Calcyphosin protein

Overview
NameCalcyphosin protein
Smed IDSMED30022806
Length (bp)1387
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calcyphosin protein (SMED30022806) t-SNE clustered cells

Violin plots show distribution of expression levels for Calcyphosin protein (SMED30022806) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calcyphosin protein (SMED30022806) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calcyphosin protein (SMED30022806) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022806

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30022806h1SMcG0018773 SmedASXL_071629SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30022806h1SMcG0018773 SmedASXL_012746SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30022806h1SMcG0018773 Contig46115uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022806h1SMcG0018773 Contig46115newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30022806h1SMcG0018773 dd_Smed_v4_4512_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30022806h1SMcG0018773 dd_Smed_v4_4512_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30022806h1SMcG0018773 dd_Smed_v4_4512_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022806h1SMcG0018773 dd_Smed_v4_4512_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022806h1SMcG0018773 dd_Smed_v4_4512_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30022806h1SMcG0018773 dd_Smed_v4_4512_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30022806h1SMcG0018773 dd_Smed_v4_4512_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30022806h1SMcG0018773 dd_Smed_v4_4512_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022806h1SMcG0018773 dd_Smed_v4_9521_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022806h1SMcG0018773 dd_Smed_v4_9521_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30022806h1SMcG0018773 dd_Smed_v6_4512_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30022806h1SMcG0018773 dd_Smed_v4_4512_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calcyphosin protein vs. Ensembl Human
Match: CAPSL (calcyphosine like [Source:HGNC Symbol;Acc:HGNC:28375])

HSP 1 Score: 236.113 bits (601), Expect = 2.921e-75
Identity = 122/206 (59.22%), Postives = 164/206 (79.61%), Query Frame = 3
Query:  447 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            MA T R +RE+ +++K+KL +A+DP+E+LRLQCLARG+ GIKGLGR F+I DDD N TLDF+EF KG+NDY   + KEEV+ +F   DKD +GT+DF+EFL+ LRPPM+++R  +++QAF KLDKT DG +T+EDL+ VYN   HPKY +GE +EE++F +FL NF++P + DG VT EEF+NYY+GVSASID D YF +MMR A+
Sbjct:    1 MAGTARHDREMAIQAKKKLTTATDPIERLRLQCLARGSAGIKGLGRVFRIMDDDNNRTLDFKEFMKGLNDYAVVMEKEEVEELFRRFDKDGNGTIDFNEFLLTLRPPMSRARKEVIMQAFRKLDKTGDGVITIEDLREVYNAKHHPKYQNGEWSEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSASIDTDVYFIIMMRTAW 206          

HSP 2 Score: 48.521 bits (114), Expect = 6.766e-6
Identity = 20/34 (58.82%), Postives = 26/34 (76.47%), Query Frame = 2
Query: 1091 VITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 1192
            ++T  EF+NYY+ VS SID D YF +MMR A+KL
Sbjct:  175 LVTPEEFMNYYAGVSASIDTDVYFIIMMRTAWKL 208          
BLAST of Calcyphosin protein vs. Ensembl Human
Match: CAPSL (calcyphosine like [Source:HGNC Symbol;Acc:HGNC:28375])

HSP 1 Score: 236.113 bits (601), Expect = 2.921e-75
Identity = 122/206 (59.22%), Postives = 164/206 (79.61%), Query Frame = 3
Query:  447 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            MA T R +RE+ +++K+KL +A+DP+E+LRLQCLARG+ GIKGLGR F+I DDD N TLDF+EF KG+NDY   + KEEV+ +F   DKD +GT+DF+EFL+ LRPPM+++R  +++QAF KLDKT DG +T+EDL+ VYN   HPKY +GE +EE++F +FL NF++P + DG VT EEF+NYY+GVSASID D YF +MMR A+
Sbjct:    1 MAGTARHDREMAIQAKKKLTTATDPIERLRLQCLARGSAGIKGLGRVFRIMDDDNNRTLDFKEFMKGLNDYAVVMEKEEVEELFRRFDKDGNGTIDFNEFLLTLRPPMSRARKEVIMQAFRKLDKTGDGVITIEDLREVYNAKHHPKYQNGEWSEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSASIDTDVYFIIMMRTAW 206          

HSP 2 Score: 48.521 bits (114), Expect = 6.766e-6
Identity = 20/34 (58.82%), Postives = 26/34 (76.47%), Query Frame = 2
Query: 1091 VITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 1192
            ++T  EF+NYY+ VS SID D YF +MMR A+KL
Sbjct:  175 LVTPEEFMNYYAGVSASIDTDVYFIIMMRTAWKL 208          
BLAST of Calcyphosin protein vs. Ensembl Human
Match: CAPSL (calcyphosine like [Source:HGNC Symbol;Acc:HGNC:28375])

HSP 1 Score: 236.113 bits (601), Expect = 2.921e-75
Identity = 122/206 (59.22%), Postives = 164/206 (79.61%), Query Frame = 3
Query:  447 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            MA T R +RE+ +++K+KL +A+DP+E+LRLQCLARG+ GIKGLGR F+I DDD N TLDF+EF KG+NDY   + KEEV+ +F   DKD +GT+DF+EFL+ LRPPM+++R  +++QAF KLDKT DG +T+EDL+ VYN   HPKY +GE +EE++F +FL NF++P + DG VT EEF+NYY+GVSASID D YF +MMR A+
Sbjct:    1 MAGTARHDREMAIQAKKKLTTATDPIERLRLQCLARGSAGIKGLGRVFRIMDDDNNRTLDFKEFMKGLNDYAVVMEKEEVEELFRRFDKDGNGTIDFNEFLLTLRPPMSRARKEVIMQAFRKLDKTGDGVITIEDLREVYNAKHHPKYQNGEWSEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSASIDTDVYFIIMMRTAW 206          

HSP 2 Score: 48.521 bits (114), Expect = 6.766e-6
Identity = 20/34 (58.82%), Postives = 26/34 (76.47%), Query Frame = 2
Query: 1091 VITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 1192
            ++T  EF+NYY+ VS SID D YF +MMR A+KL
Sbjct:  175 LVTPEEFMNYYAGVSASIDTDVYFIIMMRTAWKL 208          
BLAST of Calcyphosin protein vs. Ensembl Human
Match: CAPSL (calcyphosine like [Source:HGNC Symbol;Acc:HGNC:28375])

HSP 1 Score: 213.772 bits (543), Expect = 8.804e-67
Identity = 112/190 (58.95%), Postives = 152/190 (80.00%), Query Frame = 3
Query:  447 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSA 1016
            MA T R +RE+ +++K+KL +A+DP+E+LRLQCLARG+ GIKGLGR F+I DDD N TLDF+EF KG+NDY   + KEEV+ +F   DKD +GT+DF+EFL+ LRPPM+++R  +++QAF KLDKT DG +T+EDL+ VYN   HPKY +GE +EE++F +FL NF++P + DG VT EEF+NYY+GVSA
Sbjct:    1 MAGTARHDREMAIQAKKKLTTATDPIERLRLQCLARGSAGIKGLGRVFRIMDDDNNRTLDFKEFMKGLNDYAVVMEKEEVEELFRRFDKDGNGTIDFNEFLLTLRPPMSRARKEVIMQAFRKLDKTGDGVITIEDLREVYNAKHHPKYQNGEWSEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSA 190          
BLAST of Calcyphosin protein vs. Ensembl Human
Match: CAPSL (calcyphosine like [Source:HGNC Symbol;Acc:HGNC:28375])

HSP 1 Score: 191.43 bits (485), Expect = 2.198e-58
Identity = 102/178 (57.30%), Postives = 141/178 (79.21%), Query Frame = 3
Query:  447 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTK 980
            MA T R +RE+ +++K+KL +A+DP+E+LRLQCLARG+ GIKGLGR F+I DDD N TLDF+EF KG+NDY   + KEEV+ +F   DKD +GT+DF+EFL+ LRPPM+++R  +++QAF KLDKT DG +T+EDL+ VYN   HPKY +GE +EE++F +FL NF++P + DG V+K
Sbjct:    1 MAGTARHDREMAIQAKKKLTTATDPIERLRLQCLARGSAGIKGLGRVFRIMDDDNNRTLDFKEFMKGLNDYAVVMEKEEVEELFRRFDKDGNGTIDFNEFLLTLRPPMSRARKEVIMQAFRKLDKTGDGVITIEDLREVYNAKHHPKYQNGEWSEEQVFRKFLDNFDSPYDKDGLVSK 178          
BLAST of Calcyphosin protein vs. Ensembl Celegans
Match: cal-4 (CALmodulin related genes [Source:UniProtKB/TrEMBL;Acc:G5EDZ8])

HSP 1 Score: 54.6842 bits (130), Expect = 1.658e-8
Identity = 28/97 (28.87%), Postives = 55/97 (56.70%), Query Frame = 3
Query:  567 IKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLK 857
            ++   +AFK++D DGNNT++ +E  + +   G + ++EE+  +    D D +G +DF EF   ++    ++   L+  AF   DK  +G++T ++ K
Sbjct:   22 LQEFAQAFKLFDKDGNNTMNIKELGEAMRMLGLNPTEEELLNMVNEYDVDGNGKIDFGEFCKMMKEMNKETDQELIRLAFKVFDKDGNGYITAQEFK 118          
BLAST of Calcyphosin protein vs. Ensembl Celegans
Match: cal-4 (CALmodulin related genes [Source:UniProtKB/TrEMBL;Acc:G5EDZ8])

HSP 1 Score: 55.0694 bits (131), Expect = 1.747e-8
Identity = 28/97 (28.87%), Postives = 55/97 (56.70%), Query Frame = 3
Query:  567 IKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLK 857
            ++   +AFK++D DGNNT++ +E  + +   G + ++EE+  +    D D +G +DF EF   ++    ++   L+  AF   DK  +G++T ++ K
Sbjct:   48 LQEFAQAFKLFDKDGNNTMNIKELGEAMRMLGLNPTEEELLNMVNEYDVDGNGKIDFGEFCKMMKEMNKETDQELIRLAFKVFDKDGNGYITAQEFK 144          
BLAST of Calcyphosin protein vs. Ensembl Celegans
Match: C50C3.5 (Uncharacterized calcium-binding protein C50C3.5 [Source:UniProtKB/Swiss-Prot;Acc:P34368])

