRIASKWESPGGANDMTQFPSDLKIEFVNVHKVKDYYTVTDIKLTPTDPLVGPVKTVHHFYFDLWKDMNKPEEVVPIMELCAH---SHSLNSRGNPIIVHCSAGVGRTGTFIALDHLMHDTLDFKNITERSRHSDRATEEYTRDLIEQIVLQLRSQRMKMVQTKDQFLFIYH 323          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Yeast
Match: PTP2 (Nuclear phosphotyrosine-specific phosphatase involved in osmosensing; involved in the inactivation of mitogen-activated protein kinase (MAPK) during osmolarity sensing; dephosporylates Hog1p MAPK and regulates its localization; with Msg5p co-regulates the calcium signaling pathway [Source:SGD;Acc:S000005734])

HSP 1 Score: 90.1225 bits (222), Expect = 2.032e-18
Identity = 91/330 (27.58%), Postives = 134/330 (40.61%), Query Frame = 2
Query: 5099 AKNRYANVIAYDHSRILLQYI-----------------------------NGVLGSDYINANYIDGYK-RPN-AYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITV--TITDTKELAYYTIRTFII--SANYSSNSSEFCS---NKDKREIR----------QYQFTAWPDH-GVPDNPMPLLMFLKRIRAGNPLS----------------------------SRPIIVHCSAGVGRTGAFIVIDTTLERI----RHEMTVD--------IFGQVSIMRAQRNYMVQTEDQYVFVHEVVLD 5821
             KNRY+N++ Y+HSR+ L +                              +    +DYINANY+   +  P+  YIATQ PL +T  DFW+++       I+ +   +E    K D YW N    SY++  I +  T  +   +    +R F +  +A  + N S+ C    N D   I           Q Q+  W D  GV  N +  L  +K     NP S                            S P++VHCSAG GRTG F+ +D  L  +     H   +D        IF  V+ +R QR  MVQ   QY+  +E +L+
Sbjct:  410 TKNRYSNILPYEHSRVKLPHSPKPPAVSEASTTETKTDKSYPMCPVDAKNHSCKPNDYINANYLKLTQINPDFKYIATQAPLPSTMDDFWKVITLNKVKVIISLNSDDELNLRKWDIYWNN---LSYSNHTIKLQNTWENICNINGCVLRVFQVKKTAPQNDNISQDCDLPHNGDLTSITMAVSEPFIVYQLQYKNWLDSCGVDMNDIIKLHKVKNSLLFNPQSFITSLEKDVCKPDLIDDNNSELHLDTANSSPLLVHCSAGCGRTGVFVTLDFLLSILSPTTNHSNKIDVWNMTQDLIFIIVNELRKQRISMVQNLTQYIACYEALLN 736          

HSP 2 Score: 81.6481 bits (200), Expect = 1.018e-15
Identity = 91/331 (27.49%), Postives = 129/331 (38.97%), Query Frame = 2
Query: 6011 KNRLVNILPYEFNRICLQ-------------------------PI----RGCEGSDYINASYIDGYQ---NVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEY-NMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQG----VPYQATEAFIEF-----------------IGQVHKTKEQ--FGQEGPIT------------------------------VHCSAGVGRTGVFLALSIALERL----KNEGVLD--------LFQVVRALRYQRANMVQSEEQYRFCYLAAQDY 6709
            KNR  NILPYE +R+ L                          P+      C+ +DYINA+Y+   Q   + K YIATQAPL  T++DFW++I  +   +I+ L    E+   K   YW     S     + +      N+   VL+ F+V      Q+  +   Q  + P  G    +    +E FI +                 I ++HK K    F  +  IT                              VHCSAG GRTGVF+ L   L  L     +   +D        +F +V  LR QR +MVQ+  QY  CY A  +Y
Sbjct:  411 KNRYSNILPYEHSRVKLPHSPKPPAVSEASTTETKTDKSYPMCPVDAKNHSCKPNDYINANYLKLTQINPDFK-YIATQAPLPSTMDDFWKVITLNKVKVIISLNSDDELNLRKWDIYWNNLSYSNHTIKLQNTWENICNINGCVLRVFQVKKTA-PQNDNIS--QDCDLPHNGDLTSITMAVSEPFIVYQLQYKNWLDSCGVDMNDIIKLHKVKNSLLFNPQSFITSLEKDVCKPDLIDDNNSELHLDTANSSPLLVHCSAGCGRTGVFVTLDFLLSILSPTTNHSNKIDVWNMTQDLIFIIVNELRKQRISMVQNLTQYIACYEALLNY 737          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Yeast
Match: PTP3 (Phosphotyrosine-specific protein phosphatase; involved in the inactivation of mitogen-activated protein kinase (MAPK) during osmolarity sensing; dephosporylates Hog1p MAPK and regulates its localization; localized to the cytoplasm [Source:SGD;Acc:S000000877])

HSP 1 Score: 59.6918 bits (143), Expect = 4.889e-9
Identity = 39/128 (30.47%), Postives = 60/128 (46.88%), Query Frame = 2
Query: 5516 EIRQYQFTAWPDHGVPDNPMPLL------------MFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTL-----------ERIRHEMTVDIFGQVS----IMRAQRNYMVQTEDQYVFVHEVVL 5818
            E+ Q Q   WPD G   NP+ +L            +F +     + L +  I+VHCSAG GRTG    ID+ L           E ++ +    +F  +S    I R QR  MVQ  +Q++F+++ +L
Sbjct:  751 ELLQIQVKNWPDLGTLLNPISILQAINVKNHIIDTLFARNYYQNDQLPT--ILVHCSAGCGRTGTLCTIDSILSNFEMFEMLQKEFVKLKYPAKLFDPISWTINIFRKQRISMVQNINQFIFIYDCLL 876          

HSP 2 Score: 59.3066 bits (142), Expect = 7.033e-9
Identity = 39/117 (33.33%), Postives = 56/117 (47.86%), Query Frame = 2
Query: 6011 KNRLVNILPYEFNRICL----QPIRGCEGS----------DYINASYID----------GYQNVKA------YIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYW 6271
            KNR  +I PYE +R+ L    Q  +G + S          +YINA+Y+            +Q          YIATQAP+  T+ DF+  I  +   +++ LT   E G EKC+RYW
Sbjct:  530 KNRYKDIFPYEHSRVILKKGLQSSKGIKHSHSTSDGGILDNYINANYLSLPRFSVEQNSSFQTTTTTTRRVRYIATQAPMPSTVHDFYTCILNNGVPLVLSLTNDFENGIEKCYRYW 646          

HSP 3 Score: 54.6842 bits (130), Expect = 1.593e-7
Identity = 34/118 (28.81%), Postives = 52/118 (44.07%), Query Frame = 2
Query: 5099 AKNRYANVIAYDHSRILLQY--------------INGVLGSDYINANYID----------------GYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYW 5362
            AKNRY ++  Y+HSR++L+                +G +  +YINANY+                    R   YIATQ P+ +T  DF+  +   G   ++ +T   E    KC +YW
Sbjct:  529 AKNRYKDIFPYEHSRVILKKGLQSSKGIKHSHSTSDGGILDNYINANYLSLPRFSVEQNSSFQTTTTTTRRVRYIATQAPMPSTVHDFYTCILNNGVPLVLSLTNDFENGIEKCYRYW 646          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Nematostella
Match: EDO46961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNP0])

HSP 1 Score: 697.967 bits (1800), Expect = 0.000e+0
Identity = 331/617 (53.65%), Postives = 434/617 (70.34%), Query Frame = 2
Query: 4880 LELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            +E++++ N Q P ++ +         PPI V  L   I  L+A++N  F+QEYESI+PGQ FT ++S +E N+ KNRY N+ AYDHSR+ L YING+ GSDYINAN+ DGY++  AYIATQGP+ +T  DFWRMVWEQ T +IVM+T+ EER R+KCDQYWP  GT+ Y    I V++ D  ELA YTI T  I    +S           RE++ +QFT WPDHGVP +P P L FL+R++  NP  + PI+VHCSAGVGRTG FIVID+ LER+RHE TVDI+G V+++R QRNYMVQT++QY+F H+ +L+AV   NTEV  +N+  H++KL       G    TG+E EF+ +   +    +  +A L +NR KNRL NILPYE  R+ + P+RG EGSDYINAS+IDGY+    +IATQ PL +T++DFWRM+ E NS IIVMLT+L E   EKC++YWPT+RS+R QY++VDP+ E+  P FV+++FKV DAR    R ++QF F  WPE GVP ++ E  I+ IGQV +  EQ  +EGPITVHCS GVGRTGVF AL I LER+++EGV+DLFQ V+ LR QR  MVQS+EQY FCY  A +Y+ SFD +
Sbjct: 1282 VEMRRL-NFQTPAMIDH---------PPISVLDLPKHIAILKADNNSQFTQEYESIEPGQTFTADSSQMECNKGKNRYPNIHAYDHSRVRLSYINGIEGSDYINANFCDGYRKERAYIATQGPMQHTAADFWRMVWEQRTFTIVMLTREEERGRVKCDQYWPTDGTDVYE--GIEVSLVDWVELANYTISTLQICKEGASQP---------REVKHFQFTGWPDHGVPAHPTPFLAFLRRVKFYNPPDAGPIVVHCSAGVGRTGCFIVIDSMLERLRHEETVDIYGHVTVLRTQRNYMVQTQEQYIFSHDAILEAVSCGNTEVHARNLLHHIKKLTE----LGKGEVTGLEEEFKVVDPSQAKKHKYGAATLAINRPKNRLANILPYETTRVHISPVRGVEGSDYINASFIDGYRQRGLFIATQGPLQDTVDDFWRMLMEQNSNIIVMLTQLHEGEWEKCYKYWPTDRSARHQYYIVDPIAEHEYPQFVIRDFKVKDARSDTVRNIKQFHFLGWPETGVP-KSGEGIIDLIGQVQRAYEQQEEEGPITVHCSDGVGRTGVFTALFIVLERMRSEGVVDLFQTVKLLRTQRPAMVQSQEQYLFCYKTALEYLGSFDHY 1872          

HSP 2 Score: 260.766 bits (665), Expect = 1.016e-69
Identity = 273/1065 (25.63%), Postives = 452/1065 (42.44%), Query Frame = 2
Query:  221 ITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQVVGTG-SLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEK-ESPMTPQ--IVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKY---RLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVG-VSAQLTETTKDENILNEISNLKIWGTNISKDSAT--ICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPD-KPEAVSIKVINSTSSKISWKGPMKTLD-QVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAIS-----LIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFG-ETARINYTIPEERPSAPPNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDM-KEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWS 3355
            +T  P D       F+++IC   G+P PT+ +  NG V  N   R  I +  +G  +R   ++   +    +C A+N +G   + ++  ++ + +  PAGFP I   P     + G      C     P+  +TW K+    V  N+ R  V+  G  L I ++RE+D G Y C+A N +G V S   M   R  +   L  ++ K E  + PQ   VD  + +E        L C+A GSP P + WEV     +  N E             + +  I  SG+Y C A + MG ++  A + V+  P AP+  + + + + +  I W P +    + SY +  +     +               Q++++     S  ++ L+ +++YE +V AV N++G S PSL   + T E  P S P ++ A  +S  S K  W PP+  NGRI+GYRLYY+  L   I  W           +  L    T++ ++ AYN+AGDGP+S+   +    G          VP  P++++ + LS+T+I++ W+ P    D  + GY++ Y   + D D     F+ + +       I  L P   Y +++A K+  GVG +S  LT  T ++   +   N++      S+DS T  I W     E      HR   +  F I         A  L  D      VL +L   + Y +WV+      D           S K  +ST ++  VP+  P  V I+V NST+  + W  P    D ++  Y++ +  + ++    +        +  +  N   H L  L P   Y+IEV A + KG G+     + KT      P           V +    G     V LAW   + S   ++ Y+V  +     L G  +   ++K +K   + + + ++S     +  G  YLF V       +  ET+R     P      P N   +     +V + W  P I  R G I  Y + Y    K   +T+K   + +    ++  L++   Y  ++RA+   G GP S
Sbjct:    3 VTLTPKDFAGVTRGFVYMICNVTGSPMPTLTWYKNGSVIRNS--RIQIFTMPYGGLIRIGPLRAKIHKATYECEADNGVGPPLRDSSTLIVHTASTKPAGFPRIAKHPSFKQRRSGDDVTFTCAAVGTPTPNITWFKDRLPIV-LNDPRVSVLSDGRKLRITDLRESDNGKYSCVARNALGMVFSSQAM-PARLFIYLTLSVVRSKPEFTLRPQDKTVDPDTDVE--------LKCSARGSPTPSIVWEVDGSRISGQNGE-------------LIIRGIQRSGNYSCIADSNMGRVQAYAYVTVRLLPFAPSRPNAASITSDAIKITWHP-RGAHVVTSYEVQYRLKGKTEW--------------QEITNVRGMQSLVVSGLRPFSSYEFRVFAV-NSLGRSRPSLMAEYTTSETKPGSAPRNIEAMGVSDTSFKAGWLPPISANGRIRGYRLYYSLDLLEDISQWRFMASSTNSTTVTGLTRQTTHFFRILAYNIAGDGPLSEVVAVKTQKG----------VPGQPRSVQLSVLSSTAIRVTWSPPRYPGD-GIFGYDVYYNKSKQDMDTVIGAFQMNTKE------IMGLTPYTVYKVAVAAKSDKGVGPMSFVLTARTDEDRPSDAPQNIQ----GRSRDSTTLEISWDPPRPE------HRNGLITHFTIKYRAKGQRGAKYLTVDATKTSVVLHNLDKFTNYFIWVQASTKQGDGPF--------SDKHTVSTAED--VPNGAPRDVRIRVHNSTTMTVKWNPPTTKQDGKILGYMVFYTRVDDQGNQLRPPAQPESKDSMSEENHKVH-LTGLAPETTYQIEVAAYTIKGDGARSVTRLAKTMAQSPDPPF---------VYLERASGDPISDVTLAW---RTSATGVIEYKVRYAKSVRRLRGRDQGNLKMKEIKFKSHTTKQKFQS-----LANGIWYLFNVSLRTKAGWSPETSRWIEIPPGPPSGPPLNVRAVAVSSTSVEVTWSAPDIWNRGGPILGYSVMYNPANKRGDVTVKNVTSPNIFKVVLKRLKKFREYEVRVRAIGMLGMGPAS 971          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Nematostella
Match: EDO43854 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXI9])

HSP 1 Score: 607.831 bits (1566), Expect = 0.000e+0
Identity = 294/590 (49.83%), Postives = 402/590 (68.14%), Query Frame = 2
Query: 4964 IPVHRLESQINELRANDNFLFSQEYESIDPGQQ-FTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            IPV      +  +  + +  FS+EYE + P  + FTW +S    N+ KNRYAN++AYDHSR+LL  + GVL SDYINANYIDGY R  A+IA+QGPL  TF DFWRMVWEQG+A IVM+T+LEER R KCDQYWP++GT +Y  GA+ VT  +T  ++YY +RTF++S             ++ R++RQY +T+WPDHGVP +P PLL  ++ + + NP ++ P+IVHCSAGVGRTG FI +D+ L+R   E T+D+FG V  MR +RN MVQTE QYVF+H+ +++AV    TEV    +++ +++L   D   GT   T ++LEF++L++ + +  +  SA L  N  KNR  NILPYE  R+ L    G  GSDYINAS+IDG   +KAYIATQAP+  T EDFWRM+WE  S +IVMLT+  E G+ KCHRYWP++ S  +   +V+   E    ++VL++F +T   +  SR VRQFQ T+WP+ G+P ++    I+ IGQV K ++Q G    ITVHCS GVGRTGVF A+SI +ER+K EG++D+FQ V+ LR QR  MVQ+++QY FCY   Q+Y+ SFD +
Sbjct:    2 IPVEAFAMHVRRMHMDGDIGFSEEYEMVQPNDETFTWHHSLHPANKYKNRYANIVAYDHSRVLLTPLEGVLESDYINANYIDGYNRSGAFIASQGPLPETFDDFWRMVWEQGSAIIVMLTQLEERGRRKCDQYWPDRGTRNY--GALRVTANETFHMSYYVLRTFLVS--------HMQEEEEPRQVRQYHYTSWPDHGVPAHPAPLLSMVRTVSSANPPTAGPMIVHCSAGVGRTGTFITLDSMLQRAAQEGTIDVFGFVRQMRNKRNLMVQTESQYVFIHDALVEAVICGVTEVDANKLASRIRELREVDPNIGT---TYMDLEFERLTRDERHPTQFKSAMLSCNAAKNRYANILPYERTRVALHMRPGEVGSDYINASFIDGNHRLKAYIATQAPVPRTFEDFWRMLWEQESAVIVMLTREEEAGKLKCHRYWPSDGSRLYDKILVELTEELTYSDYVLRQFSLTHTEEKSSRIVRQFQCTDWPDSGLP-ESGVGLIDLIGQVEKWQQQSGNTC-ITVHCSGGVGRTGVFCAVSILIERVKAEGLIDVFQTVQHLRLQRPAMVQTKDQYEFCYTTIQEYLESFDLY 576          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Nematostella
Match: EDO45382 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT25])