HSP 1 Score: 54.299 bits (129), Expect = 2.528e-8
Identity = 29/97 (29.90%), Postives = 52/97 (53.61%), Query Frame = 3
Query:  582 RAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQ-AFNKLDKTKDGFVTVEDLKGVYN 869
            + F++ DDDG+ T+   E  K +N+ G D+S + VQ +    D    G +DF+EFL A+   +  S V   +Q   +K+D   +  ++ E+L   ++
Sbjct:   54 KIFQLMDDDGSGTISSSEVAKMLNELGIDVSPKVVQAVMRSSDVSGDGQIDFEEFLAAVTSKIKLSTVKADVQLMLSKIDNNPEKVISAEELVVAWS 150          
BLAST of Calcyphosin protein vs. Ensembl Celegans
Match: cal-4 (CALmodulin related genes [Source:UniProtKB/TrEMBL;Acc:G5EDZ8])

HSP 1 Score: 54.6842 bits (130), Expect = 2.611e-8
Identity = 28/97 (28.87%), Postives = 55/97 (56.70%), Query Frame = 3
Query:  567 IKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLK 857
            ++   +AFK++D DGNNT++ +E  + +   G + ++EE+  +    D D +G +DF EF   ++    ++   L+  AF   DK  +G++T ++ K
Sbjct:   76 LQEFAQAFKLFDKDGNNTMNIKELGEAMRMLGLNPTEEELLNMVNEYDVDGNGKIDFGEFCKMMKEMNKETDQELIRLAFKVFDKDGNGYITAQEFK 172          
BLAST of Calcyphosin protein vs. Ensembl Celegans
Match: cal-2 (CALmodulin related genes; Calmodulin-like protein [Source:UniProtKB/TrEMBL;Acc:G5EEG0])

HSP 1 Score: 50.0618 bits (118), Expect = 4.278e-7
Identity = 24/91 (26.37%), Postives = 52/91 (57.14%), Query Frame = 3
Query:  585 AFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLK 857
            AF+++D DGN ++  +E    +   G + +++E+  +   +D D SGT+DF EF   ++    ++   ++ +AF   D+  +GF+T ++ +
Sbjct:   40 AFRLFDKDGNGSISSKELGVAMRSLGQNPTEQELLDMVNEVDIDGSGTIDFGEFCQMMKRMNKENDSEMIREAFRVFDRDGNGFITADEFR 130          
BLAST of Calcyphosin protein vs. Ensembl Fly
Match: CG10126 (gene:FBgn0038088 transcript:FBtr0082686)

HSP 1 Score: 203.371 bits (516), Expect = 8.612e-63
Identity = 98/184 (53.26%), Postives = 138/184 (75.00%), Query Frame = 3
Query:  516 DPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXX-XXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            DP+ KLRL CL+RGATGI GLGRAF+  DDDG+  L+  EF  G+ D G D+S+EE++ +F   D+D SG+++  EFL+ LRPPM +SR+ ++ QAFNK+D+ +DG +T++DLK VY+V +HPKY SGE++E+E+  +           +DGK+T+EEF+NYY+ +SASIDND +FDLMMR AY
Sbjct:   30 DPITKLRLLCLSRGATGILGLGRAFRAMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMTEFLLKLRPPMPQSRLNIIDQAFNKMDRDEDGVITIQDLKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGGRGNLDGKITREEFVNYYATISASIDNDMFFDLMMRRAY 213          

HSP 2 Score: 50.8322 bits (120), Expect = 5.817e-7
Identity = 21/31 (67.74%), Postives = 26/31 (83.87%), Query Frame = 2
Query: 1094 ITKREFLNYYSAVSCSIDNDAYFDLMMRNAY 1186
            IT+ EF+NYY+ +S SIDND +FDLMMR AY
Sbjct:  183 ITREEFVNYYATISASIDNDMFFDLMMRRAY 213          
BLAST of Calcyphosin protein vs. Ensembl Fly
Match: CG10126 (gene:FBgn0038088 transcript:FBtr0082687)

HSP 1 Score: 203.756 bits (517), Expect = 1.005e-62
Identity = 98/184 (53.26%), Postives = 138/184 (75.00%), Query Frame = 3
Query:  516 DPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXX-XXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            DP+ KLRL CL+RGATGI GLGRAF+  DDDG+  L+  EF  G+ D G D+S+EE++ +F   D+D SG+++  EFL+ LRPPM +SR+ ++ QAFNK+D+ +DG +T++DLK VY+V +HPKY SGE++E+E+  +           +DGK+T+EEF+NYY+ +SASIDND +FDLMMR AY
Sbjct:   42 DPITKLRLLCLSRGATGILGLGRAFRAMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMTEFLLKLRPPMPQSRLNIIDQAFNKMDRDEDGVITIQDLKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGGRGNLDGKITREEFVNYYATISASIDNDMFFDLMMRRAY 225          

HSP 2 Score: 50.8322 bits (120), Expect = 6.431e-7
Identity = 21/31 (67.74%), Postives = 26/31 (83.87%), Query Frame = 2
Query: 1094 ITKREFLNYYSAVSCSIDNDAYFDLMMRNAY 1186
            IT+ EF+NYY+ +S SIDND +FDLMMR AY
Sbjct:  195 ITREEFVNYYATISASIDNDMFFDLMMRRAY 225          
BLAST of Calcyphosin protein vs. Ensembl Fly
Match: CG31345 (gene:FBgn0051345 transcript:FBtr0082689)

HSP 1 Score: 201.83 bits (512), Expect = 3.852e-62
Identity = 107/212 (50.47%), Postives = 145/212 (68.40%), Query Frame = 3
Query:  447 MALTNRGNRELQMKSKEKLKSAS----DPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXX--XXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            M   N  ++E ++K+  K + A+    DP+ KLRLQC +RGATGI GL R+F++ DDDG+ +L   EF KGV D G DL+  E+  +F   D D SG ++  EFL+ LRPPM  SR++++ +AF+K+D   DG +TV DLK VY+V  HPKY+SGE TE ++F +        AP+  DG VT+EEF+NYY+ +SASIDNDAYFDLMMR AY
Sbjct:    1 MHRENAYSKEAELKNLAKRELANGLDKDPIYKLRLQCFSRGATGILGLSRSFRVMDDDGSKSLSPEEFKKGVTDIGLDLTDSEIDEMFSRFDTDGSGNINMTEFLVKLRPPMNNSRISIIEKAFDKMDANGDGQITVTDLKNVYSVRDHPKYLSGEMTENQIFTQFLKNFEVGAPNP-DGIVTREEFINYYATISASIDNDAYFDLMMRQAY 211          

HSP 2 Score: 59.3066 bits (142), Expect = 7.650e-10
Identity = 24/34 (70.59%), Postives = 30/34 (88.24%), Query Frame = 2
Query: 1091 VITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 1192
            ++T+ EF+NYY+ +S SIDNDAYFDLMMR AYKL
Sbjct:  180 IVTREEFINYYATISASIDNDAYFDLMMRQAYKL 213          
BLAST of Calcyphosin protein vs. Ensembl Fly
Match: Cam (gene:FBgn0000253 transcript:FBtr0304964)

HSP 1 Score: 49.6766 bits (117), Expect = 6.252e-7
Identity = 29/95 (30.53%), Postives = 51/95 (53.68%), Query Frame = 3
Query:  582 RAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVI-QAFNKLDKTKDGFVTVEDLKGV 863
             AF ++D DG+ T+  +E    +   G + ++ E+Q +   +D D +GT+DF EFL  +   M  +     I +AF   DK  +GF++  +L+ V
Sbjct:   15 EAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHV 109          
BLAST of Calcyphosin protein vs. Ensembl Fly
Match: Cam (gene:FBgn0000253 transcript:FBtr0088001)

HSP 1 Score: 49.6766 bits (117), Expect = 6.252e-7
Identity = 29/95 (30.53%), Postives = 51/95 (53.68%), Query Frame = 3
Query:  582 RAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVI-QAFNKLDKTKDGFVTVEDLKGV 863
             AF ++D DG+ T+  +E    +   G + ++ E+Q +   +D D +GT+DF EFL  +   M  +     I +AF   DK  +GF++  +L+ V
Sbjct:   15 EAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHV 109          
BLAST of Calcyphosin protein vs. Ensembl Zebrafish
Match: capslb (calcyphosine-like b [Source:ZFIN;Acc:ZDB-GENE-050417-298])

HSP 1 Score: 263.077 bits (671), Expect = 2.119e-85
Identity = 131/206 (63.59%), Postives = 166/206 (80.58%), Query Frame = 3
Query:  447 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            MA T+R NRE+ + +K++L   SDP+E+LRLQCL+RG  GIKGLGR F+I DDD N TLD +EF KG+NDYG  + KEE   +F+  D+D SG +DFDEFLI LRPPM+ +R  +V+QAF KLDKT DG +TVEDLKGVY+V KHPKY++GE TE+++F +FL +F++PD+ DGKVTKEEF+NYYSGVSASID D YF LMMRNA+
Sbjct:   40 MAGTSRHNREMMINAKKQLAECSDPIERLRLQCLSRGCAGIKGLGRTFRIMDDDNNRTLDLKEFIKGLNDYGVLMEKEEAINLFQQFDRDGSGQIDFDEFLITLRPPMSNARKEVVLQAFKKLDKTGDGVITVEDLKGVYDVRKHPKYLNGEWTEDQIFRKFLDSFDSPDDKDGKVTKEEFMNYYSGVSASIDTDIYFILMMRNAW 245          

HSP 2 Score: 52.7582 bits (125), Expect = 2.136e-7
Identity = 23/33 (69.70%), Postives = 27/33 (81.82%), Query Frame = 2
Query: 1094 ITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 1192
            +TK EF+NYYS VS SID D YF LMMRNA++L
Sbjct:  215 VTKEEFMNYYSGVSASIDTDIYFILMMRNAWRL 247          
BLAST of Calcyphosin protein vs. Ensembl Zebrafish
Match: capsla (calcyphosine-like a [Source:ZFIN;Acc:ZDB-GENE-030131-7291])

HSP 1 Score: 217.238 bits (552), Expect = 2.092e-68
Identity = 106/185 (57.30%), Postives = 143/185 (77.30%), Query Frame = 3
Query:  510 ASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            A+D ++ LR QCL+RGA GIKGLGR F+  DDDG+ +LDF+EF +G+ DYG  + +++ Q IF  +DKD SG+++FDEFL  LRPPM+ +R+ ++ QAF K DK+ DG VTVEDL+GVYN   HPKY SGE TE ++F  FL +F++P + DGKVT EEF+NYYSGVSAS+D+D YF  MM++A+
Sbjct:    2 AADALQDLRQQCLSRGAAGIKGLGRMFRSMDDDGSKSLDFQEFVRGLQDYGVSVGRDQAQQIFAMMDKDGSGSINFDEFLEKLRPPMSSARMQVIRQAFQKFDKSGDGVVTVEDLQGVYNSKHHPKYKSGEWTETQVFHSFLDSFDSPHDKDGKVTLEEFVNYYSGVSASVDSDEYFISMMKSAW 186          
BLAST of Calcyphosin protein vs. Ensembl Zebrafish
Match: CR749762.5 (si:rp71-17i16.4 [Source:NCBI gene;Acc:100002038])

HSP 1 Score: 55.4546 bits (132), Expect = 8.884e-9
Identity = 30/104 (28.85%), Postives = 55/104 (52.88%), Query Frame = 3
Query:  585 AFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVA----LVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHP 884
            AF ++D DG   +  +E    +   G + S+EE+  I E +D+D SGT+DF+EFL+ +   + + +       + + F   DK +DGF+  E+   + + +  P
Sbjct:   23 AFDMFDTDGGGDISTKELGTVMRMLGQNPSREELDAIIEEVDEDGSGTIDFEEFLVMMVQQLKEDQAGKSEEELSECFRIFDKNQDGFIDREEFGDILHATGEP 126          
BLAST of Calcyphosin protein vs. Ensembl Zebrafish
Match: si:rp71-17i16.4 (si:rp71-17i16.4 [Source:ZFIN;Acc:ZDB-GENE-090312-215])

HSP 1 Score: 55.4546 bits (132), Expect = 8.966e-9
Identity = 30/104 (28.85%), Postives = 55/104 (52.88%), Query Frame = 3
Query:  585 AFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVA----LVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHP 884
            AF ++D DG   +  +E    +   G + S+EE+  I E +D+D SGT+DF+EFL+ +   + + +       + + F   DK +DGF+  E+   + + +  P
Sbjct:   24 AFDMFDTDGGGDISTKELGTVMRMLGQNPSREELDAIIEEVDEDGSGTIDFEEFLVMMVQQLKEDQAGKSEEELSECFRIFDKNQDGFIDREEFGDILHATGEP 127          
BLAST of Calcyphosin protein vs. Ensembl Zebrafish
Match: efcab2 (EF-hand calcium binding domain 2 [Source:ZFIN;Acc:ZDB-GENE-070521-5])

HSP 1 Score: 48.9062 bits (115), Expect = 1.632e-6
Identity = 33/105 (31.43%), Postives = 55/105 (52.38%), Query Frame = 3
Query:  570 KGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDK-SGTLDFDEFLIALRPPMTKSRVA---------LVIQAFNKLDKTKDGFVTVEDL 854
            K +G AF ++D + N T+D RE    +   GC  S+ E+  I   L++++ +G + +++FL    P MTK  +          L+IQAF  LD+ K G +   +L
Sbjct:   22 KRIGNAFDVFDHESNKTVDVREIGTIIRSLGCFPSEAELHDIISELEEEEPTGFVRYEKFL----PTMTKILLERKFRPITEDLLIQAFEVLDQQKKGHLEPAEL 122          
BLAST of Calcyphosin protein vs. Ensembl Xenopus
Match: capsl (calcyphosine like [Source:NCBI gene;Acc:549278])

HSP 1 Score: 254.603 bits (649), Expect = 1.928e-82
Identity = 126/206 (61.17%), Postives = 165/206 (80.10%), Query Frame = 3
Query:  447 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            M  T R +R++ +++K+ L S +DP+EKLRLQCL+RG+ GIKGLGR F+I DDDGN TLDF+EF+KG++DYG  + K E Q +F   DKD SGT+DFDEFL+ LRPPM+ +R  +++QAF KLDK+ DG VT+EDL+GVYN   HPKY +GE TE+++F  FL NF++P + DG+VTK+EFLNYYSGVSASID+D YF LMMRNA+
Sbjct:    1 MPGTARHDRDMALQAKKNLSSCTDPVEKLRLQCLSRGSAGIKGLGRVFRIMDDDGNKTLDFKEFSKGLSDYGVMMDKTETQELFSVFDKDGSGTIDFDEFLVTLRPPMSNARKDMILQAFRKLDKSGDGVVTIEDLRGVYNAKHHPKYQNGEWTEDQVFRSFLDNFDSPYDKDGQVTKDEFLNYYSGVSASIDSDTYFILMMRNAW 206          

HSP 2 Score: 55.0694 bits (131), Expect = 4.369e-8
Identity = 25/33 (75.76%), Postives = 28/33 (84.85%), Query Frame = 2
Query: 1094 ITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 1192
            +TK EFLNYYS VS SID+D YF LMMRNA+KL
Sbjct:  176 VTKDEFLNYYSGVSASIDSDTYFILMMRNAWKL 208          
BLAST of Calcyphosin protein vs. Ensembl Xenopus
Match: capsl (calcyphosine like [Source:NCBI gene;Acc:549278])

HSP 1 Score: 247.669 bits (631), Expect = 7.571e-80
Identity = 122/206 (59.22%), Postives = 162/206 (78.64%), Query Frame = 3
Query:  447 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            M  T R +R++ +++K+ L S +DP+EKLRLQCL+RG+ GIKGLGR F+I DDDGN TLDF+EF+KG++DYG  + K E Q +F   DKD SGT+DFDEFL+ LRPPM+ +R  +++QAF KLDK+ DG VT+EDL+GVYN   HPKY +GE TE+++F  FL NF++P + DG+VT +EF+NYY+GVSASID D YF  MMRNA+
Sbjct:    1 MPGTARHDRDMALQAKKNLSSCTDPVEKLRLQCLSRGSAGIKGLGRVFRIMDDDGNKTLDFKEFSKGLSDYGVMMDKTETQELFSVFDKDGSGTIDFDEFLVTLRPPMSNARKDMILQAFRKLDKSGDGVVTIEDLRGVYNAKHHPKYQNGEWTEDQVFRSFLDNFDSPYDKDGQVTPDEFMNYYAGVSASIDTDIYFITMMRNAW 206          

HSP 2 Score: 48.1358 bits (113), Expect = 8.260e-6
Identity = 21/33 (63.64%), Postives = 25/33 (75.76%), Query Frame = 2
Query: 1094 ITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 1192
            +T  EF+NYY+ VS SID D YF  MMRNA+KL
Sbjct:  176 VTPDEFMNYYAGVSASIDTDIYFITMMRNAWKL 208          
BLAST of Calcyphosin protein vs. Ensembl Xenopus
Match: capsl (calcyphosine like [Source:NCBI gene;Acc:549278])

HSP 1 Score: 241.121 bits (614), Expect = 1.966e-77
Identity = 118/196 (60.20%), Postives = 156/196 (79.59%), Query Frame = 3
Query:  477 LQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            + +++K+ L S +DP+EKLRLQCL+RG+ GIKGLGR F+I DDDGN TLDF+EF+KG++DYG  + K E Q +F   DKD SGT+DFDEFL+ LRPPM+ +R  +++QAF KLDK+ DG VT+EDL+GVYN   HPKY +GE TE+++F  FL NF++P + DG+VT +EF+NYY+GVSASID D YF  MMRNA+
Sbjct:    1 MALQAKKNLSSCTDPVEKLRLQCLSRGSAGIKGLGRVFRIMDDDGNKTLDFKEFSKGLSDYGVMMDKTETQELFSVFDKDGSGTIDFDEFLVTLRPPMSNARKDMILQAFRKLDKSGDGVVTIEDLRGVYNAKHHPKYQNGEWTEDQVFRSFLDNFDSPYDKDGQVTPDEFMNYYAGVSASIDTDIYFITMMRNAW 196          

HSP 2 Score: 48.1358 bits (113), Expect = 7.575e-6
Identity = 21/33 (63.64%), Postives = 25/33 (75.76%), Query Frame = 2
Query: 1094 ITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 1192
            +T  EF+NYY+ VS SID D YF  MMRNA+KL
Sbjct:  166 VTPDEFMNYYAGVSASIDTDIYFITMMRNAWKL 198          
BLAST of Calcyphosin protein vs. Ensembl Xenopus
Match: caps (calcyphosine [Source:NCBI gene;Acc:100037881])

HSP 1 Score: 222.631 bits (566), Expect = 4.905e-70
Identity = 112/206 (54.37%), Postives = 154/206 (74.76%), Query Frame = 3
Query:  447 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            MA   +  RE+  K++ +     DP+EKLRLQCLARGA+GIKGLGRAF+I DD+ ++TLD  EF+KG+ ++G  L   EV  IF   D + +GT++FDEFLI++RPPM+ +R  +++ AF K+D+T DG +T+EDLKGVYN   H KY +GE  E ++F  FL NF++P+  DG+VT+EEFLNYYSGVSASID+DAYF +MM+N +
Sbjct:    1 MASMTQLEREMMAKAQRQYPQCQDPVEKLRLQCLARGASGIKGLGRAFRIMDDNRSSTLDLEEFSKGLQNFGISLQPSEVLDIFHQFDTNGNGTINFDEFLISIRPPMSNARRQVILDAFKKMDRTGDGVITIEDLKGVYNPKFHQKYRNGEWNERQVFQNFLDNFDSPNNKDGQVTEEEFLNYYSGVSASIDSDAYFVVMMKNEW 206          

HSP 2 Score: 50.8322 bits (120), Expect = 1.167e-6
Identity = 21/33 (63.64%), Postives = 28/33 (84.85%), Query Frame = 2
Query: 1094 ITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 1192
            +T+ EFLNYYS VS SID+DAYF +MM+N +K+
Sbjct:  176 VTEEEFLNYYSGVSASIDSDAYFVVMMKNEWKI 208          
BLAST of Calcyphosin protein vs. Ensembl Xenopus
Match: ENSXETT00000016513.1 (calcyphosine 2 [Source:NCBI gene;Acc:100380015])

HSP 1 Score: 85.5001 bits (210), Expect = 8.152e-19
Identity = 56/172 (32.56%), Postives = 96/172 (55.81%), Query Frame = 3
Query:  549 ARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            +RG   + GLG+ F+  D++G+  L   +F + +  +  D+S+E  +  ++ LD+   G LD+ +F  AL   M + R   V +AF KLD  K G + + D++  Y   KHP+ +SG  +EEE+   FLK  +A      +V+  EF ++Y G+S  I +D  F  ++RN++
Sbjct:   11 SRGVQTLTGLGKFFRQVDENGDGILQKAKFKQALKVFHLDVSEEIFESFWKILDEKHEGKLDYGKFTRALIGEMNEYRKTFVQKAFMKLDPNKSGIIPMIDIRKFYCARKHPQVLSGHSSEEEILSSFLKTLQAACRNPKEVSYCEFEDFYEGLSIEILSDNDFINILRNSW 182          
BLAST of Calcyphosin protein vs. Ensembl Mouse
Match: Capsl (calcyphosine-like [Source:MGI Symbol;Acc:MGI:1922818])