HSP 1 Score: 564.303 bits (1453), Expect = 0.000e+0
Identity = 282/590 (47.80%), Postives = 391/590 (66.27%), Query Frame = 2
Query: 4964 IPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSR-PIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            +PV   E  +  L AN   LFSQEY +       T  +S  + NR KNRY N+ A+DH R+LLQ I G   SDYINANY+DGY++   YIA QGPL  T  DFWRMVWEQ +  IVM+T  EER RIKC QYWP+ G+++Y  G I V +  T EL+ YTIR+F +  + S          ++R + QY +TAWPDHGVP++   +L F+++  A N      P++VHCSAGVGRTG ++VID  L+RI+ E TVD++  V ++R QRN MVQ EDQYV +H+V+L+A+   +TE+  +++   +++LMR    TG    T ++ EFQ+LS+ K   ++  SANLPVN+ KNR  N+LPY+  R+ L      EGSDYINA+YIDGY + KA+IATQAP+ +TI DFWRMIWE +   IVML++  E G+ K HRYWP ++ +     VV+ + +    +++++EFKVT+ ++  SR VRQ+QFT WP+ G P  +    I+ IGQV + +++ G +    VHCSAGVGRTGVF A+SI +ERLK E ++D+FQ V+ LR QR  MVQ++EQY FCY    +Y++SFD +
Sbjct:    1 MPVDEFEEHVRRLHANGELLFSQEYGAFRSPDTVTSHHSLNQANRFKNRYNNITAFDHCRVLLQPIEGDPTSDYINANYLDGYRKQREYIAAQGPLPETCHDFWRMVWEQNSRVIVMVTNCEERGRIKCHQYWPSSGSQNY--GVIHVNMMSTVELSDYTIRSFGVKRSGSP---------EERMVLQYHYTAWPDHGVPNSVTSVLNFVRKSSAVNLTEDYGPMVVHCSAGVGRTGTYVVIDAQLKRIQAEATVDVYNYVMMLRGQRNLMVQVEDQYVLIHDVLLEAIACGDTEIQARDLRQRIKELMRPSTDTG---QTEMDAEFQRLSRNKAPPSKFQSANLPVNKHKNRYANVLPYDDTRVRLTMQAVTEGSDYINANYIDGYMSKKAFIATQAPIPDTIPDFWRMIWEQDCCTIVMLSQEMESGKVKVHRYWPGKQPTSIGNLVVEMLHDKQFDDYIMREFKVTNTKESASRVVRQYQFTAWPDIGSP-DSGGGLIDLIGQVQRWQQKCGVQ-LTAVHCSAGVGRTGVFCAVSILIERLKAEAMVDVFQTVKQLREQRPAMVQTKEQYEFCYQTLGEYLHSFDPY 574          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Nematostella
Match: EDO48187 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK45])

HSP 1 Score: 533.872 bits (1374), Expect = 8.855e-170
Identity = 274/590 (46.44%), Postives = 373/590 (63.22%), Query Frame = 2
Query: 4964 IPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEA---FIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFD 6724
            I +   E  +  +R + +  F+ EYE I   +  T  +S   +N+ KNRY N++AYDHSR+ LQ      GSDYINAN++ GY+R NAYIA QGPL+ T  DFWRMVWEQ + +I+M+T L+ER R KC QYWP++G+ SY D  ITVT+    EL  Y +RT        S   E C   D R+++Q+ FT+WPDHGVP +   LL F++     +P  + P++VHCSAGVGRTG FIVID  L++I  E TVDI G VS +R  RN MVQTE QY+F+H+ +LDA+ +  TE S  ++ +H+++L   D  +G    T +  EFQKLS+   ++    +A  PVN+ KNR  N+LPY+  R+ L    G EGSDYINA+YIDGY   + +IATQAP+ ETI DFWRM+WE N   IV L +  E  + K HRYWP ++   F   VV+   +    + V++ FK+T+     SR VRQF +T W E+  P +   +    I+ IGQV   + + G+  PI VHCSAGVGRTGVF A+SI +ERLK E ++D+FQ V+ LR QR  MVQ++ QY FCY    +Y+ SF+
Sbjct:    1 ISIDDFEQHVARMRRSGDLFFTTEYERIPVPEHVTATHSLDPVNQHKNRYINIVAYDHSRVKLQDFEDEPGSDYINANFLPGYRRDNAYIAAQGPLAETCRDFWRMVWEQNSRTIIMLTNLKERCRDKCAQYWPSRGSLSYED--ITVTLDSVTELTPYIVRTL-------SVQREGCD--DVRQVKQFHFTSWPDHGVPTSVCNLLAFVRDSTRADPPGAGPMVVHCSAGVGRTGTFIVIDVMLQQIHEEKTVDILGFVSTLRRHRNLMVQTEQQYIFIHDALLDAIISGETETSASDLRSHIRRLQEQDPESG---YTPMFTEFQKLSRCINSSLSLNAATHPVNKRKNRYANVLPYDVTRVRLSMQVGVEGSDYINANYIDGYMAKRTFIATQAPIPETIPDFWRMVWEQNCCTIVTLAQEVEQAKAKMHRYWPGKQPITFGSLVVEMQDKVKSGHLVVRIFKLTNTEVSASRDVRQFHYTSWTEEN-PLEDGLSRCQLIDLIGQVQYWQAESGRH-PIIVHCSAGVGRTGVFCAVSILIERLKAEAMVDVFQTVKQLREQRPAMVQTKGQYDFCYQVVLEYLASFE 574          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Nematostella
Match: EDO45081 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTS6])

HSP 1 Score: 491.5 bits (1264), Expect = 5.828e-154
Identity = 264/636 (41.51%), Postives = 372/636 (58.49%), Query Frame = 2
Query: 4961 PIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAY--------------DHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERS-----SRFQYFVVDP-----------------------MVEYN----MPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            PIPV++L        +  N  F +E+  I     F+W++S  E N+ KNRY N++A               DH+R+ +  ++G+ GSDYINAN+IDGY   N +IATQGP+SNTF DFWRMVWE G + IVM+T + ER ++KC +YWP+   E Y  G + VT  + +EL++Y IR F I    S   S        REI QY +TAWPDHGVP +   LL F++RIR      + PI+VHCSAGVGRTG +IV+D  L+++  E  VDIFG VS  R QRN MVQTE QY+F+H+ +++A +  NTE  +Q++   ++ L   D  +G    T I  EF+ L     +     SA++P N+ KNR + +LPY+  R+ L P  G  GSDYINAS+ID YQ  +A++ATQAPL  TI DFWRM+WE+ S  +VML K  E  + +  +  P +        RF + ++ P                       MVE         ++ ++ K+++ +  + R V  FQ+ +WPE GVP Q  +  I+ +  + + ++Q G  GPITVHCS G GRTG F A+SIALER+K +  +D+FQ VR LR QR  MVQ+ EQY+FCY   + +V +F  +
Sbjct:    1 PIPVNKLAEYCQIHHSTGNKSFKEEFMCIRTPGNFSWDHSLKEENKPKNRYQNIVACKLFRLTNPCVNSVDDHTRVAISELDGIPGSDYINANFIDGYNHRNKFIATQGPVSNTFDDFWRMVWEHGCSCIVMVTNIVERGKLKCQKYWPSANPEEY--GRLVVTPLEEEELSHYVIRKFCIEIANSDVESP------AREIVQYHYTAWPDHGVPTHATSLLAFIRRIRNSVSRDAGPIVVHCSAGVGRTGTYIVLDAMLDQMSKEGAVDIFGFVSHTRLQRNMMVQTEAQYIFIHDALMEAAKCGNTEFKVQDLHDRIKALQSRDPDSG---ETYIAKEFKNLDIGDSDVETFDSASMPENKSKNRFL-VLPYDRTRVKLWPYPGVLGSDYINASFIDSYQQREAFLATQAPLETTINDFWRMLWEYESYTVVMLNKDSENIKVRLKQT-PGKTEIIIVQQRFFFLLISPKHVLYQGQSYLPDKGEFVVYGLLMVEVESEERQEGYIKRQLKISNTKSSEVRNVFHFQYEDWPEDGVP-QDGKLVIDMLKHIARAQQQTGN-GPITVHCSDGSGRTGTFCAISIALERVKLDATIDMFQTVRNLRTQRPIMVQTPEQYKFCYEVVRHFVEAFSDY 621          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Medaka
Match: ptprsa (receptor-type tyrosine-protein phosphatase S [Source:NCBI gene;Acc:101169564])

HSP 1 Score: 904.82 bits (2337), Expect = 0.000e+0
Identity = 529/1274 (41.52%), Postives = 735/1274 (57.69%), Query Frame = 2
Query: 2999 PGKTYLFEVQALNSVNFGE-TARINYTIPEERPSAPPNKLEIQG-EKKTVTLKWHPPPIDYRNGIITKYKIQY-FDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVT--DLLSQVNGFHVQVSTNRDFPDGKITFKKIVGPFTSTVMEKIYPNHYFIRVQAIIRDKRIAEWSNIHTLTVFKSKYTERNIK---GLNCIGQTNSIKVTWEKPDDYTEIKSFLIELSGYRKFRNIYGAYKIEKIKARTSRIEFFGEEQSTYNYSIPNLEPNTNYDXXXXXXXXXXXXXXXXXXXXXCVTLMEQPKSILSPMPVPLRKVSNEIILRLSRTNEILGMISHYYLIVSPIKET-----HV-TPHDVNIDETF---------TQTKNLKAMNSRYVAAQFTPA----LFRSKSYVDFVLGSNSPIESFHSNDWIFLKRLPVKKKTNLKAFLRACVIPEGLTSDLKSIPVERCTSSEWSMTFSTDINREIQVFTAA--VIAGIGSIVFLVFI-CIGFACFLKRSHSKISRPLGSTDPCLKQPLMMQPGLSGGNLPQYTNIVNIGNSSRHGYTDSLRTNSDLCATSGVMTPINNHQPLSVSNPMFEQRSLELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            P   Y   V A NS+  G  + R+     E+ P++PP  ++     + +V ++W  P  +  NG +  Y++ Y  D   P+   +    +      I NL  +  Y+ ++ A    GDGP+S      +       P       + D  I+++W+ P    ++   +LL +   F             K+TF     P T+  +E +  N  +    A I  K I  +S  H +     + T+ N+     +N    T S+ +TWE P+                 +R IY   K+E + AR  +              IPNL+P+T+YD  I     ++              L  +  +  SP P+ +R+   +   R + T   + + S+ Y++V P++       H+ +P ++++++           ++ +    +   Y+ A+FTPA     F     +D+    N  ++     +++F     +   T ++                     +   SS  S    T  + + Q F A   +I  +G ++ +VFI CI  A  L ++  K S                +PG                       T SL +N+++ A          H P   ++P      + +++I N Q P ++ +         PPIP+  L   I  L+ANDN   SQEYESIDPGQQFTWE+SNLE+N+ KNRYANVIAYDH+R++L  I G+LGSDYINAN+IDGY++ NAYIATQGPLS TFGDFWRMVWEQ TAS+VMMT+LEE++RIKCDQYWP++GTE+Y  G I VT+ DT ELA + +RTF +  N          N ++RE+RQ+QFTAWPDHGVP+ P P L FL+R++A NP  + PII HCSAGVGRTG FIVID  LERIR E TVDI+G V++MR+QRNYMVQTEDQY F+HE +L+AV    TEV+ +++ +++QKL + +     +   G+ELEF++L+  K + +R  +ANLP N+ KNRLVNI+PYE  R+CLQPIRG EGSDYINASYIDGY+  + YIATQ PL ET EDFWRM+WEHNSTI+VMLTKLREMGREKCH+YWP ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRTVRQFQFT+WPEQGVP ++ E FI+FIGQVHKTKEQFGQ+GPITVHCSAGVGRTGVF+ LSI LER++ EG +D+FQ V+ LR QR  MVQ+E++Y+FCY AA +Y+ SFD +
Sbjct:  366 PNTEYEIRVSAFNSIGQGPPSTRVEARTGEQAPASPPQSVQAHVISENSVFIRWEEP--EEPNGQVKGYRVYYTMDPSRPINEWQIQNVQDSLITTIQNLVASETYIVQVLAFTSVGDGPFSIPIKVKVLHGVPGQPGKFRAGKVTDTSIELTWDPPFTKEKIINYELLYKPVKFGSL---------EKLTFT----PRTTYTVEGLKANTEYSFSLAAISSKGIGAFS--HEMV---QRTTQANVPRNFSVNLATMT-SVLLTWEFPETSN-------------PYRFIYNRQKME-VDARLKKA------------VIPNLQPDTSYDFKITSTEGNMGG------------LRHRITAKTSP-PITIRRPEIDHT-RDTETTITIILPSNVYVVVVPLRRARGVIKHLKSPDEMDLEDLLKDISQRQRDSRQQKQVDLKRAYITARFTPATLPAFFTLGDQLDYGGFQNQALDP--GQEYVFFILAELNSTTGVR---------------------KPTCSSFISFHQVTAPHSDPQPFDAGDGLIWVVGPVLAVVFIICIVIAILLYKNKRKDS----------------EPG-----------------------TKSLLSNAEMMA----------HHP---TDP------VAMRRI-NFQTPGMMSH---------PPIPIGELAEHIELLKANDNLRLSQEYESIDPGQQFTWEHSNLEVNKTKNRYANVIAYDHTRVILSPIEGILGSDYINANFIDGYRKQNAYIATQGPLSETFGDFWRMVWEQRTASVVMMTRLEEKSRIKCDQYWPSRGTETY--GMIQVTLLDTMELATFCVRTFSLHKN---------GNSERREVRQFQFTAWPDHGVPEYPTPFLNFLRRVKACNPPDAGPIIAHCSAGVGRTGCFIVIDAMLERIRQERTVDIYGHVTLMRSQRNYMVQTEDQYSFIHEALLEAVACGITEVAARSLYSYMQKLSKVE---PGEHVPGMELEFKRLANTKAHTSRFVTANLPCNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINASYIDGYRQQRGYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGAVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFDHY 1472          

HSP 2 Score: 247.669 bits (631), Expect = 1.589e-65
Identity = 204/712 (28.65%), Postives = 325/712 (45.65%), Query Frame = 2
Query:  209 SPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGAS--LR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNE-RFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPY-YLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGV-SAQLTETTKDENILNEIS-NLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDL 2323
            +P   T+ P D    +G     +C+A GNPKP V +   GK    +S R     FD GA   LR Q ++   + +V +C+A N  G  + ++ ++++  +  + AGFP I  GP   + +  K A + C  S +P  +++W K+      S ++ R + + +G+L I+N  ETD G YEC+ATN  G   S    L           Y++ +  P  P+     S  E+  G   N+TC A GSP+P V W   +GN +    +  P+G      + + L  + ES +Y C A + +G+++  AQ++VK  P  P     ++  ATS  I W     NP  D  +  I     K P      + ++               + I  L   T YE++V A  N+IG   PS  +  +T E  P+SPP  + A  IS +S+ + W+ P + NG++KGYR+YYT      I+ W I+ VQD+    + NL+ + TY V+V A+   GDGP S    + V+ G          VP  P   R   ++ TSI++ W  P      K+  YEL Y+    + G + K    P +T Y ++ LK    Y  SLA  +  G+G  S ++ + T   N+    S NL       +  S  + W+      + +  +R  Y              N   +  D +    V+ +L+PD+ YD 
Sbjct:   16 APPRFTKIPTDQIGVSGGVASFVCQAVGNPKPVVYWNKKGK--KVNSQRIETIEFDEGAGAVLRIQPLRAPRDENVYECVARNSEGEVSVTSKLSIMREDT-LEAGFPSIDMGPQLKVVERTKTATMLCAASGNPDPEISWFKDFLPVDPSTSQGRIKQLRSGALQIENSDETDQGKYECVATNSKGVRYSSPANL-----------YVRVRRVP--PRFSILPSNHEIMPGGSVNITCVAVGSPMPYVKW--MLGNEDLTPEDEMPIG-----RNVLELNGVRESANYTCVAMSSLGILEATAQVLVKTLPKPPGTPIVTETTATSITITW--DSGNP--DPVSYYIIQYRAKGPDSKYETVDSI-----------TTTRYSIGGLYPNTEYEIRVSAF-NSIGQGPPSTRVEARTGEQAPASPPQSVQAHVISENSVFIRWEEPEEPNGQVKGYRVYYTMDPSRPINEWQIQNVQDSLITTIQNLVASETYIVQVLAFTSVGDGPFSIPIKVKVLHG----------VPGQPGKFRAGKVTDTSIELTWDPP--FTKEKIINYELLYK--PVKFGSLEKLTFTP-RTTYTVEGLKANTEYSFSLAAISSKGIGAFSHEMVQRTTQANVPRNFSVNLA------TMTSVLLTWEF----PETSNPYRFIY--------------NRQKMEVDARLKKAVIPNLQPDTSYDF 649          

HSP 3 Score: 77.0258 bits (188), Expect = 2.860e-13
Identity = 112/481 (23.28%), Postives = 194/481 (40.33%), Query Frame = 2
Query:  509 PAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQVV----GTGS-LTIKNVRE-TDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIE-VSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGL-IKKEAQIIVKKKPMAPTL----VSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKP--PLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLD 1909
            P   P  T  P D +   G +A   C+   +P   V W K   +KV  N++R + +    G G+ L I+ +R   D   YEC+A N  G V           ++TS L  M+E         +D   +++ V   + A + C A G+P P + W  +   P  P+     +   +  +  I  +D T+ G Y C A N  G+     A + V+ + + P       ++  +   S  I  + V S  P   + L  +D + +D     R +                   ++  ++   NY    VA+S ++G  + +  +  +TL  PP +P         +  SI +TW    P   +  I  YR    +  +  +D+     +  T Y +  L  N  Y ++V+A+N  G GP S        V     +  P S    PQ+++   +S  S+ I W  P    + +++GY + Y +D
Sbjct:   14 PMAPPRFTKIPTDQIGVSGGVASFVCQAVGNPKPVVYWNKKG-KKV--NSQRIETIEFDEGAGAVLRIQPLRAPRDENVYECVARNSEGEV-----------SVTSKLSIMREDTLEAGFPSIDMGPQLKVVERTKTATMLCAASGNPDPEISW-FKDFLPVDPSTSQGRIKQLRSGALQIENSDETDQGKYECVATNSKGVRYSSPANLYVRVRRVPPRFSILPSNHEIMPGGSVNITCVAVGSPMPYVKWMLGNEDLTPEDEMPIGRNV------------------LELNGVRESANY--TCVAMS-SLGILEATAQVLVKTLPKPPGTP----IVTETTATSITITWDSGNPDPVSYYIIQYRAKGPDSKYETVDS-----ITTTRYSIGGLYPNTEYEIRVSAFNSIGQGPPSTR------VEARTGEQAPAS---PPQSVQAHVISENSVFIRWEEPEE-PNGQVKGYRVYYTMD 439          