HSP 1 Score: 242.662 bits (618), Expect = 6.688e-78
Identity = 120/206 (58.25%), Postives = 163/206 (79.13%), Query Frame = 3
Query:  447 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            MA T R +RE+ ++SK+KL +A+DP+E+LRLQCLARG+ GIKGLGR F+I DD+ N TLDF+EF KG+NDY   + KEE + +F+  D+D SGT+DF+EFL+ LRPPM+++R  ++++AF KLDKT DG +T+EDL+ VYN   HPKY +GE TEE++F +FL NF++P + DG VT EEF+NYY+GVSASID D YF +MM  A+
Sbjct:    1 MAGTARHDREMAIQSKKKLSTATDPIERLRLQCLARGSAGIKGLGRVFRIMDDNNNRTLDFKEFLKGLNDYAVVMEKEEAEELFQRFDRDGSGTIDFNEFLLTLRPPMSRARKEVIMKAFRKLDKTGDGVITIEDLREVYNAKHHPKYQNGEWTEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSASIDTDVYFIIMMTTAW 206          
BLAST of Calcyphosin protein vs. Ensembl Mouse
Match: Capsl (calcyphosine-like [Source:MGI Symbol;Acc:MGI:1922818])

HSP 1 Score: 136.346 bits (342), Expect = 4.295e-38
Identity = 62/105 (59.05%), Postives = 84/105 (80.00%), Query Frame = 3
Query:  447 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALR 761
            MA T R +RE+ ++SK+KL +A+DP+E+LRLQCLARG+ GIKGLGR F+I DD+ N TLDF+EF KG+NDY   + KEE + +F+  D+D SGT+DF+EFL+ LR
Sbjct:    1 MAGTARHDREMAIQSKKKLSTATDPIERLRLQCLARGSAGIKGLGRVFRIMDDNNNRTLDFKEFLKGLNDYAVVMEKEEAEELFQRFDRDGSGTIDFNEFLLTLR 105          
BLAST of Calcyphosin protein vs. Ensembl Mouse
Match: Caps2 (calcyphosphine 2 [Source:MGI Symbol;Acc:MGI:2441980])

HSP 1 Score: 77.7962 bits (190), Expect = 8.827e-15
Identity = 58/184 (31.52%), Postives = 99/184 (53.80%), Query Frame = 3
Query:  522 MEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQ---FIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
             +KL+ Q   +GA  + GLGR F+  D +GN  L+  +F + +  +  ++S+++ +    I +G    K+  +D+ EF  A+   M + R + V +AF +LD  K G V+V D++  Y   KHP+ ISG  TEEE+   FL+  +       +V+  EF +YY G+S  +  D  F  ++R  +
Sbjct:  366 QDKLKEQLHKKGARILTGLGRYFQGLDKEGNGLLEKADFQQALKTFHLEVSEQDFESFWLILQGYGHSKN-KVDYGEFKRAIFGEMNEYRKSFVRKAFMQLDFNKTGIVSVIDIRKCYCAKKHPRVISGHSTEEEIKSSFLETLKGTCSKCDEVSYGEFEDYYEGLSIGVAGDEDFVNILRIPW 548          
BLAST of Calcyphosin protein vs. Ensembl Mouse
Match: Caps2 (calcyphosphine 2 [Source:MGI Symbol;Acc:MGI:2441980])

HSP 1 Score: 77.7962 bits (190), Expect = 9.234e-15
Identity = 58/184 (31.52%), Postives = 99/184 (53.80%), Query Frame = 3
Query:  522 MEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQ---FIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
             +KL+ Q   +GA  + GLGR F+  D +GN  L+  +F + +  +  ++S+++ +    I +G    K+  +D+ EF  A+   M + R + V +AF +LD  K G V+V D++  Y   KHP+ ISG  TEEE+   FL+  +       +V+  EF +YY G+S  +  D  F  ++R  +
Sbjct:  408 QDKLKEQLHKKGARILTGLGRYFQGLDKEGNGLLEKADFQQALKTFHLEVSEQDFESFWLILQGYGHSKN-KVDYGEFKRAIFGEMNEYRKSFVRKAFMQLDFNKTGIVSVIDIRKCYCAKKHPRVISGHSTEEEIKSSFLETLKGTCSKCDEVSYGEFEDYYEGLSIGVAGDEDFVNILRIPW 590          
BLAST of Calcyphosin protein vs. Ensembl Mouse
Match: Tnnc2 (troponin C2, fast [Source:MGI Symbol;Acc:MGI:98780])

HSP 1 Score: 55.8398 bits (133), Expect = 7.841e-9
Identity = 43/148 (29.05%), Postives = 71/148 (47.97%), Query Frame = 3
Query:  585 AFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMT-----KSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVS 1013
            AF ++D DG   +  +E    +   G   +KEE+  I E +D+D SGT+DF+EFL+ +   M      KS   L  + F   D+  DG++  E+L  ++  S   ++++ E  E  +      N       DG++  +EFL    GV 
Sbjct:   23 AFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELA-ECFRIFDRNADGYIDAEELAEIFRAS--GEHVTEEEIESLMKDGDKNN-------DGRIDFDEFLKMMEGVQ 160          
BLAST of Calcyphosin protein vs. UniProt/SwissProt
Match: sp|Q6P8Y1|CAPSL_MOUSE (Calcyphosin-like protein OS=Mus musculus OX=10090 GN=Capsl PE=2 SV=4)

HSP 1 Score: 242.662 bits (618), Expect = 4.678e-77
Identity = 120/206 (58.25%), Postives = 163/206 (79.13%), Query Frame = 3
Query:  447 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            MA T R +RE+ ++SK+KL +A+DP+E+LRLQCLARG+ GIKGLGR F+I DD+ N TLDF+EF KG+NDY   + KEE + +F+  D+D SGT+DF+EFL+ LRPPM+++R  ++++AF KLDKT DG +T+EDL+ VYN   HPKY +GE TEE++F +FL NF++P + DG VT EEF+NYY+GVSASID D YF +MM  A+
Sbjct:    1 MAGTARHDREMAIQSKKKLSTATDPIERLRLQCLARGSAGIKGLGRVFRIMDDNNNRTLDFKEFLKGLNDYAVVMEKEEAEELFQRFDRDGSGTIDFNEFLLTLRPPMSRARKEVIMKAFRKLDKTGDGVITIEDLREVYNAKHHPKYQNGEWTEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSASIDTDVYFIIMMTTAW 206          
BLAST of Calcyphosin protein vs. UniProt/SwissProt
Match: sp|Q8WWF8|CAPSL_HUMAN (Calcyphosin-like protein OS=Homo sapiens OX=9606 GN=CAPSL PE=2 SV=4)

HSP 1 Score: 236.113 bits (601), Expect = 1.403e-74
Identity = 122/206 (59.22%), Postives = 164/206 (79.61%), Query Frame = 3
Query:  447 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            MA T R +RE+ +++K+KL +A+DP+E+LRLQCLARG+ GIKGLGR F+I DDD N TLDF+EF KG+NDY   + KEEV+ +F   DKD +GT+DF+EFL+ LRPPM+++R  +++QAF KLDKT DG +T+EDL+ VYN   HPKY +GE +EE++F +FL NF++P + DG VT EEF+NYY+GVSASID D YF +MMR A+
Sbjct:    1 MAGTARHDREMAIQAKKKLTTATDPIERLRLQCLARGSAGIKGLGRVFRIMDDDNNRTLDFKEFMKGLNDYAVVMEKEEVEELFRRFDKDGNGTIDFNEFLLTLRPPMSRARKEVIMQAFRKLDKTGDGVITIEDLREVYNAKHHPKYQNGEWSEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSASIDTDVYFIIMMRTAW 206          
BLAST of Calcyphosin protein vs. UniProt/SwissProt
Match: sp|Q0VCC0|CAYP1_BOVIN (Calcyphosin OS=Bos taurus OX=9913 GN=CAPS PE=2 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 2.062e-51
Identity = 95/181 (52.49%), Postives = 128/181 (70.72%), Query Frame = 3
Query:  522 MEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            MEKLR QCL+RGA+GI+G+ R F+  D DG+ +LD RE  +G+ + G  L   E++ +    D+D SGTLD +EFL ALRPPM+++R A+V  AF KLD++ DG VTV+DL+GVY+   HPK  SGE TEE++   FL NF++  E DG+VT  EF +YYSGVSAS+D D  F  MM +A+
Sbjct:    8 MEKLRAQCLSRGASGIQGVARFFRRLDQDGSRSLDVRELQRGLAELGLVLDTAEMEGVCRRWDRDGSGTLDLEEFLRALRPPMSQAREAVVTAAFAKLDRSGDGVVTVDDLRGVYSGRTHPKVRSGEWTEEQVLRHFLDNFDSS-EKDGQVTLAEFQDYYSGVSASMDTDEEFVAMMTSAW 187          
BLAST of Calcyphosin protein vs. UniProt/SwissProt
Match: sp|Q13938|CAYP1_HUMAN (Calcyphosin OS=Homo sapiens OX=9606 GN=CAPS PE=1 SV=2)

HSP 1 Score: 170.244 bits (430), Expect = 2.895e-48
Identity = 93/181 (51.38%), Postives = 127/181 (70.17%), Query Frame = 3
Query:  522 MEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            MEKLR QCL+RGA+GI+GL R F+  D DG+ +LD  EF +G+   G  L + E + +    D++ SGTLD +EFL ALRPPM+++R A++  AF KLD++ DG VTV+DL+GVY+   HPK  SGE TE+E+   FL NF++  E DG+VT  EF +YYSGVSAS++ D  F  MM +A+
Sbjct:   94 MEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWDRNGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSGDGVVTVDDLRGVYSGRAHPKVRSGEWTEDEVLRRFLDNFDS-SEKDGQVTLAEFQDYYSGVSASMNTDEEFVAMMTSAW 273          
BLAST of Calcyphosin protein vs. UniProt/SwissProt
Match: sp|P41150|CAYP1_RABIT (Calcyphosin OS=Oryctolagus cuniculus OX=9986 GN=CAPS PE=1 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 1.618e-47
Identity = 92/188 (48.94%), Postives = 127/188 (67.55%), Query Frame = 3
Query:  501 LKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            + +A   +EKLR QCLARGA GI+GL R F+  D DG+ +LD  E  +G+   G  L + E Q +    D++ SGTLD +EFL ALRPPM+++R A++  AF KLD++ DG VT+ DL+GVY+   HPK  +GE TE+E+   FL NF++  E DG+VT  EF +YYSG+SAS+D D  F  MM +A+
Sbjct:    1 MDTADAIVEKLRAQCLARGAAGIQGLARFFRRLDRDGSRSLDAGELRQGLAKLGLALDEAEAQSVCRRWDRNGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSGDGVVTLGDLRGVYSGRNHPKVRTGEWTEDEVLRRFLDNFDSS-EKDGQVTLAEFQDYYSGLSASVDTDEEFVAMMSSAW 187          
BLAST of Calcyphosin protein vs. TrEMBL
Match: A0A564YA36 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS3682 PE=4 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 3.317e-87
Identity = 139/206 (67.48%), Postives = 174/206 (84.47%), Query Frame = 3
Query:  447 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            MA+T RG+ +L++K+K+K++S++DP+EKLRL CLARG +GI GLGR F+I DD+G+  LD REF KG  D+G DL+KEE++ +FE LDKD SG +DFDEFL ALRPPM K R+ L+ QAFNK+D+T+DG++T EDLKGVYN   HPKY +GE TEE++F EFLK FEAP+EIDGKVTK EFLNYY+GVSASIDN+AYFDLMMRNAY
Sbjct:    1 MAITARGDYQLKLKAKQKIQSSTDPVEKLRLNCLARGGSGILGLGRQFRIIDDNGDKKLDMREFTKGCQDFGIDLTKEEIREVFEHLDKDGSGHIDFDEFLEALRPPMPKCRLELINQAFNKMDRTRDGYITAEDLKGVYNCKFHPKYRNGEWTEEQVFNEFLKKFEAPNEIDGKVTKSEFLNYYAGVSASIDNNAYFDLMMRNAY 206          

HSP 2 Score: 60.077 bits (144), Expect = 1.155e-6
Identity = 27/33 (81.82%), Postives = 30/33 (90.91%), Query Frame = 2
Query: 1094 ITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 1192
            +TK EFLNYY+ VS SIDN+AYFDLMMRNAYKL
Sbjct:  176 VTKSEFLNYYAGVSASIDNNAYFDLMMRNAYKL 208          
BLAST of Calcyphosin protein vs. TrEMBL
Match: T2M8P3 (Calcyphosin-like protein OS=Hydra vulgaris OX=6087 GN=CAPSL PE=2 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 8.604e-87
Identity = 135/206 (65.53%), Postives = 165/206 (80.10%), Query Frame = 3
Query:  447 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            M +TNR N  L+  +   L   +DP+EKLRL CL+RGA GIKGLGR FKI+DDDG+ TLDF+EF+KG+ DYG  L  +EV+ IF+  DKDKS  LDFDEFL+ALRPPM+ +R A++ +AFNKLDK+ DGFVTVEDLKG YNV+KHPKY+SGE TE++ + +FL  F+ PD  DG +T EEF+NYYSGVSASIDNDAYFDLMMRNAY
Sbjct:    1 MPVTNRTNEALKRSATSALNKTTDPIEKLRLACLSRGAAGIKGLGRTFKIFDDDGSRTLDFKEFSKGLRDYGLHLEPQEVKEIFDAFDKDKSQQLDFDEFLLALRPPMSNARKAIISKAFNKLDKSGDGFVTVEDLKGTYNVTKHPKYLSGEWTEDQCYRQFLDAFDTPDSCDGTITLEEFINYYSGVSASIDNDAYFDLMMRNAY 206          

HSP 2 Score: 61.6178 bits (148), Expect = 3.721e-7
Identity = 29/41 (70.73%), Postives = 31/41 (75.61%), Query Frame = 2
Query: 1070 VTDSSIKVITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 1192
              DS    IT  EF+NYYS VS SIDNDAYFDLMMRNAYK+
Sbjct:  168 TPDSCDGTITLEEFINYYSGVSASIDNDAYFDLMMRNAYKI 208          
BLAST of Calcyphosin protein vs. TrEMBL
Match: A0A068YA96 (Calcyphosin protein OS=Echinococcus multilocularis OX=6211 PE=4 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 1.153e-86
Identity = 141/206 (68.45%), Postives = 171/206 (83.01%), Query Frame = 3
Query:  447 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            MALT+RG+ +L++K+K+K++  + P+EKLRLQCLARG TGI GLGR F+I DDDGN  LD REF KG  D+G DL+KEEV+ IFE LDKD SG +DFDEFL ALRPPM K RV L+ QAF K+D+++DG++T EDL+GVYN   HPKY +GE TEE++F EFL+ FEAP EIDGKVTK EFLNYY+GVSASIDN+AYFDLMMRNAY
Sbjct:    1 MALTSRGDYQLKLKAKKKVQETTSPLEKLRLQCLARGGTGILGLGRQFRIIDDDGNKLLDLREFTKGCADFGVDLTKEEVKEIFELLDKDGSGHIDFDEFLEALRPPMPKCRVDLINQAFMKMDRSRDGYITAEDLRGVYNCKFHPKYRNGEWTEEQVFEEFLRKFEAPAEIDGKVTKSEFLNYYAGVSASIDNNAYFDLMMRNAY 206          

HSP 2 Score: 60.077 bits (144), Expect = 1.051e-6
Identity = 27/33 (81.82%), Postives = 30/33 (90.91%), Query Frame = 2
Query: 1094 ITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 1192
            +TK EFLNYY+ VS SIDN+AYFDLMMRNAYKL
Sbjct:  176 VTKSEFLNYYAGVSASIDNNAYFDLMMRNAYKL 208          
BLAST of Calcyphosin protein vs. TrEMBL
Match: U6J8X4 (Calcyphosin protein OS=Echinococcus granulosus OX=6210 GN=EGR_04400 PE=4 SV=1)

HSP 1 Score: 273.092 bits (697), Expect = 1.666e-86
Identity = 141/206 (68.45%), Postives = 171/206 (83.01%), Query Frame = 3
Query:  447 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            MALT+RG+ +L++K+K+K++  + P+EKLRLQCLARG TGI GLGR F+I DDDGN  LD REF KG  D+G DL+KEEV+ IFE LDKD SG +DFDEFL ALRPPM K RV L+ QAF K+D+++DG++T EDL+GVYN   HPKY +GE TEE++F EFL+ FEAP EIDGKVTK EFLNYY+GVSASIDN+AYFDLMMRNAY
Sbjct:    1 MALTSRGDYQLKLKAKKKVQETTSPLEKLRLQCLARGGTGILGLGRQFRIIDDDGNKLLDLREFTKGCADFGVDLTKEEVKEIFELLDKDGSGYIDFDEFLEALRPPMPKCRVDLINQAFMKMDRSRDGYITAEDLRGVYNCKFHPKYRNGEWTEEQVFEEFLRKFEAPAEIDGKVTKSEFLNYYAGVSASIDNNAYFDLMMRNAY 206          

HSP 2 Score: 60.077 bits (144), Expect = 1.123e-6
Identity = 27/33 (81.82%), Postives = 30/33 (90.91%), Query Frame = 2
Query: 1094 ITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 1192
            +TK EFLNYY+ VS SIDN+AYFDLMMRNAYKL
Sbjct:  176 VTKSEFLNYYAGVSASIDNNAYFDLMMRNAYKL 208          
BLAST of Calcyphosin protein vs. TrEMBL
Match: A0A267F2D9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002765g1 PE=4 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 1.117e-83
Identity = 138/207 (66.67%), Postives = 168/207 (81.16%), Query Frame = 3
Query:  447 MALTNRGNRELQMKSKEKLKSAS-DPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            MA T+RG+ EL  K+K++L S + DP+EKLRL CL+RGA+GIKGLGR F+I DDDG+ +LD REF KG  D+G DLSKEE++ IF  +DKD SG+LDFDEFL+ALRPPM+ +R  L+ +AF KLDKT+DG +TVEDLKGVYN   HPK+ +GE TEE++F EFL+ FE P + DG VTKEEF NYYSGVSASIDNDAYFDLMMR AY
Sbjct:    1 MAATDRGSAELAAKAKKQLASGTKDPLEKLRLTCLSRGASGIKGLGRQFRIIDDDGSKSLDRREFFKGCTDFGADLSKEEMEAIFTRIDKDGSGSLDFDEFLVALRPPMSNARRELITKAFQKLDKTRDGVITVEDLKGVYNCKHHPKFRNGEWTEEDVFKEFLRTFETPGDADGTVTKEEFFNYYSGVSASIDNDAYFDLMMRTAY 207          

HSP 2 Score: 60.077 bits (144), Expect = 1.162e-6
Identity = 26/34 (76.47%), Postives = 28/34 (82.35%), Query Frame = 2
Query: 1091 VITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 1192
             +TK EF NYYS VS SIDNDAYFDLMMR AYK+
Sbjct:  176 TVTKEEFFNYYSGVSASIDNDAYFDLMMRTAYKI 209          
BLAST of Calcyphosin protein vs. Ensembl Cavefish
Match: capslb (calcyphosine like [Source:NCBI gene;Acc:103021302])

HSP 1 Score: 242.662 bits (618), Expect = 5.026e-78
Identity = 122/206 (59.22%), Postives = 163/206 (79.13%), Query Frame = 3
Query:  447 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            MA T+R +R++ + +K++L  A+DP+E+LRLQCLARG+ GIKGLGR F+I DDD +  L+ +EF KG+NDYG  + K+E   +F   DKD SG +DFDEFLI LRPPM+ +R  +++QAF KLDKT DG +TVEDL+GVYNV  HPKY +GE TE+++F +FL +F++ D+ DGKVTKEEF+NYYSGVSASID+D YF LMM+ A+
Sbjct:    1 MAGTSRHDRQMAIDAKKRLSEATDPVERLRLQCLARGSAGIKGLGRVFRIMDDDNSRNLELKEFMKGLNDYGIMMEKDEAMELFRTFDKDGSGQIDFDEFLITLRPPMSNARKEVIMQAFRKLDKTGDGVITVEDLRGVYNVKNHPKYQNGEWTEDQIFRKFLDSFDSDDK-DGKVTKEEFVNYYSGVSASIDSDVYFILMMKTAW 205          