HSP 4 Score: 59.6918 bits (143), Expect = 5.071e-8
Identity = 80/351 (22.79%), Postives = 141/351 (40.17%), Query Frame = 2
Query: 2423 SVPDKPEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGE-TARINYTIPEERPSAPPNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKAN 3472
            ++P  P    +    +TS  I+W       D V YYII++R     SK   V ++T             + +  L PN  Y+I V A +  G+G P     ++     + P+ P      QSV+          +V++ W  P+  +G + GYRV  ++  P   + E +   +  ++ T          +   +TY+ +V A  SV  G  +  I   +    P  P      +    ++ L W PP   +    I  Y++ Y  +K    +L++     +TT  +  L+ NT Y F + A++ +G G +S       +      P N          + ++W FPE +N
Sbjct:  302 TLPKPPGTPIVTETTATSITITWDS--GNPDPVSYYIIQYRAKGPDSKYETVDSITTT----------RYSIGGLYPNTEYEIRVSAFNSIGQGPPSTR--VEARTGEQAPASP-----PQSVQAHVI---SENSVFIRWEEPEEPNGQVKGYRVYYTM-DPSRPINEWQIQNVQDSLITTI------QNLVASETYIVQVLAFTSVGDGPFSIPIKVKVLHGVPGQPGKFRAGKVTDTSIELTWDPP---FTKEKIINYELLYKPVK--FGSLEKLTFTPRTTYTVEGLKANTEYSFSLAAISSKGIGAFSHEMVQRTTQA--NVPRNFSVNLATMTSVLLTWEFPETSN 616          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Medaka
Match: PTPRD (receptor-type tyrosine-protein phosphatase delta [Source:NCBI gene;Acc:101165843])

HSP 1 Score: 885.56 bits (2287), Expect = 0.000e+0
Identity = 405/617 (65.64%), Postives = 496/617 (80.39%), Query Frame = 2
Query: 4880 LELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            +EL+++ N Q P +  +         PPIP+  L   +  L+ANDN  FSQEYESIDP QQFTWE+SNLE+N+ KNRYANVIAYDHSRILL  I+G+ GSDYINANYIDGY++ NAYIATQGPL  TFG+FWRM+WEQ +A +VMMTKLEER+R+KCDQYWP +GTE+Y  G I V++ DT ELA Y +RTF +  N SS         +KRE+RQ+QFTAWPDHGVP++P P L FL+R++A NP  + P++VHCSAGVGRTG FIVID  LER +HE TVDI+G V++MRAQRNYMVQTEDQYVF+H+ +L+AV    TEV  +N+  ++QKL + +   G +  TG+ELEF++L+  K + +R  SANLP N+ KNRLVNI+PYE  R+CLQPIRG EGSDYINAS+IDGY+  KAYIATQ PL ET EDFWRM+WEHNSTI+VMLTKLREMGREKCH+YWP ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRTVRQFQFT+WPEQGVP ++ E FI+FIGQVHKTKEQFGQ+GPI+VHCSAGVGRTGVF+ LSI LER++ EGV+D+FQ V+ LR QR  MVQ+E+QY+FCY A  +Y+ SFD +
Sbjct: 1328 VELRRL-NFQTPGMANH---------PPIPISELADHLERLKANDNLKFSQEYESIDPAQQFTWEHSNLEVNKPKNRYANVIAYDHSRILLSAIDGIPGSDYINANYIDGYRKQNAYIATQGPLPETFGEFWRMIWEQRSAVVVMMTKLEERSRVKCDQYWPTRGTETY--GLIQVSLLDTVELATYCVRTFSLFKNGSS---------EKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERNKHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLEAVNCGTTEVPARNLYAYIQKLTQIE---GGENVTGMELEFKRLANTKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAGLEYLGSFDHY 1919          

HSP 2 Score: 361.688 bits (927), Expect = 2.435e-100
Identity = 309/1145 (26.99%), Postives = 517/1145 (45.15%), Query Frame = 2
Query:  203 GQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHE-KVDSNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNP-PIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYY-LNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMV-DDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVG-----VSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLD--QVKYYIIEWRELSNKSKNSK--VFNVTVDINKSNPNNVYEH--ILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGE-KKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYY---ISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDLLSQVN-GFHVQVSTNRDFPDGKITFKKIVG 3574
             Q+P      P D T   G     IC+A G+P+P + +   GK  SN     I      G+ LR Q ++   +  + +C+A N +G  + S  +TV+  + ++P GFP I  GP   + +  + A + C  S +P   ++W K+       +NN R + + +G+L I+   E+D G YEC+ATN  GT  S    L           Y++ +  P  P+     +  E+  G   N+TC A GSP+P V W   +G  +    ++ P+G      + + LTD+ +S +Y C A + +G+I+  AQI VK  P AP +   ++  ATS  + W     NP P+  Y +  K   + D +  +  +A                 + +  L  Y++YE +VVAV NNIG   PS  I  +T E  PS+ P  +    +S  +  + W  P + NG+I GYR+YYT      ++ W  + V+ + +  ++ LI N TY +KV AY   GDGP+S    I+   G          VP  P + +G + S TS+ + W  P+    ++++ GYEL YR   D++ K      EP  T YL+ +LKP   Y   LA ++K GVG     +SA+  +T +      E+       T I      + W+    E +  +  +  Y + +  +E + T+    + I   +   ++L +L   + Y + V    +TD       L  L  +       + D     P  V ++ +NS+S K+ W+ P+ T    Q++ Y + +  + N     +  + ++ +D  +    +  EH  I+  L+    Y + V A + KG G+  K ++I T G   VP  PR +  T ++              L W+PP ++HG + GYR+           K++ P+ +      + + +  E  I  G +Y F + A N V FGE      T  E+ PS  P  ++ +G    T+ + W P  +  RNG I KY +QY D+  P    +   T  ++T ++  L+ +T Y  K+ A   +G GP+SP   +    +    F   +N   +A     + ++W  P+  N         + G  V+V       DG++T K I G
Sbjct:   36 AQTPPKFLRTPNDQTGVQGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNTVGEISASTRLTVLRED-QLPPGFPTIDMGPQLKVVERTRTATMLCAASGNPDPDISWFKDFLPVNTSNNNGRIKQLRSGALQIEQSEESDQGKYECVATNNDGTRYSAPANL-----------YVRVRRVP--PRFSIPPTDNEIMPGGSVNITCVAVGSPMPYVKW--MLGAEDLTPEDDMPIG-----RNVLELTDVQQSANYTCVAMSTLGVIEAVAQITVKALPKAPGIPVVTERTATSITLTW--DSGNPEPVTYYIIQHKSKYSDDLYKEINGVAT--------------TRYSVGGLSPYSDYEFRVVAV-NNIGRGPPSESIEAKTAEQAPSTAPRHVRGHMMSATTAVIQWDEPEEANGQIMGYRVYYTMDPTQHVNIWEKQIVRGSNFVTIHGLIPNKTYNIKVLAYTSVGDGPLSPDLQIIAKTG----------VPSQPTDFKGEAKSETSVLLSWNTPSQTGQENQVTGYELIYRKRDDKEEKQIS--FEP-TTTYLLKDLKPFTTYTFRLAARSKHGVGAYTSEISAETPQTPEPAGPPEEVKCSSPSSTKI-----LVSWRAPPVELRNGIITQ--YTVSYAPTEGEDTAARQISNIP-PESSQYLLENLEKWTEYRVTV--TAHTDVGAGPESLPHLIRT-------EEDVPSGPPRKVEVEAVNSSSIKVIWRSPVPTKQHGQIRGYQVHYVRMVNGEPTGQPVIKDILIDDAQWEFEDSTEHEMIITGLMAETTYSVTVAAYTTKGDGARSKPKLITTTG--AVPEKPRLMVSTTNMG----------TALLQWHPPAVTHGPLQGYRLRFGR-------KDVDPLTVIEFQERDNHYTTSE--IHKGASYTFRLSARNKVGFGEETVKEITTNEDVPSGYPQNIKAEGATTSTIQVSWQPVLLAERNGKIVKYALQYKDINSPRSPSELFITAPESTVVLDGLRPDTTYDIKMCAFTSKGSGPYSPSVQFRTQPVDQAVF--AKNFHVRAAMKSSVLLTWEIPDTYNPAQPFTILYDKGQSVEV-------DGRLTQKLITG 1082          

HSP 3 Score: 119.013 bits (297), Expect = 5.380e-26
Identity = 245/1146 (21.38%), Postives = 449/1146 (39.18%), Query Frame = 2
Query:  494 SNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQVV----GTGS-LTIKNVRE-TDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEV-STGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGL-IKKEAQIIVKKKPMAPTL----VSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKP--PLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRIS-YMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVS----IKVINSTSSKI--SWKGPMKTLDQ--VKYYIIEWRELSNKSKNSK-VFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVA-ISLI-GPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPG----KTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPA--PENIETKALNDYQIKVSWN---FPEKANQVTDLLSQVNGFHVQVSTNRDFPDGKITFKKIVGPFTSTVMEKIYPNH-YFIRVQAIIRDKRIAEWSNIHTLTV-FKSKYTERNIKGLNC---IGQTNSIKVTWEKPDDYTEIKSFLI 3811
            ++A+ P   P     P D     G +A   C+ + DP  K+ W K   +KV  +N+RF+V+    G+GS L I+ +R   D   YEC+A+N VG +           + ++ L  ++E + P     +D   +++V    + A + C A G+P P + W       N+ N   R +   +  +  I  ++ ++ G Y C A N  G      A + V+ + + P           +   S  I  + V S  P   + L  +D + +D     R +                   ++T+++   NY    VA+S  +G  +    I  + L   P  P         +  SI +TW    P      I  ++  Y++ L+  I+      V  T Y +  L   + Y  +V A N  G GP S++            KT   +    P+++RG  +S T+  I W  P   +  ++ GY + Y +D  +   ++++ I        I  L P K Y+I +   T  G G  +   +      + ++ ++ K  G   S+ S  + W      S+    ++++ Y LI+   + K   +     I+      ++L  L+P + Y                +  +       + S +  ++ P  PE       +K  + +S+KI  SW+ P   L    +  Y + +     +   ++ + N+        P    +++L NL     Y++ V A +  G G      +I+T  +  VPS P      ++V   S K   R  V      P   HG I GY+V  + ++ G P     +K + I  +   E   S E   I  G     TY   V A  +   G  ++             P  +       T  L+WHPP + +  G +  Y+++ F  K+          E       + + +  +Y F++ A NK G G  +       ++E  P+  P+NI+ +      I+VSW      E+  ++     Q    +   S +  F         I  P ++ V++ + P+  Y I++ A       ++ S  ++ +V F+++  ++ +   N        +S+ +TWE PD Y   + F I
Sbjct:   34 ADAQTP---PKFLRTPNDQTGVQGGVASFICQATGDPRPKIVWNKKG-KKV--SNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNTVGEI-----------SASTRLTVLREDQLPPGFPTIDMGPQLKVVERTRTATMLCAASGNPDPDISWFKDFLPVNTSNNNGR-IKQLRSGALQIEQSEESDQGKYECVATNNDGTRYSAPANLYVRVRRVPPRFSIPPTDNEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPEDDMPIGRNV------------------LELTDVQQSANY--TCVAMST-LGVIEAVAQITVKALPKAPGIP----VVTERTATSITLTWDSGNPEPVTYYIIQHKSKYSDDLYKEING-----VATTRYSVGGLSPYSDYEFRVVAVNNIGRGPPSESIE---------AKTAEQAPSTAPRHVRGHMMSATTAVIQWDEPEEANG-QIMGYRVYYTMDPTQHVNIWEKQIVRGSNFVTIHGLIPNKTYNIKVLAYTSVGDGPLSPDLQIIAKTGVPSQPTDFK--GEAKSETSVLLSWNT---PSQTGQENQVTGYELIYRKRDDKEEKQ-----ISFEPTTTYLLKDLKPFTTY-------------TFRLAARSKHGVGAYTSEISAET-PQTPEPAGPPEEVKCSSPSSTKILVSWRAPPVELRNGIITQYTVSYAPTEGEDTAARQISNI--------PPESSQYLLENLEKWTEYRVTVTAHTDVGAGPESLPHLIRTEED--VPSGPPRKVEVEAVNSSSIKVIWRSPV------PTKQHGQIRGYQVHYVRMVNGEPTGQPVIKDILI-DDAQWEFEDSTEHEMIITGLMAETTYSVTVAAYTTKGDGARSKPKLITTTGAVPEKPRLMVSTTNMGTALLQWHPPAVTH--GPLQGYRLR-FGRKDVDPLTVIEFQERDNHYTTSEIHKGASYTFRLSARNKVGFGEET--VKEITTNEDVPSGYPQNIKAEGATTSTIQVSWQPVLLAERNGKIVKYALQYKDINSPRSPSELF---------ITAPESTVVLDGLRPDTTYDIKMCAFT-----SKGSGPYSPSVQFRTQPVDQAVFAKNFHVRAAMKSSVLLTWEIPDTYNPAQPFTI 1061          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Medaka
Match: PTPRD (receptor-type tyrosine-protein phosphatase delta [Source:NCBI gene;Acc:101165843])

HSP 1 Score: 884.789 bits (2285), Expect = 0.000e+0
Identity = 405/617 (65.64%), Postives = 496/617 (80.39%), Query Frame = 2
Query: 4880 LELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            +EL+++ N Q P +  +         PPIP+  L   +  L+ANDN  FSQEYESIDP QQFTWE+SNLE+N+ KNRYANVIAYDHSRILL  I+G+ GSDYINANYIDGY++ NAYIATQGPL  TFG+FWRM+WEQ +A +VMMTKLEER+R+KCDQYWP +GTE+Y  G I V++ DT ELA Y +RTF +  N SS         +KRE+RQ+QFTAWPDHGVP++P P L FL+R++A NP  + P++VHCSAGVGRTG FIVID  LER +HE TVDI+G V++MRAQRNYMVQTEDQYVF+H+ +L+AV    TEV  +N+  ++QKL + +   G +  TG+ELEF++L+  K + +R  SANLP N+ KNRLVNI+PYE  R+CLQPIRG EGSDYINAS+IDGY+  KAYIATQ PL ET EDFWRM+WEHNSTI+VMLTKLREMGREKCH+YWP ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRTVRQFQFT+WPEQGVP ++ E FI+FIGQVHKTKEQFGQ+GPI+VHCSAGVGRTGVF+ LSI LER++ EGV+D+FQ V+ LR QR  MVQ+E+QY+FCY A  +Y+ SFD +
Sbjct: 1189 VELRRL-NFQTPGMANH---------PPIPISELADHLERLKANDNLKFSQEYESIDPAQQFTWEHSNLEVNKPKNRYANVIAYDHSRILLSAIDGIPGSDYINANYIDGYRKQNAYIATQGPLPETFGEFWRMIWEQRSAVVVMMTKLEERSRVKCDQYWPTRGTETY--GLIQVSLLDTVELATYCVRTFSLFKNGSS---------EKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERNKHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLEAVNCGTTEVPARNLYAYIQKLTQIE---GGENVTGMELEFKRLANTKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAGLEYLGSFDHY 1780          

HSP 2 Score: 261.922 bits (668), Expect = 1.166e-69
Identity = 187/616 (30.36%), Postives = 296/616 (48.05%), Query Frame = 2
Query:  209 SPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHE-KVDSNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNP-PIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYY-LNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMV-DDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGV 2041
            +P      P D T   G     IC+A G+P+P + +   GK  SN     I      G+ LR Q ++   +  + +C+A N +G  + S  +TV+  + ++P GFP I  GP   + +  + A + C  S +P   ++W K+       +NN R + + +G+L I+   E+D G YEC+ATN  GT  S    L           Y++ +  P  P+     +  E+  G   N+TC A GSP+P V W   +G  +    ++ P+G      + + LTD+ +S +Y C A + +G+I+  AQI VK  P AP +   ++  ATS  + W     NP P+  Y +  K   + D +  +  +A                 + +  L  Y++YE +VVAV NNIG   PS  I  +T E  PS+ P  +    +S  +  + W  P + NG+I GYR+YYT      ++ W  + V+ + +  ++ LI N TY +KV AY   GDGP+S    I+   G          VP  P + +G + S TS+ + W  P+    ++++ GYEL YR   D++ K      EP  T YL+ +LKP   Y   LA ++K GVG 
Sbjct:   14 APPKFLRTPNDQTGVQGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNTVGEISASTRLTVLRED-QLPPGFPTIDMGPQLKVVERTRTATMLCAASGNPDPDISWFKDFLPVNTSNNNGRIKQLRSGALQIEQSEESDQGKYECVATNNDGTRYSAPANL-----------YVRVRRVP--PRFSIPPTDNEIMPGGSVNITCVAVGSPMPYVKW--MLGAEDLTPEDDMPIG-----RNVLELTDVQQSANYTCVAMSTLGVIEAVAQITVKALPKAPGIPVVTERTATSITLTW--DSGNPEPVTYYIIQHKSKYSDDLYKEINGVAT--------------TRYSVGGLSPYSDYEFRVVAV-NNIGRGPPSESIEAKTAEQAPSTAPRHVRGHMMSATTAVIQWDEPEEANGQIMGYRVYYTMDPTQHVNIWEKQIVRGSNFVTIHGLIPNKTYNIKVLAYTSVGDGPLSPDLQIIAKTG----------VPSQPTDFKGEAKSETSVLLSWNTPSQTGQENQVTGYELIYRKRDDKEEKQIS--FEP-TTTYLLKDLKPFTTYTFRLAARSKHGVGA 578          