HSP 2 Score: 50.8322 bits (120), Expect = 5.232e-7
Identity = 23/40 (57.50%), Postives = 29/40 (72.50%), Query Frame = 2
Query: 1073 TDSSIKVITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 1192
            +D     +TK EF+NYYS VS SID+D YF LMM+ A+KL
Sbjct:  168 SDDKDGKVTKEEFVNYYSGVSASIDSDVYFILMMKTAWKL 207          
BLAST of Calcyphosin protein vs. Ensembl Cavefish
Match: capslb (calcyphosine like [Source:NCBI gene;Acc:103021302])

HSP 1 Score: 241.506 bits (615), Expect = 1.446e-77
Identity = 120/206 (58.25%), Postives = 163/206 (79.13%), Query Frame = 3
Query:  447 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            MA T+R +R++ + +K++L  A+DP+E+LRLQCLARG+ GIKGLGR F+I DDD +  L+ +EF KG+NDYG  + K+E   +F   DKD SG +DFDEFLI LRPPM+ +R  +++QAF KLDKT DG +TVEDL+GVYNV  HPKY +GE TE+++F +FL +F++ D+ DGKVT+EEF+NYY+GVSASID D YF +MM+NA+
Sbjct:    1 MAGTSRHDRQMAIDAKKRLSEATDPVERLRLQCLARGSAGIKGLGRVFRIMDDDNSRNLELKEFMKGLNDYGIMMEKDEAMELFRTFDKDGSGQIDFDEFLITLRPPMSNARKEVIMQAFRKLDKTGDGVITVEDLRGVYNVKNHPKYQNGEWTEDQIFRKFLDSFDSDDK-DGKVTQEEFMNYYAGVSASIDTDVYFIVMMKNAW 205          

HSP 2 Score: 49.6766 bits (117), Expect = 1.343e-6
Identity = 21/40 (52.50%), Postives = 29/40 (72.50%), Query Frame = 2
Query: 1073 TDSSIKVITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 1192
            +D     +T+ EF+NYY+ VS SID D YF +MM+NA+KL
Sbjct:  168 SDDKDGKVTQEEFMNYYAGVSASIDTDVYFIVMMKNAWKL 207          
BLAST of Calcyphosin protein vs. Ensembl Cavefish
Match: capsla (calcyphosin-like protein [Source:NCBI gene;Acc:103033765])

HSP 1 Score: 221.476 bits (563), Expect = 3.619e-70
Identity = 112/184 (60.87%), Postives = 145/184 (78.80%), Query Frame = 3
Query:  513 SDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            +D +E+LR QCL+RGA GIKGLGR F+I DDDG+ +L+ +EF KG+  YG ++  E+ + IF  +DKD+SGT+DF+EFL  LRPPM+ +RV ++ QAF KLD T DG VT+EDL+GVYN   HPKY SGE TEE++F  FL +F++P E DGKVT EEF+NYYSGVSASID+DAYF  MM+NA+
Sbjct:    2 ADVLEELRQQCLSRGAAGIKGLGRTFRIMDDDGSKSLNLQEFQKGLETYGVNVGLEKAKQIFTIIDKDRSGTIDFNEFLEKLRPPMSSTRVQVIKQAFQKLDSTGDGLVTIEDLQGVYNSKHHPKYKSGEWTEEQVFRSFLDSFDSPYEKDGKVTLEEFVNYYSGVSASIDDDAYFVTMMQNAW 185          

HSP 2 Score: 50.447 bits (119), Expect = 5.915e-7
Identity = 22/33 (66.67%), Postives = 27/33 (81.82%), Query Frame = 2
Query: 1094 ITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 1192
            +T  EF+NYYS VS SID+DAYF  MM+NA+KL
Sbjct:  155 VTLEEFVNYYSGVSASIDDDAYFVTMMQNAWKL 187          
BLAST of Calcyphosin protein vs. Ensembl Cavefish
Match: si:rp71-17i16.4 (troponin C, skeletal muscle [Source:NCBI gene;Acc:103044939])

HSP 1 Score: 53.5286 bits (127), Expect = 4.170e-8
Identity = 30/104 (28.85%), Postives = 53/104 (50.96%), Query Frame = 3
Query:  585 AFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVA----LVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHP 884
            AF ++D DG   +  +E    +   G + S+EE+  I E +D+D SGT+DF+EFL+ +   + + +       + + F   DK  DGF+  E+   +   +  P
Sbjct:   24 AFDMFDTDGGGDISTKELGTVMRMLGQNPSREELDAIIEEVDEDGSGTIDFEEFLVMMVQQLKEDQAGKSEEELSECFRVFDKNGDGFIDREEFGDIMRSTGEP 127          
BLAST of Calcyphosin protein vs. Ensembl Cavefish
Match: si:rp71-17i16.4 (troponin C, skeletal muscle [Source:NCBI gene;Acc:103044939])

HSP 1 Score: 53.5286 bits (127), Expect = 5.087e-8
Identity = 30/104 (28.85%), Postives = 53/104 (50.96%), Query Frame = 3
Query:  585 AFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVAL----VIQAFNKLDKTKDGFVTVEDLKGVYNVSKHP 884
            AF ++D DG   +  +E    +   G + S+EE+  I E +D+D SGT+DF+EFL+ +   + + +       + + F   DK  DGF+  E+   +   +  P
Sbjct:   24 AFDMFDTDGGGDISTKELGTVMRMLGQNPSREELDAIIEEVDEDGSGTIDFEEFLVMMVQQLKEDQAGKSEEELSECFRVFDKNGDGFIDREEFGDIMRSTGEP 127          
BLAST of Calcyphosin protein vs. Ensembl Sea Lamprey
Match: si:rp71-17i16.4 (si:rp71-17i16.4 [Source:ZFIN;Acc:ZDB-GENE-090312-215])

HSP 1 Score: 54.6842 bits (130), Expect = 2.800e-9
Identity = 41/150 (27.33%), Postives = 70/150 (46.67%), Query Frame = 3
Query:  585 AFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVAL----VIQAFNKLDKTKDGFVTVEDLKGV-YNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSAS 1019
            AF ++D DG   +   E  K +   G   +KEE+  I E +D+D SGT+DF+EFL+ +   M +         + +AF  LD   DG++  ++LK +  N  ++   +                 +     DG++  +EFL    G++AS
Sbjct:   28 AFDMFDADGGGDISTSELGKVMKLLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEESAGQTEEELAEAFRILDTNGDGYIDRDELKDILLNTGENVTDLE----------MDELMKDGDKNCDGRLDFDEFLKMMEGIAAS 167          
BLAST of Calcyphosin protein vs. Ensembl Sea Lamprey
Match: CETN1 (centrin 1 [Source:HGNC Symbol;Acc:HGNC:1866])

HSP 1 Score: 50.447 bits (119), Expect = 1.048e-7
Identity = 29/94 (30.85%), Postives = 53/94 (56.38%), Query Frame = 3
Query:  585 AFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMT-KSRVALVIQAFNKLDKTKDGFVTVEDLKGV 863
            AF ++D DG+ T+D +E    +   G +  KEE++ +    DKD SG ++F++FL  +   M+ K     +++AF   D  + G ++ ++LK V
Sbjct:   47 AFDLFDADGSGTIDVKELKVAMRALGFEPKKEEIKKMIADFDKDGSGKINFNDFLAMMTQKMSEKDSREEILKAFRLFDDDETGKISFKNLKRV 140          
BLAST of Calcyphosin protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006008.1 (pep scaffold:Pmarinus_7.0:GL476713:142259:146509:-1 gene:ENSPMAG00000005430.1 transcript:ENSPMAT00000006008.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 2.487e-7
Identity = 28/95 (29.47%), Postives = 51/95 (53.68%), Query Frame = 3
Query:  582 RAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVI-QAFNKLDKTKDGFVTVEDLKGV 863
             AF ++D DG+ T+  +E    +   G + ++ E+Q +   +D D +GT+DF EFL  +   M  +     I +AF   DK  +G+++  +L+ V
Sbjct:   15 EAFSLFDKDGDGTITVKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHV 109          
BLAST of Calcyphosin protein vs. Ensembl Sea Lamprey
Match: CALM3 (calmodulin 3 [Source:HGNC Symbol;Acc:HGNC:1449])

HSP 1 Score: 48.1358 bits (113), Expect = 3.683e-7
Identity = 28/95 (29.47%), Postives = 51/95 (53.68%), Query Frame = 3
Query:  582 RAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVI-QAFNKLDKTKDGFVTVEDLKGV 863
             AF ++D DG+ T+  +E    +   G + ++ E+Q +   +D D +GT+DF EFL  +   M  +     I +AF   DK  +G+++  +L+ V
Sbjct:   15 EAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHV 109          
BLAST of Calcyphosin protein vs. Ensembl Sea Lamprey
Match: CALML3 (calmodulin like 3 [Source:HGNC Symbol;Acc:HGNC:1452])

HSP 1 Score: 48.1358 bits (113), Expect = 3.827e-7
Identity = 28/95 (29.47%), Postives = 51/95 (53.68%), Query Frame = 3
Query:  582 RAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVI-QAFNKLDKTKDGFVTVEDLKGV 863
             AF ++D DG+ T+  +E    +   G + ++ E+Q +   +D D +GT+DF EFL  +   M  +     I +AF   DK  +G+++  +L+ V
Sbjct:   15 EAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHV 109          
BLAST of Calcyphosin protein vs. Ensembl Nematostella
Match: EDO32961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STK4])

HSP 1 Score: 251.521 bits (641), Expect = 7.183e-82
Identity = 131/206 (63.59%), Postives = 157/206 (76.21%), Query Frame = 3
Query:  447 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            MA T R  +EL  K K+      DP+E LRL CL+RG++GIKGLGR FKI DDDGN +LDF EF KG+ DYG  L  +EV+  FE  D D SGT+DFDEFLI LRPPM+K+R  ++ QAFNKLDKT D  +TVEDLKGVYNV  HPKY +GE TEE+   +FL +F++PD+ DG +T +EFLNYYSGVSASID+DAYFDLMMRNAY
Sbjct:    1 MAATARHEKELIEKCKKNAGQTKDPVESLRLACLSRGSSGIKGLGRTFKIMDDDGNRSLDFNEFKKGLRDYGVMLEPKEVKRTFEAFDTDGSGTIDFDEFLIRLRPPMSKARKNVIQQAFNKLDKTGDNNITVEDLKGVYNVKHHPKYQNGEWTEEQCLRKFLDSFDSPDDKDGIITYDEFLNYYSGVSASIDSDAYFDLMMRNAY 206          