HSP 3 Score: 168.703 bits (426), Expect = 3.357e-41
Identity = 231/1042 (22.17%), Postives = 415/1042 (39.83%), Query Frame = 2
Query:  521 PIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQVV----GTGS-LTIKNVRE-TDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEV-STGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGL-IKKEAQIIVKKKPMAPTL----VSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKP--PLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRIS-YMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKP----EAVSIKVINSTSSKISWKGPMKTLDQ--VKYYIIEWRELSNKSKNSK-VFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGE-KKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDLLSQVN-GFHVQVSTNRDFPDGKITFKKIVG 3574
            P     P D     G +A   C+ + DP  K+ W K   +KV  +N+RF+V+    G+GS L I+ +R   D   YEC+A+N VG +           + ++ L  ++E + P     +D   +++V    + A + C A G+P P + W       N+ N   R +   +  +  I  ++ ++ G Y C A N  G      A + V+ + + P           +   S  I  + V S  P   + L  +D + +D     R +                   ++T+++   NY    VA+S  +G  +    I  + L   P  P         +  SI +TW    P      I  ++  Y++ L+  I+      V  T Y +  L   + Y  +V A N  G GP S++            KT   +    P+++RG  +S T+  I W  P   +  ++ GY + Y +D  +   ++++ I        I  L P K Y+I +   T  G G  +   +      + ++ ++ K  G   S+ S  + W      S+    ++++ Y LI+   + K   +     I+      ++L  L+P + Y                +  +       + S +  ++   +P    E V     +ST   +SW+ P   L    +  Y + +     +   ++ + N+        P    +++L NL     Y++ V A +  G G      +I+T  +  VP  PR +  T ++              L W+PP ++HG + GYR+           K++ P+ +      + + +  E  I  G +Y F + A N V FGE      T  E+ PS  P  ++ +G    T+ + W P  +  RNG I KY +QY D+  P    +   T  ++T ++  L+ +T Y  K+ A   +G GP+SP   +          +N   +A     + ++W  P+  N         + G  V+V       DG++T K I G
Sbjct:   16 PKFLRTPNDQTGVQGGVASFICQATGDPRPKIVWNKKG-KKV--SNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNTVGEI-----------SASTRLTVLREDQLPPGFPTIDMGPQLKVVERTRTATMLCAASGNPDPDISWFKDFLPVNTSNNNGR-IKQLRSGALQIEQSEESDQGKYECVATNNDGTRYSAPANLYVRVRRVPPRFSIPPTDNEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPEDDMPIGRNV------------------LELTDVQQSANY--TCVAMST-LGVIEAVAQITVKALPKAPGIP----VVTERTATSITLTWDSGNPEPVTYYIIQHKSKYSDDLYKEING-----VATTRYSVGGLSPYSDYEFRVVAVNNIGRGPPSESIE---------AKTAEQAPSTAPRHVRGHMMSATTAVIQWDEPEEANG-QIMGYRVYYTMDPTQHVNIWEKQIVRGSNFVTIHGLIPNKTYNIKVLAYTSVGDGPLSPDLQIIAKTGVPSQPTDFK--GEAKSETSVLLSWNT---PSQTGQENQVTGYELIYRKRDDKEEKQ-----ISFEPTTTYLLKDLKPFTTY-------------TFRLAARSKHGVGAYTSEISAETPQTQPAGPPEEVKCSSPSSTKILVSWRAPPVELRNGIITQYTVSYAPTEGEDTAARQISNI--------PPESSQYLLENLEKWTEYRVTVTAHTDVGAGPESLPHLIRTEED--VPEKPRLMVSTTNMG----------TALLQWHPPAVTHGPLQGYRLRFGR-------KDVDPLTVIEFQERDNHYTTSE--IHKGASYTFRLSARNKVGFGEETVKEITTNEDVPSGYPQNIKAEGATTSTIQVSWQPVLLAERNGKIVKYALQYKDINSPRSPSELFITAPESTVVLDGLRPDTTYDIKMCAFTSKGSGPYSPSVQFRTQPVDQVFAKNFHVRAAMKSSVLLTWEIPDTYNPAQPFTILYDKGQSVEV-------DGRLTQKLITG 943          

HSP 4 Score: 77.411 bits (189), Expect = 2.143e-13
Identity = 149/640 (23.28%), Postives = 260/640 (40.62%), Query Frame = 2
Query:  272 LICKAQGNPKPTVQ-FKINGKVQSNDSHRKIIRSFDFGASLRQQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTL----VSYSKVEATSAVIEW-LPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVA-VSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQ--QNGRIKGYRLYYTERLWSAIDNWHIREVQDTP---YYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAM-VDDHKLEGYELKYR-LDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICW 2149
            ++C A GNP P +  FK    V +++++ +I +       + Q  + D      +C+A N+ G    SA   +      VP  F I    P D     G    I C     P   V W+  +    D   E    +G   L + +V+++   +Y C+A + +G +               A+  +  K  P  P I     +    T     LT ++ G+P P+ ++ +Q  +  S +      G      S   L+  ++    V  A N +G       I  K    AP+     V    + AT+AVI+W  P ++N  I  Y +        DP     Q  N++   +++   S  V+  I  L     Y ++V+A  S   G   P L I  +T  +P  S PTD   +A S  S+ ++W  P Q  Q  ++ GY L Y +R     D+   +++   P   Y L +L    TY  ++ A +  G G  +        +  +  +T P   P   + ++ +S S+T I + W  P + + +  +  Y + Y   +G++       +I P  +QYL++NL+    Y +++   T  G G  + L    + E  + E   L +  TN+   +A + W
Sbjct:  137 MLCAASGNPDPDISWFKDFLPVNTSNNNGRIKQLRSGALQIEQSEESDQGK--YECVATNNDGT-RYSAPANLYVRVRRVPPRFSI---PPTDNEIMPGGSVNITCVAVGSPMPYVKWMLGAE---DLTPEDDMPIGRNVLELTDVQQS--ANYTCVAMSTLGVI--------------EAVAQITVKALPKAPGIPVVTER----TATSITLTWDS-GNPEPVTYYIIQHKSKYSDDLYKEINGVATTRYSVGGLSPYSDYEFRVV-AVNNIGRGPPSESIEAKTAEQAPSTAPRHVRGHMMSATTAVIQWDEPEEANGQIMGYRVYY----TMDP----TQHVNIW--EKQIVRGSNFVT--IHGLIPNKTYNIKVLAYTSVGDGPLSPDLQIIAKT-GVP--SQPTDFKGEAKSETSVLLSWNTPSQTGQENQVTGYELIYRKR-----DDKEEKQISFEPTTTYLLKDLKPFTTYTFRLAARSKHGVGAYTSE------ISAETPQTQPAGPP---EEVKCSSPSSTKILVSWRAPPVELRNGIITQYTVSYAPTEGEDTAARQISNIPPESSQYLLENLEKWTEYRVTVTAHTDVGAGPES-LPHLIRTEEDVPEKPRLMVSTTNMG--TALLQW 713          

HSP 5 Score: 58.9214 bits (141), Expect = 7.918e-8
Identity = 201/1008 (19.94%), Postives = 367/1008 (36.41%), Query Frame = 2
Query:  890 GQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIH-LTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKV------SFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPP--SSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYYLNNL----IHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWT--HPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSEN----ATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKT--LDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPP--QISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPA--PENIETKALNDYQIKVSWN---FPEKANQVTDLLSQVNGFHVQVSTNRDFPDGKITFKKIVGPFTSTVMEKIYPNH-YFIRVQAIIRDKRIAEWSNIHTLT-----VFKSKYTERNIKGLNCIGQTNSIKVTWEKPDDYTEIKSFLI 3811
            G  A+  C A G P P + W  +    ++   E     D   S   I  L    +   Y C A N +G I    ++ V ++   P       +     V+E           + T+L   + N DP +   +     F P   S+ + ++      + QI + +     + + VA +N+         +  +   +PP  S PPTD   + +   S+ +T            G  + Y + +  A D   +    D P   N L    +  +  Y  V    L           ++  V    VK LP + P +P        + TSI + W   +P  V  + ++ ++ KY  D      ++KE      T+Y +  L P   Y   +      G G  ++  E    E   +  +   + G  +S  +A I W    + +   + +R+ Y +  D ++  +  E      +N +T        +  L P+  Y++ V    +  D  L+  L+ +  +           VP +P     +  + TS  +SW  P +T   +QV  Y + +R+  +K +    F  T             ++L +L P   Y   + A S+ G G+    EI       +    P E++ +          P    + ++W  P  ++ +G+I  Y V+ +   P E   E    +   N+  E+ +   E  +     Y   V A   V  G  +  +    EE     P  +       T  L+WHPP + +  G +  Y+++ F  K+          E       + + +  +Y F++ A NK G G  +       ++E  P+  P+NI+ +      I+VSW      E+  ++     Q    +   S +  F         I  P ++ V++ + P+  Y I++ A           ++   T     VF   +  R           +S+ +TWE PD Y   + F I
Sbjct:   30 GGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNTVGEISASTRLTVLREDQLPPGFPTIDMGPQLKVVER--------TRTATMLCAASGNPDPDISWFKD----FLPVNTSNNNGRIKQLRSGALQIEQSEESDQGKYECVATNNDGTRYSAPANLYVRVRRVPPRFSIPPTD--NEIMPGGSVNITCV--------AVGSPMPYVKWMLGAED---LTPEDDMPIGRNVLELTDVQQSANYTCVAMSTLG----------VIEAVAQITVKALPKA-PGIPVV---TERTATSITLTWDSGNPEPVTYYIIQ-HKSKYSDD------LYKEINGVATTRYSVGGLSPYSDYEFRVVAVNNIGRGPPSESIEAKTAEQAPS-TAPRHVRGHMMSATTAVIQWDEPEEANGQIMGYRVYYTM--DPTQHVNIWEKQIVRGSNFVT--------IHGLIPNKTYNIKVLAYTSVGDGPLSPDLQIIAKT----------GVPSQPTDFKGEAKSETSVLLSWNTPSQTGQENQVTGYELIYRKRDDKEEKQISFEPTTT-----------YLLKDLKPFTTYTFRLAARSKHGVGAYTS-EISAETPQTQPAGPPEEVKCS---------SPSSTKILVSWRAPPVELRNGIITQYTVSYA---PTE--GEDTAARQISNIPPESSQYLLE-NLEKWTEYRVTVTAHTDVGAGPESLPHLIRTEEDVPEKPRLMVSTTNMGTALLQWHPPAVTH--GPLQGYRLR-FGRKDVDPLTVIEFQERDNHYTTSEIHKGASYTFRLSARNKVGFGEET--VKEITTNEDVPSGYPQNIKAEGATTSTIQVSWQPVLLAERNGKIVKYALQYKDINSPRSPSELF---------ITAPESTVVLDGLRPDTTYDIKMCAFTSKGSGPYSPSVQFRTQPVDQVFAKNFHVR-------AAMKSSVLLTWEIPDTYNPAQPFTI 922          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Medaka
Match: PTPRD (receptor-type tyrosine-protein phosphatase delta [Source:NCBI gene;Acc:101165843])

HSP 1 Score: 884.789 bits (2285), Expect = 0.000e+0
Identity = 400/591 (67.68%), Postives = 485/591 (82.06%), Query Frame = 2
Query: 4958 PPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            PPIP+  L   +  L+ANDN  FSQEYESIDP QQFTWE+SNLE+N+ KNRYANVIAYDHSRILL  I+G+ GSDYINANYIDGY++ NAYIATQGPL  TFG+FWRM+WEQ +A +VMMTKLEER+R+KCDQYWP +GTE+Y  G I V++ DT ELA Y +RTF +  N SS         +KRE+RQ+QFTAWPDHGVP++P P L FL+R++A NP  + P++VHCSAGVGRTG FIVID  LER +HE TVDI+G V++MRAQRNYMVQTEDQYVF+H+ +L+AV    TEV  +N+  ++QKL + +   G +  TG+ELEF++L+  K + +R  SANLP N+ KNRLVNI+PYE  R+CLQPIRG EGSDYINAS+IDGY+  KAYIATQ PL ET EDFWRM+WEHNSTI+VMLTKLREMGREKCH+YWP ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRTVRQFQFT+WPEQGVP ++ E FI+FIGQVHKTKEQFGQ+GPI+VHCSAGVGRTGVF+ LSI LER++ EGV+D+FQ V+ LR QR  MVQ+E+QY+FCY A  +Y+ SFD +
Sbjct: 1358 PPIPISELADHLERLKANDNLKFSQEYESIDPAQQFTWEHSNLEVNKPKNRYANVIAYDHSRILLSAIDGIPGSDYINANYIDGYRKQNAYIATQGPLPETFGEFWRMIWEQRSAVVVMMTKLEERSRVKCDQYWPTRGTETY--GLIQVSLLDTVELATYCVRTFSLFKNGSS---------EKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERNKHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLEAVNCGTTEVPARNLYAYIQKLTQIE---GGENVTGMELEFKRLANTKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAGLEYLGSFDHY 1933          

HSP 2 Score: 361.303 bits (926), Expect = 3.230e-100
Identity = 309/1145 (26.99%), Postives = 517/1145 (45.15%), Query Frame = 2
Query:  203 GQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHE-KVDSNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNP-PIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYY-LNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMV-DDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVG-----VSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPM--KTLDQVKYYIIEWRELSNKSKNSK--VFNVTVDINKSNPNNVYEH--ILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGE-KKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYY---ISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDLLSQVN-GFHVQVSTNRDFPDGKITFKKIVG 3574
             Q+P      P D T   G     IC+A G+P+P + +   GK  SN     I      G+ LR Q ++   +  + +C+A N +G  + S  +TV+  + ++P GFP I  GP   + +  + A + C  S +P   ++W K+       +NN R + + +G+L I+   E+D G YEC+ATN  GT  S    L           Y++ +  P  P+     +  E+  G   N+TC A GSP+P V W   +G  +    ++ P+G      + + LTD+ +S +Y C A + +G+I+  AQI VK  P AP +   ++  ATS  + W     NP P+  Y +  K   + D +  +  +A                 + +  L  Y++YE +VVAV NNIG   PS  I  +T E  PS+ P  +    +S  +  + W  P + NG+I GYR+YYT      ++ W  + V+ + +  ++ LI N TY +KV AY   GDGP+S    I+   G          VP  P + +G + S TS+ + W  P+    ++++ GYEL YR   D++ K      EP  T YL+ +LKP   Y   LA ++K GVG     +SA+  +T +      E+       T I      + W+    E +  +  +  Y + +  +E + T+    + I   +   ++L +L   + Y + V    +TD       L  L  +       + D     P  V ++ +NS+S K+ W+ P+  K   Q++ Y + +  + N     +  + ++ +D  +    +  EH  I+  L+    Y + V A + KG G+  K ++I T G   VP  PR +  T ++              L W+PP ++HG + GYR+           K++ P+ +      + + +  E  I  G +Y F + A N V FGE      T  E+ PS  P  ++ +G    T+ + W P  +  RNG I KY +QY D+  P    +   T  ++T ++  L+ +T Y  K+ A   +G GP+SP   +    +    F   +N   +A     + ++W  P+  N         + G  V+V       DG++T K I G
Sbjct:   36 AQTPPKFLRTPNDQTGVQGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNTVGEISASTRLTVLRED-QLPPGFPTIDMGPQLKVVERTRTATMLCAASGNPDPDISWFKDFLPVNTSNNNGRIKQLRSGALQIEQSEESDQGKYECVATNNDGTRYSAPANL-----------YVRVRRVP--PRFSIPPTDNEIMPGGSVNITCVAVGSPMPYVKW--MLGAEDLTPEDDMPIG-----RNVLELTDVQQSANYTCVAMSTLGVIEAVAQITVKALPKAPGIPVVTERTATSITLTW--DSGNPEPVTYYIIQHKSKYSDDLYKEINGVAT--------------TRYSVGGLSPYSDYEFRVVAV-NNIGRGPPSESIEAKTAEQAPSTAPRHVRGHMMSATTAVIQWDEPEEANGQIMGYRVYYTMDPTQHVNIWEKQIVRGSNFVTIHGLIPNKTYNIKVLAYTSVGDGPLSPDLQIIAKTG----------VPSQPTDFKGEAKSETSVLLSWNTPSQTGQENQVTGYELIYRKRDDKEEKQIS--FEP-TTTYLLKDLKPFTTYTFRLAARSKHGVGAYTSEISAETPQTPEPAGPPEEVKCSSPSSTKI-----LVSWRAPPVELRNGIITQ--YTVSYAPTEGEDTAARQISNIP-PESSQYLLENLEKWTEYRVTV--TAHTDVGAGPESLPHLIRT-------EEDVPSGPPRKVEVEAVNSSSIKVIWRSPVPTKQHGQIRGYQVHYVRMVNGEPTGQPVIKDILIDDAQWEFEDSTEHEMIITGLMAETTYSVTVAAYTTKGDGARSKPKLITTTG--AVPEKPRLMVSTTNMG----------TALLQWHPPAVTHGPLQGYRLRFGR-------KDVDPLTVIEFQERDNHYTTSE--IHKGASYTFRLSARNKVGFGEETVKEITTNEDVPSGYPQNIKAEGATTSTIQVSWQPVLLAERNGKIVKYALQYKDINSPRSPSELFITAPESTVVLDGLRPDTTYDIKMCAFTSKGSGPYSPSVQFRTQPVDQAVF--AKNFHVRAAMKSSVLLTWEIPDTYNPAQPFTILYDKGQSVEV-------DGRLTQKLITG 1082          

HSP 3 Score: 118.627 bits (296), Expect = 6.331e-26
Identity = 245/1146 (21.38%), Postives = 449/1146 (39.18%), Query Frame = 2
Query:  494 SNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQVV----GTGS-LTIKNVRE-TDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEV-STGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGL-IKKEAQIIVKKKPMAPTL----VSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKP--PLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRIS-YMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVS----IKVINSTSSKI--SWKGPMKTLDQ--VKYYIIEWRELSNKSKNSK-VFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVA-ISLI-GPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPG----KTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPA--PENIETKALNDYQIKVSWN---FPEKANQVTDLLSQVNGFHVQVSTNRDFPDGKITFKKIVGPFTSTVMEKIYPNH-YFIRVQAIIRDKRIAEWSNIHTLTV-FKSKYTERNIKGLNC---IGQTNSIKVTWEKPDDYTEIKSFLI 3811
            ++A+ P   P     P D     G +A   C+ + DP  K+ W K   +KV  +N+RF+V+    G+GS L I+ +R   D   YEC+A+N VG +           + ++ L  ++E + P     +D   +++V    + A + C A G+P P + W       N+ N   R +   +  +  I  ++ ++ G Y C A N  G      A + V+ + + P           +   S  I  + V S  P   + L  +D + +D     R +                   ++T+++   NY    VA+S  +G  +    I  + L   P  P         +  SI +TW    P      I  ++  Y++ L+  I+      V  T Y +  L   + Y  +V A N  G GP S++            KT   +    P+++RG  +S T+  I W  P   +  ++ GY + Y +D  +   ++++ I        I  L P K Y+I +   T  G G  +   +      + ++ ++ K  G   S+ S  + W      S+    ++++ Y LI+   + K   +     I+      ++L  L+P + Y                +  +       + S +  ++ P  PE       +K  + +S+KI  SW+ P   L    +  Y + +     +   ++ + N+        P    +++L NL     Y++ V A +  G G      +I+T  +  VPS P      ++V   S K   R  V      P   HG I GY+V  + ++ G P     +K + I  +   E   S E   I  G     TY   V A  +   G  ++             P  +       T  L+WHPP + +  G +  Y+++ F  K+          E       + + +  +Y F++ A NK G G  +       ++E  P+  P+NI+ +      I+VSW      E+  ++     Q    +   S +  F         I  P ++ V++ + P+  Y I++ A       ++ S  ++ +V F+++  ++ +   N        +S+ +TWE PD Y   + F I
Sbjct:   34 ADAQTP---PKFLRTPNDQTGVQGGVASFICQATGDPRPKIVWNKKG-KKV--SNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNTVGEI-----------SASTRLTVLREDQLPPGFPTIDMGPQLKVVERTRTATMLCAASGNPDPDISWFKDFLPVNTSNNNGR-IKQLRSGALQIEQSEESDQGKYECVATNNDGTRYSAPANLYVRVRRVPPRFSIPPTDNEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPEDDMPIGRNV------------------LELTDVQQSANY--TCVAMST-LGVIEAVAQITVKALPKAPGIP----VVTERTATSITLTWDSGNPEPVTYYIIQHKSKYSDDLYKEING-----VATTRYSVGGLSPYSDYEFRVVAVNNIGRGPPSESIE---------AKTAEQAPSTAPRHVRGHMMSATTAVIQWDEPEEANG-QIMGYRVYYTMDPTQHVNIWEKQIVRGSNFVTIHGLIPNKTYNIKVLAYTSVGDGPLSPDLQIIAKTGVPSQPTDFK--GEAKSETSVLLSWNT---PSQTGQENQVTGYELIYRKRDDKEEKQ-----ISFEPTTTYLLKDLKPFTTY-------------TFRLAARSKHGVGAYTSEISAET-PQTPEPAGPPEEVKCSSPSSTKILVSWRAPPVELRNGIITQYTVSYAPTEGEDTAARQISNI--------PPESSQYLLENLEKWTEYRVTVTAHTDVGAGPESLPHLIRTEED--VPSGPPRKVEVEAVNSSSIKVIWRSPV------PTKQHGQIRGYQVHYVRMVNGEPTGQPVIKDILI-DDAQWEFEDSTEHEMIITGLMAETTYSVTVAAYTTKGDGARSKPKLITTTGAVPEKPRLMVSTTNMGTALLQWHPPAVTH--GPLQGYRLR-FGRKDVDPLTVIEFQERDNHYTTSEIHKGASYTFRLSARNKVGFGEET--VKEITTNEDVPSGYPQNIKAEGATTSTIQVSWQPVLLAERNGKIVKYALQYKDINSPRSPSELF---------ITAPESTVVLDGLRPDTTYDIKMCAFT-----SKGSGPYSPSVQFRTQPVDQAVFAKNFHVRAAMKSSVLLTWEIPDTYNPAQPFTI 1061          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Medaka
Match: PTPRD (receptor-type tyrosine-protein phosphatase delta [Source:NCBI gene;Acc:101165944])

HSP 1 Score: 881.322 bits (2276), Expect = 0.000e+0
Identity = 401/617 (64.99%), Postives = 497/617 (80.55%), Query Frame = 2
Query: 4880 LELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF 6730
            +EL++I N Q P +  +         PP+P+  L   I  L+ANDN  FSQEYES+DPGQQFTWENSNLE+N+ KNRYANVIAYDHSR++L  I GV GSDYINANYIDGY+R NAYIATQG L  TFGDFWRMVWEQ +A+I+MMTKLEE++R+KCDQYWP +GTE+Y  G I VT+ DT ELA Y++RTF +   Y  N S      +KRE+R +QFTAWPDHGVP++P P L FL+R++A NP  + P++VHCSAGVGRTG FIVID   ERI+HE T+D++G V++MR+QRNYMVQTEDQY+F+H+ VL+AV   NTEV  +N+ +++Q+L + +     +  TG+ELEF++L+  K + +R  SANLP N+ KNRLVNI+PYE  R+CLQPIRG EGSDYINAS+IDGY+  +AYIATQ PL ET ED+WRM+WEHNSTI+VMLTKLREMGREKCH+YWP ERS+R+QYFVVDPM EYNMP ++L+EFKVTDARDGQSRTVRQFQFT+WPEQGVP ++ E FI+FIGQVHKTKEQFGQ+GPITVHCSAGVGRTGVF+ LSI LER++ EGV+D+FQ V+ LR QR   VQ+E+QY+FCY A+ +Y+ SFD +
Sbjct:  904 VELRRI-NFQTPGMASH---------PPVPISELTDHIERLKANDNLKFSQEYESVDPGQQFTWENSNLEVNKPKNRYANVIAYDHSRVVLSSIEGVPGSDYINANYIDGYRRQNAYIATQGALPETFGDFWRMVWEQHSANIIMMTKLEEKSRVKCDQYWPTRGTETY--GLIQVTLLDTVELATYSVRTFAL---YKVNGS-----NEKREVRHFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMTERIKHEKTIDVYGHVTLMRSQRNYMVQTEDQYIFIHDAVLEAVTCGNTEVPARNLYSYIQRLTQIEPG---ENVTGMELEFKRLASAKAHTSRFVSANLPCNKFKNRLVNIMPYETTRVCLQPIRGVEGSDYINASFIDGYRQQRAYIATQGPLAETTEDYWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVP-KSGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPATVQTEDQYQFCYRASLEYLGSFDHY 1496          

HSP 2 Score: 270.781 bits (691), Expect = 1.231e-72
Identity = 189/620 (30.48%), Postives = 297/620 (47.90%), Query Frame = 2
Query:  200 SGQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLR-QQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHE-KVDSNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNP-PIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYY-LNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVD--DHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGV 2041
            S ++    T  P D T   G     +C+A G+P+P + +   GK  SN     I      G+ LR Q ++   +  + +C A N  G  T S  ++V+  + ++PAGFP I  GP   + +  + A + C  S +P  +++W K+       SNN R + + +G+L I+   E+D G YEC+ATN  GT           R  T A  Y++ +  P  P+     +  E+  G   N+TC A GSP+P V W   +G  +    ++ P+G      + + LTD+ +S +Y C A + +G+I+  AQI VK  P AP +   ++  ATS  + W     NP P+  Y +  +   ++DP   +  IA                 + +  L  Y++Y+ +V A  N IG   PS  +  +T E  PSSPP  +  + +S  +  + W  P + NG++ GYR+YYT      ++ W  + V+ T +  + +L  N TYY++V A+   GDGP+S    I+   G          VP  P   +G + S TSI + W  P+     + ++ GYEL YR   D + K  K   EP  T YL+ NLKP   Y   LA K+K G+G 
Sbjct:   19 SDRTSPRFTRTPEDQTGVQGGVASFVCQAAGDPQPKIMWNKKGKRVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECHASNSAGEITASTRLSVLRED-QLPAGFPTIDMGPQLKVVERSRTATMLCAASGNPDPEISWFKDFLPVNTSSNNGRIKQLRSGALQIEMSEESDQGKYECVATNSDGT-----------RYSTPANLYVRVRRVP--PRFSIPPADSEIMPGGNINITCVAVGSPMPYVKW--MLGAEDLTPEDDMPIG-----RNVLELTDVRQSNNYTCVAMSTLGVIEAMAQITVKALPKAPGMPMVTERTATSITLTW--DSGNPEPVSYYVIQYRGKGSEDPFKEIDGIAT--------------TRYSVGGLSPYSHYDFRVAAF-NTIGQGPPSEVVEARTAEQAPSSPPRQVIGRMLSATTAMIHWDEPEEPNGQVVGYRVYYTSDNMLPVNQWDKQMVRSTSFITIQDLTPNKTYYIRVLAFTSVGDGPLSQDLQIIAKTG----------VPSQPSEFKGEAKSETSILLSWVAPSTQGGPESQITGYELVYRRVNDSEEK--KVTFEP-TTSYLLKNLKPFSTYTFQLAAKSKNGIGA 587          

HSP 3 Score: 89.7373 bits (221), Expect = 3.553e-17
Identity = 143/620 (23.06%), Postives = 245/620 (39.52%), Query Frame = 2
Query:  521 PIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQVV----GTGS-LTIKNVRE-TDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEV-STGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGL-IKKEAQIIVKKKPMAPTLVSYSKVEATSAV-------IEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKP--PLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICW----KMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGY 2317
            P  T  P D     G +A   C+ + DP  K+ W K        +N+RF+V+    G+GS L I+ +R   D   YEC A+N  G + +           ++ L  ++E + P     +D   +++V    + A + C A G+P P + W       N+ +   R +   +  +  I +++ ++ G Y C A N  G      A + V+ + + P    +S   A S +       I  + V S  P   + L  +D + +D     R +                   ++T+++   NY    VA+S  +G  +    I  + L   P  P         +  SI +TW    P   +  +  YR   +E  +  ID      +  T Y +  L   + Y  +V A+N  G GP S+      VV     +  P+S P   + + G  LS T+  I W  P    + ++ GY + Y  D       + + +    +   I +L P K Y+I +   T  G G  +Q  +      + ++ S  K  G   S+ S  + W         ES+I   + + Y  + D  E K T E  T+         ++L +L+P S Y
Sbjct:   24 PRFTRTPEDQTGVQGGVASFVCQAAGDPQPKIMWNKKGKR---VSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECHASNSAGEITA-----------STRLSVLREDQLPAGFPTIDMGPQLKVVERSRTATMLCAASGNPDPEISWFKDFLPVNTSSNNGR-IKQLRSGALQIEMSEESDQGKYECVATNSDGTRYSTPANLYVRVRRVPP---RFSIPPADSEIMPGGNINITCVAVGSPMPYVKWMLGAEDLTPEDDMPIGRNV------------------LELTDVRQSNNY--TCVAMST-LGVIEAMAQITVKALPKAPGMP----MVTERTATSITLTWDSGNPEPVSYYVIQYRGKGSEDPFKEIDG-----IATTRYSVGGLSPYSHYDFRVAAFNTIGQGPPSE------VVEARTAEQAPSSPP---RQVIGRMLSATTAMIHWDEPEE-PNGQVVGYRVYYTSDNMLPVNQWDKQMVRSTSFITIQDLTPNKTYYIRVLAFTSVGDGPLSQDLQIIAKTGVPSQPSEFK--GEAKSETSILLSWVAPSTQGGPESQIT-GYELVYRRVNDSEEKKVTFEPTTS---------YLLKNLKPFSTY 573          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Planmine SMEST
Match: SMESG000068618.1 (SMESG000068618.1)

HSP 1 Score: 4152.05 bits (10767), Expect = 0.000e+0
Identity = 2057/2087 (98.56%), Postives = 2062/2087 (98.80%), Query Frame = 2
Query:  131 MKQIEXXXXXXXXXXXXXXSCQTSGQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLRQQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQVSTNRDFPDGKITFKKIVGPFTSTVMEKIYPNHYFIRVQAIIRDKRIAEWSNIHTLTVFKSKYTERNIKGLNCIGQTNSIKVTWEKPDDYTEIKSFLIELSGYRKFRNIYGAYKIEKIKARTSRIEFFGEEQSTYNYSIPNLEPNTNYDXXXXXXXXXXXXXXXXXXXXXCVTLMEQPKSILSPMPVPLRKVSNEIILRLSRTNEILGMISHYYLIVSPIKETHVTPHDVNIDETFTQTKNLKAMNSRYVAAQFTPALFRSKSYVDFVLGSNSPIESFHSNDWIFLKRLPVKKKTNLKAFLRACVIPEGLTSDLKSIPVERCTSSEWSMTFSTDINREIQVFTAAVIAGIGSIVFLVFICIGFACFLKRSHSKISRPLGSTDPCLKQPLMMQPGLSGGNLPQYTNIVNIGNSSRHGYTDSLRTNSDLCATSGVMTPINNHQPLSVSNPMFEQRSLELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSR 6391
            MKQIEFFSIFLFLDFFLHFSCQTSGQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLRQQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVG          VPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVLTLKETETESKTTEMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQVSTNRDFPDGKITFKKIVGPFTSTVMEKIYPNHYFIRVQAIIRDKRIAEWSNIHTLTVFKSKYTERNIKGLNCIGQTNSIKVTWEKPDDYTEIKSFLIELSGYRKFRNIYGAYKIEKIKARTSRIEFFGEEQSTYNYSIPNLEPNTNYDLSIKILYSSISKLESISKTTSCVTLMEQPKSILSPMPVPLRKVSNEIILRLSRTNEILGMISHYYLIVSPIKETHVTPHDVNIDETFTQTKNLKAMNSRYVAAQFTPALFRSKSYVDFVLGSNSPIESFHSNDWIFLKRLPVKKKTNLKAFLRACVIPEGLTSDLKSIPVERCTSSEWSMTFSTDINREIQVFTAAVIAGIGSIVFLVFICIGFACFLKRSHSKISRPLGSTDPCLKQPLMMQPGLSGGNLPQYTNIVNIGNSSRHGYTDSLRTNSDLCATSGVMTPINNHQPLSVSNPMFEQRSLELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPM+       +L  F +   R+ + R
Sbjct:    1 MKQIEFFSIFLFLDFFLHFSCQTSGQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLRQQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVG----------VPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVLTLKETETESKTTEMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQVSTNRDFPDGKITFKKIVGPFTSTVMEKIYPNHYFIRVQAIIRDKRIAEWSNIHTLTVFKSKYTERNIKGLNCIGQTNSIKVTWEKPDDYTEIKSFLIELSGYRKFRNIYGAYKIEKIKARTSRIEFFGEEQSTYNYSIPNLEPNTNYDLSIKILYSSISKLESISKTTSCVTLMEQPKSILSPMPVPLRKVSNEIILRLSRTNEILGMISHYYLIVSPIKETHVTPHDVNIDETFTQTKNLKAMNSRYVAAQFTPALFRSKSYVDFVLGSNSPIESFHSNDWIFLKRLPVKKKTNLKAFLRACVIPEGLTSDLKSIPVERCTSSEWSMTFSTDINREIQVFTAAVIAGIGSIVFLVFICIGFACFLKRSHSKISRPLGSTDPCLKQPLMMQPGLSGGNLPQYTNIVNIGNSSRHGYTDSLRTNSDLCATSGVMTPINNHQPLSVSNPMFEQRSLELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMMLEMDSLELLDSFSLQSGRNKEYR 2077          

HSP 2 Score: 204.527 bits (519), Expect = 3.517e-52
Identity = 104/256 (40.62%), Postives = 149/256 (58.20%), Query Frame = 2
Query: 5984 SANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVV-------DPMVEYNMPNFVLQEFKVTDARDGQS----RTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNS 6718
            ++NL +NR KNR  N++ Y+ +RI LQ I G  GSDYINA+YIDGY+   AYIATQ PL  T  DFWRM+WE  +  IVM+TKL E  R KC +YWP + +  +    +         +  Y +  F++     +++ +  S    R +RQ+QFT WP+ GVP       + F+ ++        +  PI VHCSAGVGRTG F+ +   LER+++E  +D+F  V  +R QR  MVQ+E+QY F +    D V +
Sbjct: 1639 NSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPM-PLLMFLKRIRAGNPLSSR--PIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRA 1891          

HSP 3 Score: 65.0846 bits (157), Expect = 8.509e-10
Identity = 30/31 (96.77%), Postives = 31/31 (100.00%), Query Frame = 3
Query: 6369 MLEMDSLELLDSFSLQSGRNREYRIKLLKHL 6461
            MLEMDSLELLDSFSLQSGRN+EYRIKLLKHL
Sbjct: 2054 MLEMDSLELLDSFSLQSGRNKEYRIKLLKHL 2084          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Planmine SMEST
Match: SMESG000068618.1 (SMESG000068618.1)