HSP 2 Score: 60.077 bits (144), Expect = 1.669e-10
Identity = 29/40 (72.50%), Postives = 31/40 (77.50%), Query Frame = 2
Query: 1073 TDSSIKVITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 1192
             D    +IT  EFLNYYS VS SID+DAYFDLMMRNAYKL
Sbjct:  169 PDDKDGIITYDEFLNYYSGVSASIDSDAYFDLMMRNAYKL 208          
BLAST of Calcyphosin protein vs. Ensembl Nematostella
Match: EDO32962 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STK5])

HSP 1 Score: 153.68 bits (387), Expect = 1.942e-44
Identity = 73/146 (50.00%), Postives = 104/146 (71.23%), Query Frame = 3
Query:  471 RELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERT 908
            REL++K+K+  ++A  P+EKL      RG  GIK  GRAF+I+DDDGN  L+  EF KG+ D+G  L+ +EV+ +F   DKD SG+LDF+EFL A+RP M+K+RV ++++AF+K+D T DG +T+ DLK VYN  +  +Y SGE T
Sbjct:   10 RELKIKAKKMEENAKTPIEKLHAAMAGRGTCGIKMFGRAFRIFDDDGNRALNIDEFRKGMQDFGTKLTDDEVKQLFAQFDKDGSGSLDFEEFLRAVRPSMSKNRVEIIMKAFHKMDTTGDGVITIADLKKVYNARQDKRYQSGEMT 155          
BLAST of Calcyphosin protein vs. Ensembl Nematostella
Match: EDO33723 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRH0])

HSP 1 Score: 118.242 bits (295), Expect = 1.113e-31
Identity = 78/173 (45.09%), Postives = 104/173 (60.12%), Query Frame = 3
Query:  585 AFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQF------------IFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXA-PDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            AF+I+DDDGN  L+  EF KG+ DYG  L+ ++V F            IF+GL+                       R  ++++AF+K+D T DG +T+ DLK VYN  +  +Y SGE TE E+F +FL  FE  P + DGKVTK EFL+YY+GVS SID+DAYFDLMMR A+
Sbjct:    2 AFRIFDDDGNKALNIDEFRKGMQDYGTKLT-DDVSFTHFSAQSTDLLLIFQGLE----------------------LRFRIIMKAFHKMDTTGDGVITIADLKKVYNARQDKRYQSGEMTEAEVFQKFLATFEPDPAKRDGKVTKGEFLDYYNGVSVSIDDDAYFDLMMRQAW 151          

HSP 2 Score: 55.8398 bits (133), Expect = 1.842e-9
Identity = 24/33 (72.73%), Postives = 29/33 (87.88%), Query Frame = 2
Query: 1094 ITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 1192
            +TK EFL+YY+ VS SID+DAYFDLMMR A+KL
Sbjct:  121 VTKGEFLDYYNGVSVSIDDDAYFDLMMRQAWKL 153          
BLAST of Calcyphosin protein vs. Ensembl Nematostella
Match: EDO37727 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF01])

HSP 1 Score: 87.4261 bits (215), Expect = 3.677e-19
Identity = 59/179 (32.96%), Postives = 92/179 (51.40%), Query Frame = 3
Query:  528 KLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            ++R Q   R +  + G+GR F+  D DG+    F EF + V        KE +  ++  LD +  G LD+ EF+      M ++R A V + F+K D +K G V + ++K  ++  KHPK +SG R +E    +   +     E  G+VT  EF +YY GVS  I +D  F  MM+N +
Sbjct:  148 EVRRQLAQRASKTLMGMGRHFRTLDKDGHRL--FEEFWEVVE-------KEVLGGLWNLLDVNGDGALDYGEFVRGFIGEMNETRKAYVRKVFHKFDPSKTGLVELNNMKKFFSAKKHPKVLSG-RLKEHEAQQMFLSSFENCEHRGEVTYAEFEDYYEGVSIGIASDEEFVAMMKNCW 316          
BLAST of Calcyphosin protein vs. Ensembl Nematostella
Match: EDO40775 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S690])

HSP 1 Score: 56.6102 bits (135), Expect = 1.277e-9
Identity = 32/94 (34.04%), Postives = 55/94 (58.51%), Query Frame = 3
Query:  585 AFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMT-KSRVALVIQAFNKLDKTKDGFVTVEDLKGV 863
            AF ++D DG+ T+D +E    +   G +  KEE++ +   +DKD SGT+DF+EFL  +   M+ K     +++AF   D  + G ++ ++LK V
Sbjct:   26 AFDLFDTDGSGTIDAKELKVAMRALGFEPKKEEIKKMISDIDKDGSGTIDFNEFLQMMTAKMSEKDSKEEILKAFKLFDDDETGKISFKNLKRV 119          
BLAST of Calcyphosin protein vs. Ensembl Medaka
Match: capslb (calcyphosine like [Source:NCBI gene;Acc:101171382])

HSP 1 Score: 248.825 bits (634), Expect = 8.324e-80
Identity = 122/207 (58.94%), Postives = 165/207 (79.71%), Query Frame = 3
Query:  444 SMALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            +MA T+R + E+ + +K +L   SDP+EKLRLQCL RG++GIKGLGR F++ DD+ N +LD +EF KG+NDYG  + KEE   +F+  D+D SGT+ FDEFLIALRPPM+++R+ +V+QAF K+DKT DG +TVEDL+GVYN   HPKY +GE +E+++F  FL +F++P + DGKVTKEEF++YYSGVSASID+D YF LMMRNA+
Sbjct:   50 AMAGTSRHDHEMAVMAKRQLSQCSDPVEKLRLQCLIRGSSGIKGLGRTFRVMDDNQNRSLDLKEFLKGLNDYGLLMEKEEAAALFQHFDRDGSGTISFDEFLIALRPPMSRARLEVVMQAFRKMDKTGDGVITVEDLRGVYNAKYHPKYQNGELSEDQVFRTFLDSFDSPYDKDGKVTKEEFIDYYSGVSASIDSDVYFILMMRNAW 256          

HSP 2 Score: 53.1434 bits (126), Expect = 1.839e-7
Identity = 23/33 (69.70%), Postives = 28/33 (84.85%), Query Frame = 2
Query: 1094 ITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 1192
            +TK EF++YYS VS SID+D YF LMMRNA+KL
Sbjct:  226 VTKEEFIDYYSGVSASIDSDVYFILMMRNAWKL 258          
BLAST of Calcyphosin protein vs. Ensembl Medaka
Match: si:rp71-17i16.4 (troponin C, skeletal muscle [Source:NCBI gene;Acc:101171577])

HSP 1 Score: 53.1434 bits (126), Expect = 1.140e-7
Identity = 30/101 (29.70%), Postives = 54/101 (53.47%), Query Frame = 3
Query:  585 AFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVA----LVIQAFNKLDKTKDGFVTVEDLKGVYNVS 875
            AF ++D DG   +  +E    +   G + S+EE+  I E +D+D SGT+DF+EFL+ +   + + +       + + F   DK  DGFV  E+   + +++
Sbjct:   88 AFDMFDTDGGGDISTKELGTVMRMLGQNPSREELDAIIEEVDEDGSGTIDFEEFLVMMVQQLKEDQAGKSEEELSECFRIFDKNSDGFVDREEFGDILHMT 188          
BLAST of Calcyphosin protein vs. Ensembl Medaka
Match: tnnc2 (troponin C, skeletal muscle [Source:NCBI gene;Acc:101171829])

HSP 1 Score: 50.447 bits (119), Expect = 4.030e-7
Identity = 30/104 (28.85%), Postives = 50/104 (48.08%), Query Frame = 3
Query:  585 AFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIA----LRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHP 884
            AF ++D DG   +  +E    +   G + ++EE+  I E +D+D SGT+DF+EFL+     L+          + + F   DK  DG +  E+   +   S  P
Sbjct:   23 AFDMFDTDGGGDISTKELGTVMRMLGQNPTREELDEIIEEVDEDGSGTIDFEEFLVMMVRLLKEDQAGKSEEELAECFRVFDKNGDGVIDREEFAQIIRSSGEP 126          
BLAST of Calcyphosin protein vs. Ensembl Medaka
Match: calm2a (calmodulin 2 [Source:NCBI gene;Acc:100049420])

HSP 1 Score: 48.1358 bits (113), Expect = 1.805e-6
Identity = 28/95 (29.47%), Postives = 51/95 (53.68%), Query Frame = 3
Query:  582 RAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVI-QAFNKLDKTKDGFVTVEDLKGV 863
             AF ++D DG+ T+  +E    +   G + ++ E+Q +   +D D +GT+DF EFL  +   M  +     I +AF   DK  +G+++  +L+ V
Sbjct:   15 EAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHV 109          
BLAST of Calcyphosin protein vs. Ensembl Medaka
Match: ENSORLT00000008599.2 (calmodulin 3 [Source:NCBI gene;Acc:100049421])

HSP 1 Score: 48.1358 bits (113), Expect = 1.805e-6
Identity = 28/95 (29.47%), Postives = 51/95 (53.68%), Query Frame = 3
Query:  582 RAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVI-QAFNKLDKTKDGFVTVEDLKGV 863
             AF ++D DG+ T+  +E    +   G + ++ E+Q +   +D D +GT+DF EFL  +   M  +     I +AF   DK  +G+++  +L+ V
Sbjct:   15 EAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHV 109          
BLAST of Calcyphosin protein vs. Planmine SMEST
Match: SMESG000025859.1 (SMESG000025859.1)

HSP 1 Score: 388.267 bits (996), Expect = 2.756e-135
Identity = 205/206 (99.51%), Postives = 206/206 (100.00%), Query Frame = 3
Query:  447 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGF+TVEDLKGVYNVSKHPKYISGERTEEELFLEFLKNFEAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY
Sbjct:    1 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTEEELFLEFLKNFEAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 206          

HSP 2 Score: 64.3142 bits (155), Expect = 1.197e-11
Identity = 29/33 (87.88%), Postives = 30/33 (90.91%), Query Frame = 2
Query: 1094 ITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 1192
            +TK EFLNYYS VS SIDNDAYFDLMMRNAYKL
Sbjct:  176 VTKEEFLNYYSGVSASIDNDAYFDLMMRNAYKL 208          
BLAST of Calcyphosin protein vs. Planmine SMEST
Match: SMESG000005291.1 (SMESG000005291.1)