HSP 1 Score: 4130.1 bits (10710), Expect = 0.000e+0
Identity = 2050/2087 (98.23%), Postives = 2057/2087 (98.56%), Query Frame = 2
Query:  131 MKQIEXXXXXXXXXXXXXXSCQTSGQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLRQQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQVSTNRDFPDGKITFKKIVGPFTSTVMEKIYPNHYFIRVQAIIRDKRIAEWSNIHTLTVFKSKYTERNIKGLNCIGQTNSIKVTWEKPDDYTEIKSFLIELSGYRKFRNIYGAYKIEKIKARTSRIEFFGEEQSTYNYSIPNLEPNTNYDXXXXXXXXXXXXXXXXXXXXXCVTLMEQPKSILSPMPVPLRKVSNEIILRLSRTNEILGMISHYYLIVSPIKETHVTPHDVNIDETFTQTKNLKAMNSRYVAAQFTPALFRSKSYVDFVLGSNSPIESFHSNDWIFLKRLPVKKKTNLKAFLRACVIPEGLTSDLKSIPVERCTSSEWSMTFSTDINREIQVFTAAVIAGIGSIVFLVFICIGFACFLKRSHSKISRPLGSTDPCLKQPLMMQPGLSGGNLPQYTNIVNIGNSSRHGYTDSLRTNSDLCATSGVMTPINNHQPLSVSNPMFEQRSLELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSR 6391
            MKQIEFFSIFLFLDFFLHFSCQTSGQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLRQQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIR             +SPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLP  +PPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVLTLKETETESKTTEMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQVSTNRDFPDGKITFKKIVGPFTSTVMEKIYPNHYFIRVQAIIRDKRIAEWSNIHTLTVFKSKYTERNIKGLNCIGQTNSIKVTWEKPDDYTEIKSFLIELSGYRKFRNIYGAYKIEKIKARTSRIEFFGEEQSTYNYSIPNLEPNTNYDLSIKILYSSISKLESISKTTSCVTLMEQPKSILSPMPVPLRKVSNEIILRLSRTNEILGMISHYYLIVSPIKETHVTPHDVNIDETFTQTKNLKAMNSRYVAAQFTPALFRSKSYVDFVLGSNSPIESFHSNDWIFLKRLPVKKKTNLKAFLRACVIPEGLTSDLKSIPVERCTSSEWSMTFSTDINREIQVFTAAVIAGIGSIVFLVFICIGFACFLKRSHSKISRPLGSTDPCLKQPLMMQPGLSGGNLPQYTNIVNIGNSSRHGYTDSLRTNSDLCATSGVMTPINNHQPLSVSNPMFEQRSLELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPM+       +L  F +   R+ + R
Sbjct:    1 MKQIEFFSIFLFLDFFLHFSCQTSGQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLRQQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIR-------------QSPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLP--MPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVLTLKETETESKTTEMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQVSTNRDFPDGKITFKKIVGPFTSTVMEKIYPNHYFIRVQAIIRDKRIAEWSNIHTLTVFKSKYTERNIKGLNCIGQTNSIKVTWEKPDDYTEIKSFLIELSGYRKFRNIYGAYKIEKIKARTSRIEFFGEEQSTYNYSIPNLEPNTNYDLSIKILYSSISKLESISKTTSCVTLMEQPKSILSPMPVPLRKVSNEIILRLSRTNEILGMISHYYLIVSPIKETHVTPHDVNIDETFTQTKNLKAMNSRYVAAQFTPALFRSKSYVDFVLGSNSPIESFHSNDWIFLKRLPVKKKTNLKAFLRACVIPEGLTSDLKSIPVERCTSSEWSMTFSTDINREIQVFTAAVIAGIGSIVFLVFICIGFACFLKRSHSKISRPLGSTDPCLKQPLMMQPGLSGGNLPQYTNIVNIGNSSRHGYTDSLRTNSDLCATSGVMTPINNHQPLSVSNPMFEQRSLELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMMLEMDSLELLDSFSLQSGRNKEYR 2072          

HSP 2 Score: 204.527 bits (519), Expect = 3.984e-52
Identity = 104/256 (40.62%), Postives = 149/256 (58.20%), Query Frame = 2
Query: 5984 SANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVV-------DPMVEYNMPNFVLQEFKVTDARDGQS----RTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNS 6718
            ++NL +NR KNR  N++ Y+ +RI LQ I G  GSDYINA+YIDGY+   AYIATQ PL  T  DFWRM+WE  +  IVM+TKL E  R KC +YWP + +  +    +         +  Y +  F++     +++ +  S    R +RQ+QFT WP+ GVP       + F+ ++        +  PI VHCSAGVGRTG F+ +   LER+++E  +D+F  V  +R QR  MVQ+E+QY F +    D V +
Sbjct: 1634 NSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPM-PLLMFLKRIRAGNPLSSR--PIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRA 1886          

HSP 3 Score: 65.4698 bits (158), Expect = 7.011e-10
Identity = 30/31 (96.77%), Postives = 31/31 (100.00%), Query Frame = 3
Query: 6369 MLEMDSLELLDSFSLQSGRNREYRIKLLKHL 6461
            MLEMDSLELLDSFSLQSGRN+EYRIKLLKHL
Sbjct: 2049 MLEMDSLELLDSFSLQSGRNKEYRIKLLKHL 2079          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Planmine SMEST
Match: SMESG000068618.1 (SMESG000068618.1)

HSP 1 Score: 3033.82 bits (7864), Expect = 0.000e+0
Identity = 1497/1517 (98.68%), Postives = 1502/1517 (99.01%), Query Frame = 2
Query: 1841 MWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQVSTNRDFPDGKITFKKIVGPFTSTVMEKIYPNHYFIRVQAIIRDKRIAEWSNIHTLTVFKSKYTERNIKGLNCIGQTNSIKVTWEKPDDYTEIKSFLIELSGYRKFRNIYGAYKIEKIKARTSRIEFFGEEQSTYNYSIPNLEPNTNYDXXXXXXXXXXXXXXXXXXXXXCVTLMEQPKSILSPMPVPLRKVSNEIILRLSRTNEILGMISHYYLIVSPIKETHVTPHDVNIDETFTQTKNLKAMNSRYVAAQFTPALFRSKSYVDFVLGSNSPIESFHSNDWIFLKRLPVKKKTNLKAFLRACVIPEGLTSDLKSIPVERCTSSEWSMTFSTDINREIQVFTAAVIAGIGSIVFLVFICIGFACFLKRSHSKISRPLGSTDPCLKQPLMMQPGLSGGNLPQYTNIVNIGNSSRHGYTDSLRTNSDLCATSGVMTPINNHQPLSVSNPMFEQRSLELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSR 6391
            MWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVLTLKETETESKTTEMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQVSTNRDFPDGKITFKKIVGPFTSTVMEKIYPNHYFIRVQAIIRDKRIAEWSNIHTLTVFKSKYTERNIKGLNCIGQTNSIKVTWEKPDDYTEIKSFLIELSGYRKFRNIYGAYKIEKIKARTSRIEFFGEEQSTYNYSIPNLEPNTNYDLSIKILYSSISKLESISKTTSCVTLMEQPKSILSPMPVPLRKVSNEIILRLSRTNEILGMISHYYLIVSPIKETHVTPHDVNIDETFTQTKNLKAMNSRYVAAQFTPALFRSKSYVDFVLGSNSPIESFHSNDWIFLKRLPVKKKTNLKAFLRACVIPEGLTSDLKSIPVERCTSSEWSMTFSTDINREIQVFTAAVIAGIGSIVFLVFICIGFACFLKRSHSKISRPLGSTDPCLKQPLMMQPGLSGGNLPQYTNIVNIGNSSRHGYTDSLRTNSDLCATSGVMTPINNHQPLSVSNPMFEQRSLELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPM+       +L  F +   R+ + R
Sbjct:    1 MWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVLTLKETETESKTTEMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQVSTNRDFPDGKITFKKIVGPFTSTVMEKIYPNHYFIRVQAIIRDKRIAEWSNIHTLTVFKSKYTERNIKGLNCIGQTNSIKVTWEKPDDYTEIKSFLIELSGYRKFRNIYGAYKIEKIKARTSRIEFFGEEQSTYNYSIPNLEPNTNYDLSIKILYSSISKLESISKTTSCVTLMEQPKSILSPMPVPLRKVSNEIILRLSRTNEILGMISHYYLIVSPIKETHVTPHDVNIDETFTQTKNLKAMNSRYVAAQFTPALFRSKSYVDFVLGSNSPIESFHSNDWIFLKRLPVKKKTNLKAFLRACVIPEGLTSDLKSIPVERCTSSEWSMTFSTDINREIQVFTAAVIAGIGSIVFLVFICIGFACFLKRSHSKISRPLGSTDPCLKQPLMMQPGLSGGNLPQYTNIVNIGNSSRHGYTDSLRTNSDLCATSGVMTPINNHQPLSVSNPMFEQRSLELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMMLEMDSLELLDSFSLQSGRNKEYR 1517          

HSP 2 Score: 203.756 bits (517), Expect = 4.783e-52
Identity = 104/256 (40.62%), Postives = 149/256 (58.20%), Query Frame = 2
Query: 5984 SANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVV-------DPMVEYNMPNFVLQEFKVTDARDGQS----RTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNS 6718
            ++NL +NR KNR  N++ Y+ +RI LQ I G  GSDYINA+YIDGY+   AYIATQ PL  T  DFWRM+WE  +  IVM+TKL E  R KC +YWP + +  +    +         +  Y +  F++     +++ +  S    R +RQ+QFT WP+ GVP       + F+ ++        +  PI VHCSAGVGRTG F+ +   LER+++E  +D+F  V  +R QR  MVQ+E+QY F +    D V +
Sbjct: 1079 NSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPM-PLLMFLKRIRAGNPLSSR--PIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRA 1331          

HSP 3 Score: 64.3142 bits (155), Expect = 1.236e-9
Identity = 30/31 (96.77%), Postives = 31/31 (100.00%), Query Frame = 3
Query: 6369 MLEMDSLELLDSFSLQSGRNREYRIKLLKHL 6461
            MLEMDSLELLDSFSLQSGRN+EYRIKLLKHL
Sbjct: 1494 MLEMDSLELLDSFSLQSGRNKEYRIKLLKHL 1524          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Planmine SMEST
Match: SMESG000068618.1 (SMESG000068618.1)

HSP 1 Score: 2642.07 bits (6847), Expect = 0.000e+0
Identity = 1349/1546 (87.26%), Postives = 1392/1546 (90.04%), Query Frame = 2
Query: 1769 LPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKY--RLDGDEKGKMFKEHIEPYQ-TQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILNEISNLKIWGTNISKDSATICWK--MNLDESKIALTHRISYMLIFDISELKSTSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVXXXXXXXXXXXXXXMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQVSTNRDFPDGKITFKKIVGPFTSTVMEKIYPNHYFIRVQAIIRDKRIAEWSNIHTLTVFKSKYTERNIKGLNCIGQTNSIKVTWEKPDDYTEIKSFLIELSGYRKFRNIYGAYKIEKIKARTSRIEFFGEEQSTYNYSIPNLEPNTNYDXXXXXXXXXXXXXXXXXXXXXCVTLMEQPKSILSPMPVPLRKVSNEIILRLSRTNEILGMISHYYLIVSPIKETHVTPHDVNIDETFTQTKNLKAMNSRYVAAQFTPALFRSKSYVDFVLGSNSPIESFHSNDWIFLKRLPVKKKTNLKAFLRACVIPEGLTSDLKSIPVERCTSSEWSMTFSTDINREIQVFTAAVIAGIGSIVFLVFICIGFACFLKRSHSKISRPLGSTDPCLKQPLMMQPGLSGGNLPQYTNIVNIGNSSRHGYTDSLRTNSDLCATSGVMTPINNHQPLSVSNPMFEQRSLELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSR 6391
            LP S PP   +L   ++S  SI++ W  P +  + +++GY L Y  RL       +   HI   Q T Y ++NL     Y++ +      G G  +          +     NL+  G ++S  S  I W     +D+ K+   + + Y L  D  + K   E+     T      +++ +L+P   Y +           +L    K        ++    D +PDKPEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVLTLKETETESKTTEMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQVSTNRDFPDGKITFKKIVGPFTSTVMEKIYPNHYFIRVQAIIRDKRIAEWSNIHTLTVFKSKYTERNIKGLNCIGQTNSIKVTWEKPDDYTEIKSFLIELSGYRKFRNIYGAYKIEKIKARTSRIEFFGEEQSTYNYSIPNLEPNTNYDLSIKILYSSISKLESISKTTSCVTLMEQPKSILSPMPVPLRKVSNEIILRLSRTNEILGMISHYYLIVSPIKETHVTPHDVNIDETFTQTKNLKAMNSRYVAAQFTPALFRSKSYVDFVLGSNSPIESFHSNDWIFLKRLPVKKKTNLKAFLRACVIPEGLTSDLKSIPVERCTSSEWSMTFSTDINREIQVFTAAVIAGIGSIVFLVFICIGFACFLKRSHSKISRPLGSTDPCLKQPLMMQPGLSGGNLPQYTNIVNIGNSSRHGYTDSLRTNSDLCATSGVMTPINNHQPLSVSNPMFEQRSLELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPM+       +L  F +   R+ + R
Sbjct:  429 LPPSSPPT--DLFAKAISPDSIKVTW-KPPLQQNGRIKGYRLYYTERL----WSAIDNWHIREVQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGVPPVPQNLR--GASLSTTSIQIMWTHPAMVDDHKLE-GYELKYRLDGD-EKGKMFKEHIEPYQTQ-----YLIDNLKPGKAYHI-----------SLAGKTKFGVGVSAQLTETTKDEIPDKPEAVSIKVINSTSSKISWKGPMKTLDQVKYYIIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGEKKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVLTLKETETESKTTEMITNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALNDYQIKVSWNFPEKANQVTDLLSQVNGFHVQVSTNRDFPDGKITFKKIVGPFTSTVMEKIYPNHYFIRVQAIIRDKRIAEWSNIHTLTVFKSKYTERNIKGLNCIGQTNSIKVTWEKPDDYTEIKSFLIELSGYRKFRNIYGAYKIEKIKARTSRIEFFGEEQSTYNYSIPNLEPNTNYDLSIKILYSSISKLESISKTTSCVTLMEQPKSILSPMPVPLRKVSNEIILRLSRTNEILGMISHYYLIVSPIKETHVTPHDVNIDETFTQTKNLKAMNSRYVAAQFTPALFRSKSYVDFVLGSNSPIESFHSNDWIFLKRLPVKKKTNLKAFLRACVIPEGLTSDLKSIPVERCTSSEWSMTFSTDINREIQVFTAAVIAGIGSIVFLVFICIGFACFLKRSHSKISRPLGSTDPCLKQPLMMQPGLSGGNLPQYTNIVNIGNSSRHGYTDSLRTNSDLCATSGVMTPINNHQPLSVSNPMFEQRSLELKKISNTQAPDLVQNALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARCTSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVVDPMMLEMDSLELLDSFSLQSGRNKEYR 1947          

HSP 2 Score: 1228 bits (3176), Expect = 0.000e+0
Identity = 690/952 (72.48%), Postives = 739/952 (77.63%), Query Frame = 2
Query:  131 MKQIEXXXXXXXXXXXXXXSCQTSGQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLRQQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSVPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENILN--EISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELKSTSENAT--NLITD------TQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKDLTSSKLF--ISTVDNDSVPDKPEAVSIKVINSTSSKI-SWKGPMKTLDQVKY--------YIIEWR---------ELSNKSKNSKVF-NVTVDINKSNPNNVYEHILNNLLPNKYYKIEVLAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAVYLAWNPPQISH--GLILGYRV 2887
            MKQIEFFSIFLFLDFFLHFSCQTSGQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLRQQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIR             +SPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVG   V           QNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDE I +  E  ++K+    I+  S+ I WK       +    ++ Y +I +  EL + S+N+   N+  D           H+L +L P+  Y + V          L    K   S + F  I T  N  VP  P  + +    + S KI S+KGP +    + +         I+ +R         E   + K  K++ NV+ +  KS+           + P K Y  EV A +    G   +        N+ +P    E R +        +G K+  V L W+PP I +  G+I  Y++
Sbjct:    1 MKQIEFFSIFLFLDFFLHFSCQTSGQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLRQQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIR-------------QSPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGVPPVP----------QNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKMFKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDE-IPDKPEAVSIKV----INSTSSKISWK-----GPMKTLDQVKYYII-EWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEV----------LAASRKGKGSPEKFEIIKTHGNFKVPSMPRELRM----TQSVKIPSFKGPKRLAVYLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSDEE-------AKIGPGKTYLFEVQALNSVNFGETARI-------NYTIP----EERPSAPPNKLEIQGEKK-TVTLKWHPPPIDYRNGIITKYKI 885          

HSP 3 Score: 204.527 bits (519), Expect = 4.035e-52
Identity = 104/256 (40.62%), Postives = 149/256 (58.20%), Query Frame = 2
Query: 5984 SANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNVKAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTERSSRFQYFVV-------DPMVEYNMPNFVLQEFKVTDARDGQS----RTVRQFQFTEWPEQGVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIALERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNS 6718
            ++NL +NR KNR  N++ Y+ +RI LQ I G  GSDYINA+YIDGY+   AYIATQ PL  T  DFWRM+WE  +  IVM+TKL E  R KC +YWP + +  +    +         +  Y +  F++     +++ +  S    R +RQ+QFT WP+ GVP       + F+ ++        +  PI VHCSAGVGRTG F+ +   LER+++E  +D+F  V  +R QR  MVQ+E+QY F +    D V +
Sbjct: 1509 NSNLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAYIATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTESYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQYQFTAWPDHGVPDNPM-PLLMFLKRIRAGNPLSSR--PIIVHCSAGVGRTGAFIVIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVRA 1761          

HSP 4 Score: 65.4698 bits (158), Expect = 6.944e-10
Identity = 30/31 (96.77%), Postives = 31/31 (100.00%), Query Frame = 3
Query: 6369 MLEMDSLELLDSFSLQSGRNREYRIKLLKHL 6461
            MLEMDSLELLDSFSLQSGRN+EYRIKLLKHL
Sbjct: 1924 MLEMDSLELLDSFSLQSGRNKEYRIKLLKHL 1954          
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Planmine SMEST
Match: SMESG000068618.1 (SMESG000068618.1)

HSP 1 Score: 1065.06 bits (2753), Expect = 0.000e+0
Identity = 535/551 (97.10%), Postives = 537/551 (97.46%), Query Frame = 2
Query:  131 MKQIEXXXXXXXXXXXXXXSCQTSGQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLRQQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTSV 1783
            MKQIEFFSIFLFLDFFLHFSCQTSGQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLRQQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIR             +SPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLP S+
Sbjct:    1 MKQIEFFSIFLFLDFFLHFSCQTSGQSPAMITEHPLDTTAQAGFFIFLICKAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLRQQVQMDNNNDVVQCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKIRCEVSADPSAKVTWIKNSHEKVDSNNERFQVVGTGSLTIKNVRETDGGSYECMATNKVGTVISQSGMLQIR-------------QSPMTPQIVDFKSKIEVSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTIHLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSAVIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESKKVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTDLFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQDTPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPNSL 538          
The following BLAST results are available for this feature:
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTPRD2.365e-10465.64protein tyrosine phosphatase receptor type D [Sour... [more]
PTPRD4.595e-7267.05protein tyrosine phosphatase receptor type D [Sour... [more]
PTPRD2.365e-10465.64protein tyrosine phosphatase receptor type D [Sour... [more]
PTPRD2.365e-10465.64protein tyrosine phosphatase receptor type D [Sour... [more]
PTPRD4.595e-7267.05protein tyrosine phosphatase receptor type D [Sour... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptp-32.024e-6651.98Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-39.550e-3951.98Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-35.320e-6651.98Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-33.612e-6651.98Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-32.449e-6651.98Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lar6.915e-9264.42gene:FBgn0000464 transcript:FBtr0081260[more]
Lar2.447e-6564.42gene:FBgn0000464 transcript:FBtr0331241[more]
Lar9.449e-9264.42gene:FBgn0000464 transcript:FBtr0112800[more]
Lar8.919e-6564.42gene:FBgn0000464 transcript:FBtr0331240[more]
Lar2.669e-6564.42gene:FBgn0000464 transcript:FBtr0331242[more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprsa4.692e-8063.94protein tyrosine phosphatase receptor type Sa [Sou... [more]
ptprsa1.295e-9066.50protein tyrosine phosphatase receptor type Sa [Sou... [more]
ptprfa1.721e-9566.33protein tyrosine phosphatase receptor type Fa [Sou... [more]
ptprfa3.162e-9366.33protein tyrosine phosphatase receptor type Fa [Sou... [more]
ptprfa1.721e-9566.33protein tyrosine phosphatase receptor type Fa [Sou... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
brdt7.076e-9633.19bromodomain, testis-specific [Source:Xenbase;Acc:X... [more]
brdt4.987e-9433.10bromodomain, testis-specific [Source:Xenbase;Acc:X... [more]
brdt1.593e-9533.25bromodomain, testis-specific [Source:Xenbase;Acc:X... [more]
brdt1.883e-9633.48bromodomain, testis-specific [Source:Xenbase;Acc:X... [more]
brdt9.748e-9633.22bromodomain, testis-specific [Source:Xenbase;Acc:X... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptprs3.460e-7040.20protein tyrosine phosphatase, receptor type, S [So... [more]
Ptprd4.521e-10665.64protein tyrosine phosphatase, receptor type, D [So... [more]
Ptprd5.593e-10565.64protein tyrosine phosphatase, receptor type, D [So... [more]
Ptprd1.089e-7265.64protein tyrosine phosphatase, receptor type, D [So... [more]
Ptprd3.824e-7265.64protein tyrosine phosphatase, receptor type, D [So... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase S vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q64487|PTPRD_MOUSE3.912e-10465.64Receptor-type tyrosine-protein phosphatase delta O... [more]
sp|P23468|PTPRD_HUMAN1.136e-10365.64Receptor-type tyrosine-protein phosphatase delta O... [more]
sp|A7MBJ4|PTPRF_BOVIN1.824e-9268.02Receptor-type tyrosine-protein phosphatase F OS=Bo... [more]
sp|A2A8L5|PTPRF_MOUSE8.722e-9467.85Receptor-type tyrosine-protein phosphatase F OS=Mu... [more]
sp|F1NWE3|PTPRS_CHICK8.232e-6765.13Receptor-type tyrosine-protein phosphatase S OS=Ga... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase S vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7NQE60.000e+036.86Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A4Y2FZ720.000e+035.44Tyrosine-protein phosphatase Lar OS=Araneus ventri... [more]
A0A4Y2FW630.000e+035.34Tyrosine-protein phosphatase Lar OS=Araneus ventri... [more]
A0A0V1BCC00.000e+033.29Tyrosine-protein phosphatase Lar-like OS=Trichinel... [more]
V4BDH75.449e-9334.10Uncharacterized protein (Fragment) OS=Lottia gigan... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprsa2.471e-6641.44protein tyrosine phosphatase receptor type S [Sour... [more]
PTPRD1.429e-6966.77protein tyrosine phosphatase receptor type D [Sour... [more]
PTPRD4.838e-9766.77protein tyrosine phosphatase receptor type D [Sour... [more]
PTPRD1.501e-9766.77protein tyrosine phosphatase receptor type D [Sour... [more]
PTPRD4.016e-9768.46protein tyrosine phosphatase receptor type D [Sour... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptpra2.658e-17645.91protein tyrosine phosphatase receptor type A [Sour... [more]
ptprsa4.428e-16455.10protein tyrosine phosphatase receptor type Sa [Sou... [more]
ca16b4.839e-12338.36carbonic anhydrase XVI b [Source:ZFIN;Acc:ZDB-GENE... [more]
ptprk5.000e-11336.77protein tyrosine phosphatase receptor type K [Sour... [more]
ENSPMAT00000002738.15.156e-11336.71pep scaffold:Pmarinus_7.0:GL477626:22501:55781:-1 ... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
PTP12.096e-3434.83Phosphotyrosine-specific protein phosphatase; deph... [more]
PTP22.032e-1827.58Nuclear phosphotyrosine-specific phosphatase invol... [more]
PTP34.889e-930.47Phosphotyrosine-specific protein phosphatase; invo... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO469611.016e-6953.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438540.000e+049.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453820.000e+047.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481878.855e-17046.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO450815.828e-15441.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprsa1.589e-6541.52receptor-type tyrosine-protein phosphatase S [Sour... [more]
PTPRD2.435e-10065.64receptor-type tyrosine-protein phosphatase delta [... [more]
PTPRD1.166e-6965.64receptor-type tyrosine-protein phosphatase delta [... [more]
PTPRD3.230e-10067.68receptor-type tyrosine-protein phosphatase delta [... [more]
PTPRD1.231e-7264.99receptor-type tyrosine-protein phosphatase delta [... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase S vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068618.13.517e-5298.56SMESG000068618.1[more]
SMESG000068618.13.984e-5298.23SMESG000068618.1[more]
SMESG000068618.14.783e-5298.68SMESG000068618.1[more]
SMESG000068618.14.035e-5287.26SMESG000068618.1[more]
SMESG000068618.10.000e+097.10SMESG000068618.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022812 ID=SMED30022812|Name=Receptor-type tyrosine-protein phosphatase S|organism=Schmidtea mediterranea sexual|type=transcript|length=7004bp
TTTTCAACAGAAATAATATATTATCAATCCATTGTTTTGTGAACATTAAG
AAAAATAAATATTACTACTGGAATTTTTCCAATCCAACGAGTTCAACAGT
TCAAATTAAGAGTTAGACACGAAACCCCAGATGAAACAGATTGAATTTTT
CTCTATTTTTCTGTTTTTGGATTTTTTTCTTCATTTTTCATGTCAGACAA
GTGGACAAAGTCCAGCAATGATTACTGAACACCCATTGGATACGACTGCG
CAAGCGGGATTTTTTATTTTTCTCATTTGCAAGGCTCAGGGCAATCCGAA
ACCAACGGTGCAATTTAAGATCAATGGCAAGGTTCAAAGCAATGATTCCC
ATCGGAAAATTATACGTTCTTTTGACTTTGGAGCCTCTTTACGACAACAA
GTTCAAATGGACAACAACAATGACGTTGTCCAGTGCATTGCAGAAAACCA
TTTAGGAGTTGACACCAAATCTGCCACAATAACTGTAATAGATTCTAACG
CTGAAGTACCAGCCGGATTTCCCATCATAACATCAGGTCCAATTGACGTC
CTAAGTCAGTTTGGGAAAATTGCTAAAATCAGATGTGAAGTCTCAGCTGA
TCCCTCGGCAAAAGTGACTTGGATTAAAAATTCACACGAAAAGGTTGATT
CAAACAATGAAAGATTTCAAGTAGTCGGAACTGGATCATTGACAATAAAA
AATGTTCGAGAAACGGATGGTGGAAGTTATGAATGCATGGCGACGAATAA
AGTTGGAACAGTCATCAGCCAGTCAGGGATGCTACAAATACGACGAAATC
TTACATCTGCTCTTCATTATATGAAGGAAAAAGAATCTCCAATGACTCCT
CAGATAGTCGATTTCAAATCAAAAATTGAGGTTTCAACTGGACAAGGAGC
TAATCTAACTTGTAACGCTGAAGGATCCCCTATTCCCTTGGTACATTGGG
AAGTCCAAATAGGTAATCCAAATAGTCCAAATCCTGAAAACCGACCACTT
GGTGATGAGCAACCATCATCAAGTACAATTCATCTCACTGATATTACAGA
ATCTGGTTCCTATGTTTGTCATGCAAAAAACAAAATGGGTCTTATCAAAA
AGGAAGCTCAAATAATTGTAAAAAAAAAACCAATGGCTCCAACTTTAGTC
AGCTACAGCAAAGTCGAAGCCACATCTGCAGTCATTGAATGGCTACCAGT
AAAATCCAATCCACCAATTGACTCATACACTTTACTTATTAAAGATACTT
CCAACAAAGATCCTCATTTAGGTCTCAGACAAATTGCGAATCTATACTTT
CCTCCGCAAAAGTTGTCGTCAGAATCTAAAAAGGTTTCTTTTCAAATTAC
AGAATTGAAAGCCTACACAAACTACGAAGTTCAAGTCGTTGCTGTTAGTA
ATAATATCGGCAATTCGGATCCAAGTTTACCAATACGTTTTCAAACTTTA
GAACTACCCCCAAGTTCACCTCCAACCGATCTGTTTGCTAAAGCAATTTC
TCCGGACTCCATTAAAGTTACCTGGAAGCCCCCACTCCAACAAAATGGTA
GAATAAAGGGTTACCGACTATATTACACAGAAAGATTGTGGTCTGCCATT
GATAATTGGCATATTCGAGAAGTTCAAGATACCCCTTACTATTTAAACAA
CTTAATACACAATGCCACTTATTATGTCAAGGTAAATGCCTATAATCTTG
CCGGAGACGGTCCAGTTAGTGATGCGTTTCCGATTCTCGTGGTAGTTGGA
GGAGATTTTGTGAAAACACTGCCTACATCAGTGCCTCCAGTTCCACAGAA
TCTTCGTGGAGCGTCACTATCAACCACTTCAATTCAAATAATGTGGACAC
ATCCTGCAATGGTTGATGACCATAAATTAGAAGGCTATGAATTAAAATAC
AGACTTGATGGCGATGAAAAAGGAAAGATGTTCAAAGAGCATATTGAGCC
TTATCAAACTCAGTATTTGATTGACAATCTTAAGCCCGGGAAAGCTTATC
ACATAAGTCTAGCTGGTAAAACAAAATTTGGAGTAGGAGTATCAGCACAA
CTTACCGAAACCACTAAAGATGAGAATATTTTAAATGAGATTTCAAATTT
AAAAATCTGGGGAACAAATATTTCCAAAGATTCGGCAACTATTTGTTGGA
AAATGAATTTGGATGAAAGTAAAATTGCCCTCACTCATCGGATTAGTTAT
ATGTTGATTTTTGATATTTCCGAATTGAAATCGACTTCCGAAAATGCAAC
AAATTTGATAACGGATACGCAATGTTGTTGTCACGTCTTGACGCATTTGA
GACCGGACTCCGGCTACGACTTGTGGGTAAAACCTATACCCAATACGGAT
GATAATAACTTGAATATCGTTTTAAAAGATTTAACATCATCGAAATTGTT
CATTTCTACAGTGGACAACGATTCAGTTCCGGATAAACCGGAAGCAGTCT
CGATAAAAGTGATCAATTCAACTTCATCAAAGATTTCATGGAAAGGTCCA
ATGAAAACTCTAGATCAGGTCAAATATTACATCATTGAATGGCGGGAACT
TAGTAACAAGTCAAAAAACTCCAAAGTTTTCAATGTAACTGTTGATATAA
ATAAATCTAATCCAAATAATGTTTATGAGCATATCTTGAATAATTTATTG
CCGAACAAGTATTATAAAATCGAGGTACTTGCTGCCAGTAGAAAGGGTAA
AGGGTCACCAGAAAAGTTTGAGATAATAAAAACTCATGGAAATTTTAAAG
TTCCATCAATGCCCCGAGAACTAAGAATGACGCAATCAGTAAAGATTCCA
TCTTTTAAAGGTCCAAAACGTCTTGCAGTTTACTTGGCGTGGAATCCGCC
GCAGATAAGCCATGGTTTGATTCTGGGCTACCGAGTTGCTATATCTCTTA
TTGGTCCCCCAGAATTTGTAAAAGAATTAAAACCTGTTAAGATTTATAGA
AACGTCTCAACGGAAACATATAAAAGTGATGAAGAAGCGAAAATAGGACC
CGGGAAAACTTATCTATTTGAAGTTCAAGCTTTGAATAGCGTCAATTTTG
GAGAAACTGCAAGGATCAACTATACAATTCCGGAAGAAAGACCATCTGCT
CCACCGAATAAGTTAGAAATTCAAGGTGAAAAGAAAACTGTGACATTGAA
ATGGCACCCCCCTCCGATTGATTACAGAAATGGCATCATAACTAAATATA
AGATTCAATATTTTGATATGAAAGAACCAGTTTTAACCTTAAAAGAAACT
GAAACAGAATCAAAAACCACAGAAATGATTACGAATCTACAAGAAAATAC
TAATTATGTATTCAAGATCCGAGCTGTGAATAAAGAGGGCGATGGACCTT
GGAGCCCCGGTACCCCATATTACATATCATCAGAATTCTTTCCTGCTCCT
GAAAACATAGAAACTAAAGCCCTAAATGATTATCAAATTAAAGTCTCCTG
GAACTTCCCAGAAAAAGCAAATCAAGTGACTGATTTGCTAAGCCAGGTCA
ATGGGTTTCATGTCCAAGTGTCTACCAATAGAGACTTTCCAGACGGTAAA
ATAACGTTTAAAAAGATTGTCGGACCTTTCACCTCAACAGTTATGGAAAA
GATCTATCCCAATCATTATTTTATTCGGGTTCAAGCCATTATTCGAGATA
AACGAATAGCCGAATGGAGCAATATCCACACGTTGACTGTGTTTAAGTCC
AAGTACACTGAACGAAACATTAAAGGCCTTAACTGCATTGGGCAGACGAA
TTCTATCAAGGTTACCTGGGAAAAACCAGATGATTACACCGAAATTAAAT
CCTTTCTTATAGAACTCTCGGGATATCGGAAATTCAGAAATATTTATGGA
GCGTACAAAATTGAGAAAATCAAAGCCAGAACTTCAAGAATAGAGTTCTT
TGGAGAAGAGCAATCGACTTACAATTACTCTATTCCAAATCTCGAACCTA
ATACCAATTATGATCTTTCAATTAAAATTTTGTATTCCAGTATTTCTAAG
CTTGAAAGTATCTCAAAAACTACAAGTTGTGTTACTTTAATGGAACAGCC
AAAGTCAATTTTATCCCCAATGCCGGTTCCTCTAAGAAAAGTTTCAAACG
AAATAATTCTTAGACTTTCTAGAACAAACGAGATACTTGGGATGATTAGC
CATTATTATCTAATTGTTAGCCCAATAAAAGAGACACATGTCACTCCTCA
TGATGTTAATATTGATGAGACCTTTACTCAAACGAAGAATTTAAAAGCCA
TGAATTCAAGATATGTGGCCGCTCAATTCACTCCAGCTCTTTTCAGATCC
AAAAGCTACGTTGATTTTGTTCTCGGTTCCAATAGTCCGATCGAATCGTT
TCACTCAAATGATTGGATTTTTTTGAAAAGACTTCCTGTAAAAAAGAAAA
CAAATTTAAAAGCATTTCTTAGAGCTTGTGTCATTCCAGAAGGTTTAACT
TCAGACCTTAAATCCATTCCTGTCGAGAGATGTACGAGTAGCGAATGGTC
AATGACATTTAGCACAGACATCAATAGAGAAATTCAAGTATTTACAGCAG
CAGTAATAGCTGGTATTGGCAGTATCGTCTTTTTAGTATTTATTTGCATT
GGATTTGCCTGTTTTTTGAAAAGAAGCCATAGCAAAATCAGCAGACCCTT
GGGTTCCACAGATCCTTGCCTTAAGCAACCATTAATGATGCAACCTGGTT
TAAGTGGTGGAAATTTACCTCAATACACGAATATTGTTAATATCGGTAAC
AGTAGCCGGCATGGATACACAGATAGTTTACGGACAAATTCTGATCTTTG
CGCCACATCCGGGGTGATGACACCAATAAATAACCACCAACCCCTTTCGG
TTTCTAATCCAATGTTTGAACAACGATCTTTAGAATTAAAAAAAATATCA
AATACTCAAGCGCCAGATTTGGTCCAGAATGCTTTGTCTATTAGCAACTC
GGTTCGACCTCCAATACCTGTACACAGACTGGAATCACAAATTAACGAAT
TAAGAGCAAACGACAATTTTCTTTTTAGTCAGGAATATGAATCCATTGAC
CCTGGCCAACAATTTACATGGGAGAATTCCAACCTCGAAATAAATCGGGC
AAAGAATCGCTATGCCAATGTAATTGCATACGATCATAGTAGGATTCTCT
TACAATATATAAATGGTGTTCTCGGTTCAGATTATATTAATGCAAATTAT
ATTGACGGTTATAAGCGTCCTAATGCGTATATTGCAACACAAGGTCCTTT
ATCTAATACTTTTGGTGATTTTTGGAGAATGGTATGGGAGCAAGGAACAG
CTTCAATTGTCATGATGACAAAACTGGAGGAAAGAACAAGAATCAAATGC
GATCAGTATTGGCCAAATAAAGGAACGGAATCGTATGCCGATGGAGCGAT
TACCGTTACCATTACTGACACAAAAGAATTAGCGTATTACACAATTAGAA
CCTTCATTATTTCCGCGAATTATTCGTCAAACTCATCAGAATTCTGCTCA
AACAAAGACAAACGAGAAATCCGGCAATATCAGTTCACAGCTTGGCCCGA
TCACGGAGTTCCAGATAATCCTATGCCTTTACTTATGTTCCTCAAACGTA
TTCGAGCTGGAAATCCACTCAGTTCTAGACCGATTATTGTTCATTGTTCC
GCTGGGGTTGGAAGGACTGGGGCCTTTATTGTCATCGATACAACTTTGGA
GAGAATAAGACATGAAATGACAGTTGACATATTTGGTCAAGTGTCAATTA
TGCGAGCTCAAAGAAATTACATGGTGCAAACAGAGGATCAATATGTATTT
GTTCATGAGGTAGTGCTGGATGCGGTGAGAGCAAGCAATACAGAGGTTTC
TTTGCAAAATATCTCGACCCATGTTCAAAAATTGATGCGAGCTGATTGCA
CAACAGGCACACAACGAGCGACTGGAATTGAGTTGGAATTTCAAAAGCTA
TCCCAATTCAAACCCAACAATGCCAGGTGCACAAGTGCCAATCTTCCTGT
CAATCGATTGAAAAATCGATTAGTAAACATTCTCCCATATGAGTTCAATC
GCATTTGTTTACAGCCGATTAGAGGCTGTGAAGGATCGGATTATATCAAT
GCAAGCTATATTGATGGCTATCAAAATGTCAAAGCTTATATAGCTACTCA
AGCACCTCTAATGGAAACTATTGAAGACTTTTGGAGAATGATATGGGAAC
ACAATAGTACTATAATTGTTATGCTTACAAAACTCCGTGAAATGGGCAGG
GAAAAATGTCATCGGTACTGGCCTACAGAACGTTCATCAAGATTCCAATA
TTTTGTAGTTGATCCTATGGTTGAATATAACATGCCAAATTTTGTTTTAC
AAGAATTTAAAGTTACAGATGCTAGAGATGGACAGTCTAGAACTGTTAGA
CAGTTTCAGTTTACAGAGTGGCCGGAACAGGGAGTACCGTATCAAGCTAC
TGAAGCATTTATAGAATTCATTGGTCAGGTTCATAAAACCAAAGAGCAAT
TCGGACAAGAGGGCCCCATTACTGTTCACTGCAGTGCTGGTGTTGGAAGA
ACCGGGGTATTTCTAGCGTTGAGTATTGCTCTTGAACGCTTGAAGAATGA
AGGAGTTTTGGATTTGTTTCAAGTGGTTCGAGCACTTCGGTATCAAAGAG
CTAACATGGTGCAATCAGAAGAGCAATACCGGTTTTGTTATTTAGCCGCC
CAAGATTATGTGAATTCCTTCGATAGTTTTTTTGAATAATTTCACGAAAT
TCATTTCAAATCCTTTTTCAAATCCGACTCGTTGTAATTTTTCTTTCTCT
TCGTTCCTGGACAGATATCAGATAATTCGTGTAATTTACTGCTAAATAGA
TCTTATTAATATTTAATATTCGACCAAATCATTATGAATTTTTTAATGAT
GGAAGTTGTGATGCTTTTTCTTTCCGGTTTCTAGTACGATTTGGTGATTT
TGTGGACTGTTTGGACGTTAATTTAGAAGTGAAGAAGCATTTATCAGGTT
GTGC
back to top

protein sequence of SMED30022812-orf-1

>SMED30022812-orf-1 ID=SMED30022812-orf-1|Name=SMED30022812-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2203bp
MKQIEFFSIFLFLDFFLHFSCQTSGQSPAMITEHPLDTTAQAGFFIFLIC
KAQGNPKPTVQFKINGKVQSNDSHRKIIRSFDFGASLRQQVQMDNNNDVV
QCIAENHLGVDTKSATITVIDSNAEVPAGFPIITSGPIDVLSQFGKIAKI
RCEVSADPSAKVTWIKNSHEKVDSNNERFQVVGTGSLTIKNVRETDGGSY
ECMATNKVGTVISQSGMLQIRRNLTSALHYMKEKESPMTPQIVDFKSKIE
VSTGQGANLTCNAEGSPIPLVHWEVQIGNPNSPNPENRPLGDEQPSSSTI
HLTDITESGSYVCHAKNKMGLIKKEAQIIVKKKPMAPTLVSYSKVEATSA
VIEWLPVKSNPPIDSYTLLIKDTSNKDPHLGLRQIANLYFPPQKLSSESK
KVSFQITELKAYTNYEVQVVAVSNNIGNSDPSLPIRFQTLELPPSSPPTD
LFAKAISPDSIKVTWKPPLQQNGRIKGYRLYYTERLWSAIDNWHIREVQD
TPYYLNNLIHNATYYVKVNAYNLAGDGPVSDAFPILVVVGGDFVKTLPTS
VPPVPQNLRGASLSTTSIQIMWTHPAMVDDHKLEGYELKYRLDGDEKGKM
FKEHIEPYQTQYLIDNLKPGKAYHISLAGKTKFGVGVSAQLTETTKDENI
LNEISNLKIWGTNISKDSATICWKMNLDESKIALTHRISYMLIFDISELK
STSENATNLITDTQCCCHVLTHLRPDSGYDLWVKPIPNTDDNNLNIVLKD
LTSSKLFISTVDNDSVPDKPEAVSIKVINSTSSKISWKGPMKTLDQVKYY
IIEWRELSNKSKNSKVFNVTVDINKSNPNNVYEHILNNLLPNKYYKIEVL
AASRKGKGSPEKFEIIKTHGNFKVPSMPRELRMTQSVKIPSFKGPKRLAV
YLAWNPPQISHGLILGYRVAISLIGPPEFVKELKPVKIYRNVSTETYKSD
EEAKIGPGKTYLFEVQALNSVNFGETARINYTIPEERPSAPPNKLEIQGE
KKTVTLKWHPPPIDYRNGIITKYKIQYFDMKEPVLTLKETETESKTTEMI
TNLQENTNYVFKIRAVNKEGDGPWSPGTPYYISSEFFPAPENIETKALND
YQIKVSWNFPEKANQVTDLLSQVNGFHVQVSTNRDFPDGKITFKKIVGPF
TSTVMEKIYPNHYFIRVQAIIRDKRIAEWSNIHTLTVFKSKYTERNIKGL
NCIGQTNSIKVTWEKPDDYTEIKSFLIELSGYRKFRNIYGAYKIEKIKAR
TSRIEFFGEEQSTYNYSIPNLEPNTNYDLSIKILYSSISKLESISKTTSC
VTLMEQPKSILSPMPVPLRKVSNEIILRLSRTNEILGMISHYYLIVSPIK
ETHVTPHDVNIDETFTQTKNLKAMNSRYVAAQFTPALFRSKSYVDFVLGS
NSPIESFHSNDWIFLKRLPVKKKTNLKAFLRACVIPEGLTSDLKSIPVER
CTSSEWSMTFSTDINREIQVFTAAVIAGIGSIVFLVFICIGFACFLKRSH
SKISRPLGSTDPCLKQPLMMQPGLSGGNLPQYTNIVNIGNSSRHGYTDSL
RTNSDLCATSGVMTPINNHQPLSVSNPMFEQRSLELKKISNTQAPDLVQN
ALSISNSVRPPIPVHRLESQINELRANDNFLFSQEYESIDPGQQFTWENS
NLEINRAKNRYANVIAYDHSRILLQYINGVLGSDYINANYIDGYKRPNAY
IATQGPLSNTFGDFWRMVWEQGTASIVMMTKLEERTRIKCDQYWPNKGTE
SYADGAITVTITDTKELAYYTIRTFIISANYSSNSSEFCSNKDKREIRQY
QFTAWPDHGVPDNPMPLLMFLKRIRAGNPLSSRPIIVHCSAGVGRTGAFI
VIDTTLERIRHEMTVDIFGQVSIMRAQRNYMVQTEDQYVFVHEVVLDAVR
ASNTEVSLQNISTHVQKLMRADCTTGTQRATGIELEFQKLSQFKPNNARC
TSANLPVNRLKNRLVNILPYEFNRICLQPIRGCEGSDYINASYIDGYQNV
KAYIATQAPLMETIEDFWRMIWEHNSTIIVMLTKLREMGREKCHRYWPTE
RSSRFQYFVVDPMVEYNMPNFVLQEFKVTDARDGQSRTVRQFQFTEWPEQ
GVPYQATEAFIEFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIA
LERLKNEGVLDLFQVVRALRYQRANMVQSEEQYRFCYLAAQDYVNSFDSF
FE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0000428musculature system
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR036116FN3_sf
IPR000242PTPase_domain
IPR003599Ig_sub
IPR003595Tyr_Pase_cat
IPR003598Ig_sub2
IPR003961FN3_dom
IPR013783Ig-like_fold
IPR029021Prot-tyrosine_phosphatase-like
IPR013098Ig_I-set
IPR016130Tyr_Pase_AS
IPR007110Ig-like_dom
IPR000387TYR_PHOSPHATASE_dom
IPR016061Pro-tRNA_ligase_II_C
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
GO:0016311dephosphorylation
GO:0006433prolyl-tRNA aminoacylation
GO:0035335peptidyl-tyrosine dephosphorylation
Vocabulary: molecular function
TermDefinition
GO:0004725protein tyrosine phosphatase activity
GO:0005515protein binding
GO:0016791phosphatase activity
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0004827proline-tRNA ligase activity
GO:0004721phosphoprotein phosphatase activity
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000242PTP type protein phosphatasePRINTSPR00700PRTYPHPHTASEcoord: 1807..1825
score: 72.66
coord: 1673..1693
score: 69.05
coord: 1854..1864
score: 64.49
coord: 1768..1785
score: 54.38
coord: 1657..1664
score: 79.71
coord: 1838..1853
score: 39.67
IPR000242PTP type protein phosphataseSMARTSM00194PTPc_3coord: 1905..2168
e-value: 2.2E-125
score: 432.5
coord: 1604..1873
e-value: 9.5E-120
score: 413.8
IPR000242PTP type protein phosphatasePFAMPF00102Y_phosphatasecoord: 1628..1869
e-value: 6.1E-80
score: 268.2
coord: 1931..2163
e-value: 1.2E-78
score: 263.9
IPR000242PTP type protein phosphatasePROSITEPS50055TYR_PHOSPHATASE_PTPcoord: 1605..1871
score: 58.098
IPR000242PTP type protein phosphatasePROSITEPS50055TYR_PHOSPHATASE_PTPcoord: 1906..2166
score: 58.172
NoneNo IPR availablePRINTSPR00014FNTYPEIIIcoord: 445..455
score: 34.17
coord: 432..441
score: 41.01
coord: 578..596
score: 25.8
coord: 1032..1046
score: 42.08
NoneNo IPR availablePFAMPF13927Ig_3coord: 104..179
e-value: 8.3E-14
score: 51.9
NoneNo IPR availablePANTHERPTHR19134:SF203RECEPTOR-TYPE TYROSINE-PROTEIN PHOSPHATASE Fcoord: 126..1003
coord: 1514..2166
coord: 928..1102
NoneNo IPR availablePANTHERPTHR19134PROTEIN-TYROSINE PHOSPHATASEcoord: 126..1003
coord: 1514..2166
coord: 928..1102
NoneNo IPR availableCDDcd00096Igcoord: 121..184
e-value: 1.82823E-15
score: 70.734
NoneNo IPR availableCDDcd14553R-PTPc-LAR-1coord: 1626..1872
e-value: 1.73131E-154
score: 474.192
NoneNo IPR availableCDDcd14554R-PTP-LAR-2coord: 1926..2163
e-value: 2.28994E-154
score: 473.935
NoneNo IPR availableTMHMMTMhelixcoord: 1447..1469
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 8..93
e-value: 57.0
score: 4.9
coord: 219..304
e-value: 1.0E-6
score: 38.3
coord: 110..194
e-value: 2.0E-8
score: 44.0
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 116..182
e-value: 7.2E-10
score: 48.8
coord: 225..293
e-value: 2.7E-5
score: 33.6
IPR003961Fibronectin type IIISMARTSM00060FN3_2coord: 307..402
e-value: 6.0E-9
score: 45.7
coord: 740..831
e-value: 1.1E-7
score: 41.6
coord: 525..609
e-value: 5.6E-9
score: 45.8
coord: 418..500
e-value: 3.9E-11
score: 53.0
coord: 1060..1150
e-value: 25.0
score: 8.1
coord: 961..1045
e-value: 1.6E-11
score: 54.3
coord: 1167..1262
e-value: 5.9
score: 13.5
coord: 626..716
e-value: 35.0
score: 6.8
coord: 857..947
e-value: 17.0
score: 9.6
IPR003961Fibronectin type IIIPFAMPF00041fn3coord: 964..1048
e-value: 6.4E-14
score: 52.1
coord: 741..833
e-value: 6.8E-11
score: 42.4
coord: 309..399
e-value: 2.7E-9
score: 37.3
coord: 419..502
e-value: 7.5E-12
score: 45.4
coord: 527..607
e-value: 5.2E-11
score: 42.7
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 742..844
score: 16.142
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 420..513
score: 20.41
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 527..622
score: 15.89
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 859..961
score: 7.922
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 626..736
score: 6.991
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 1062..1163
score: 9.744
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 309..415
score: 15.345
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 1166..1280
score: 6.872
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 964..1058
score: 20.126
IPR003961Fibronectin type IIICDDcd00063FN3coord: 873..948
e-value: 0.00161115
score: 37.8611
IPR003961Fibronectin type IIICDDcd00063FN3coord: 419..508
e-value: 3.02755E-16
score: 74.0699
IPR003961Fibronectin type IIICDDcd00063FN3coord: 1061..1160
e-value: 0.00999856
score: 35.5499
IPR003961Fibronectin type IIICDDcd00063FN3coord: 525..618
e-value: 8.65366E-13
score: 64.0547
IPR003961Fibronectin type IIICDDcd00063FN3coord: 307..412
e-value: 2.43115E-12
score: 62.8991
IPR003961Fibronectin type IIICDDcd00063FN3coord: 961..1049
e-value: 7.52911E-15
score: 69.8327
IPR003961Fibronectin type IIICDDcd00063FN3coord: 740..841
e-value: 2.7801E-11
score: 59.8175
IPR003595Protein-tyrosine phosphatase, catalyticSMARTSM00404ptp_7coord: 1769..1870
e-value: 3.7E-40
score: 149.4
coord: 2061..2165
e-value: 9.5E-41
score: 151.4
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 732..847
e-value: 3.6E-14
score: 54.9
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 1175..1283
e-value: 1.1E-5
score: 27.5
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 410..510
e-value: 3.2E-24
score: 87.3
coord: 304..409
e-value: 1.1E-12
score: 50.1
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 1061..1160
e-value: 2.8E-5
score: 26.3
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 952..1057
e-value: 2.5E-21
score: 77.8
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 97..203
e-value: 5.4E-21
score: 76.5
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 210..303
e-value: 3.4E-14
score: 55.0
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 516..624
e-value: 4.2E-15
score: 57.8
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 848..951
e-value: 2.0E-6
score: 30.0
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 1..94
e-value: 9.3E-11
score: 43.8
IPR013098Immunoglobulin I-setPFAMPF07679I-setcoord: 4..92
e-value: 3.2E-5
score: 23.9
coord: 213..303
e-value: 1.3E-9
score: 38.0
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 1880..2174
e-value: 1.4E-110
score: 371.3
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 1578..1879
e-value: 4.5E-113
score: 379.5
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 1584..1872
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 1900..2170
IPR016130Protein-tyrosine phosphatase, active sitePROSITEPS00383TYR_PHOSPHATASE_1coord: 1810..1820
IPR016130Protein-tyrosine phosphatase, active sitePROSITEPS00383TYR_PHOSPHATASE_1coord: 2105..2115
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 1..91
score: 7.232
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 104..198
score: 13.366
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 213..302
score: 11.479
IPR000387Tyrosine specific protein phosphatases domainPROSITEPS50056TYR_PHOSPHATASE_2coord: 2081..2157
score: 21.725
IPR000387Tyrosine specific protein phosphatases domainPROSITEPS50056TYR_PHOSPHATASE_2coord: 1791..1862
score: 19.852
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 2..94
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 104..193
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 213..310
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 1061..1159
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 739..949
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 1179..1346
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 872..1053
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 306..507
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 524..707