HSP 1 Score: 281.182 bits (718), Expect = 3.258e-93
Identity = 142/206 (68.93%), Postives = 175/206 (84.95%), Query Frame = 3
Query:  447 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            MA T+R N+ELQ++S +KL++A+DP+E+LRL CL+RGATGIKGL R FK++DDDG+ +LDF EF KG+ DYG  +   E+  IF  +D+DKSGTLDFDEFLIALRPPM+KSRV ++ +AF K+DKTKDG +TVEDLKGVY+   HPK+ SGE TE+++F EFLKNFEAP+EIDG VTKEEFLNYY G+SASIDNDAYFDLMMRNAY
Sbjct:    1 MAFTSRENKELQVQSNKKLQNATDPVERLRLMCLSRGATGIKGLSRTFKVFDDDGSRSLDFNEFKKGIADYGIVMDNNEIHEIFNQIDRDKSGTLDFDEFLIALRPPMSKSRVEMISKAFAKMDKTKDGAITVEDLKGVYSAVHHPKFKSGEWTEDQVFREFLKNFEAPEEIDGIVTKEEFLNYYCGISASIDNDAYFDLMMRNAY 206          

HSP 2 Score: 62.3882 bits (150), Expect = 4.768e-11
Identity = 27/34 (79.41%), Postives = 30/34 (88.24%), Query Frame = 2
Query: 1091 VITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 1192
            ++TK EFLNYY  +S SIDNDAYFDLMMRNAYKL
Sbjct:  175 IVTKEEFLNYYCGISASIDNDAYFDLMMRNAYKL 208          
BLAST of Calcyphosin protein vs. Planmine SMEST
Match: SMESG000005291.1 (SMESG000005291.1)

HSP 1 Score: 281.567 bits (719), Expect = 5.670e-93
Identity = 142/206 (68.93%), Postives = 175/206 (84.95%), Query Frame = 3
Query:  447 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            MA T+R N+ELQ++S +KL++A+DP+E+LRL CL+RGATGIKGL R FK++DDDG+ +LDF EF KG+ DYG  +   E+  IF  +D+DKSGTLDFDEFLIALRPPM+KSRV ++ +AF K+DKTKDG +TVEDLKGVY+   HPK+ SGE TE+++F EFLKNFEAP+EIDG VTKEEFLNYY G+SASIDNDAYFDLMMRNAY
Sbjct:    1 MAFTSRENKELQVQSNKKLQNATDPVERLRLMCLSRGATGIKGLSRTFKVFDDDGSRSLDFNEFKKGIADYGIVMDNNEIHEIFNQIDRDKSGTLDFDEFLIALRPPMSKSRVEMISKAFAKMDKTKDGAITVEDLKGVYSAVHHPKFKSGEWTEDQVFREFLKNFEAPEEIDGIVTKEEFLNYYCGISASIDNDAYFDLMMRNAY 206          

HSP 2 Score: 62.7734 bits (151), Expect = 6.379e-11
Identity = 27/34 (79.41%), Postives = 30/34 (88.24%), Query Frame = 2
Query: 1091 VITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 1192
            ++TK EFLNYY  +S SIDNDAYFDLMMRNAYKL
Sbjct:  175 IVTKEEFLNYYCGISASIDNDAYFDLMMRNAYKL 208          
BLAST of Calcyphosin protein vs. Planmine SMEST
Match: SMESG000017753.1 (SMESG000017753.1)

HSP 1 Score: 202.601 bits (514), Expect = 1.326e-62
Identity = 105/206 (50.97%), Postives = 152/206 (73.79%), Query Frame = 3
Query:  447 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            MA +++ + EL+MK++++L +A DP+ KLRLQCL  GA+GIKGL R F+I +DD +  L   EF  G+  +G  L+  E++ +F+ +D+D S T+   EFL ALRPP++ +R+ L+ +AF  +DKT DG +T+EDLK VYN +KHPK  +GE +E  +F EFLK+FEAP++ DG VT +EFL+YYS +S SIDN+ YFDLMMRN++
Sbjct:    1 MAFSDKDDMELRMKARKELSTAKDPLTKLRLQCLCNGASGIKGLSRRFRIMNDDNDRFLSQTEFKNGIKGFGLLLTDSEIEDLFKLMDRDGSNTICMTEFLRALRPPLSDNRLKLIKKAFTLMDKTGDGVITIEDLKHVYNATKHPKCQNGEWSETRVFQEFLKSFEAPNDADGIVTWDEFLDYYSSISNSIDNEGYFDLMMRNSF 206          

HSP 2 Score: 51.6026 bits (122), Expect = 2.199e-7
Identity = 21/34 (61.76%), Postives = 30/34 (88.24%), Query Frame = 2
Query: 1091 VITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 1192
            ++T  EFL+YYS++S SIDN+ YFDLMMRN++K+
Sbjct:  175 IVTWDEFLDYYSSISNSIDNEGYFDLMMRNSFKM 208          
BLAST of Calcyphosin protein vs. Planmine SMEST
Match: SMESG000072346.1 (SMESG000072346.1)

HSP 1 Score: 73.9442 bits (180), Expect = 3.632e-16
Identity = 45/74 (60.81%), Postives = 64/74 (86.49%), Query Frame = 3
Query:  843 VEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAY 1064
            ++D+KGVY++ K+ +Y++G+ TEE+ FLEFLKNFE  ++IDG VT EEFL+YYS +SASID D+YF+LMMRN++
Sbjct:   15 IDDVKGVYDIRKNSRYLNGDWTEEKCFLEFLKNFENQNQIDGIVTYEEFLDYYSVISASIDKDSYFNLMMRNSF 88          

HSP 2 Score: 48.521 bits (114), Expect = 3.503e-7
Identity = 20/33 (60.61%), Postives = 28/33 (84.85%), Query Frame = 2
Query: 1091 VITKREFLNYYSAVSCSIDNDAYFDLMMRNAYK 1189
            ++T  EFL+YYS +S SID D+YF+LMMRN++K
Sbjct:   57 IVTYEEFLDYYSVISASIDKDSYFNLMMRNSFK 89          
The following BLAST results are available for this feature:
BLAST of Calcyphosin protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CAPSL2.921e-7559.22calcyphosine like [Source:HGNC Symbol;Acc:HGNC:283... [more]
CAPSL2.921e-7559.22calcyphosine like [Source:HGNC Symbol;Acc:HGNC:283... [more]
CAPSL2.921e-7559.22calcyphosine like [Source:HGNC Symbol;Acc:HGNC:283... [more]
CAPSL8.804e-6758.95calcyphosine like [Source:HGNC Symbol;Acc:HGNC:283... [more]
CAPSL2.198e-5857.30calcyphosine like [Source:HGNC Symbol;Acc:HGNC:283... [more]
back to top
BLAST of Calcyphosin protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cal-41.658e-828.87CALmodulin related genes [Source:UniProtKB/TrEMBL... [more]
cal-41.747e-828.87CALmodulin related genes [Source:UniProtKB/TrEMBL... [more]
C50C3.52.528e-829.90Uncharacterized calcium-binding protein C50C3.5 [... [more]
cal-42.611e-828.87CALmodulin related genes [Source:UniProtKB/TrEMBL... [more]
cal-24.278e-726.37CALmodulin related genes; Calmodulin-like protein ... [more]
back to top
BLAST of Calcyphosin protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG101268.612e-6353.26gene:FBgn0038088 transcript:FBtr0082686[more]
CG101261.005e-6253.26gene:FBgn0038088 transcript:FBtr0082687[more]
CG313453.852e-6250.47gene:FBgn0051345 transcript:FBtr0082689[more]
Cam6.252e-730.53gene:FBgn0000253 transcript:FBtr0304964[more]
Cam6.252e-730.53gene:FBgn0000253 transcript:FBtr0088001[more]
back to top
BLAST of Calcyphosin protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
capslb2.119e-8563.59calcyphosine-like b [Source:ZFIN;Acc:ZDB-GENE-0504... [more]
capsla2.092e-6857.30calcyphosine-like a [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
CR749762.58.884e-928.85si:rp71-17i16.4 [Source:NCBI gene;Acc:100002038][more]
si:rp71-17i16.48.966e-928.85si:rp71-17i16.4 [Source:ZFIN;Acc:ZDB-GENE-090312-2... [more]
efcab21.632e-631.43EF-hand calcium binding domain 2 [Source:ZFIN;Acc:... [more]
back to top
BLAST of Calcyphosin protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
capsl1.928e-8261.17calcyphosine like [Source:NCBI gene;Acc:549278][more]
capsl7.571e-8059.22calcyphosine like [Source:NCBI gene;Acc:549278][more]
capsl1.966e-7760.20calcyphosine like [Source:NCBI gene;Acc:549278][more]
caps4.905e-7054.37calcyphosine [Source:NCBI gene;Acc:100037881][more]
ENSXETT00000016513.18.152e-1932.56calcyphosine 2 [Source:NCBI gene;Acc:100380015][more]
back to top
BLAST of Calcyphosin protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Capsl6.688e-7858.25calcyphosine-like [Source:MGI Symbol;Acc:MGI:19228... [more]
Capsl4.295e-3859.05calcyphosine-like [Source:MGI Symbol;Acc:MGI:19228... [more]
Caps28.827e-1531.52calcyphosphine 2 [Source:MGI Symbol;Acc:MGI:244198... [more]
Caps29.234e-1531.52calcyphosphine 2 [Source:MGI Symbol;Acc:MGI:244198... [more]
Tnnc27.841e-929.05troponin C2, fast [Source:MGI Symbol;Acc:MGI:98780... [more]
back to top
BLAST of Calcyphosin protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6P8Y1|CAPSL_MOUSE4.678e-7758.25Calcyphosin-like protein OS=Mus musculus OX=10090 ... [more]
sp|Q8WWF8|CAPSL_HUMAN1.403e-7459.22Calcyphosin-like protein OS=Homo sapiens OX=9606 G... [more]
sp|Q0VCC0|CAYP1_BOVIN2.062e-5152.49Calcyphosin OS=Bos taurus OX=9913 GN=CAPS PE=2 SV=... [more]
sp|Q13938|CAYP1_HUMAN2.895e-4851.38Calcyphosin OS=Homo sapiens OX=9606 GN=CAPS PE=1 S... [more]
sp|P41150|CAYP1_RABIT1.618e-4748.94Calcyphosin OS=Oryctolagus cuniculus OX=9986 GN=CA... [more]
back to top
BLAST of Calcyphosin protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564YA363.317e-8767.48Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
T2M8P38.604e-8765.53Calcyphosin-like protein OS=Hydra vulgaris OX=6087... [more]
A0A068YA961.153e-8668.45Calcyphosin protein OS=Echinococcus multilocularis... [more]
U6J8X41.666e-8668.45Calcyphosin protein OS=Echinococcus granulosus OX=... [more]
A0A267F2D91.117e-8366.67Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Calcyphosin protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
capslb5.026e-7859.22calcyphosine like [Source:NCBI gene;Acc:103021302][more]
capslb1.446e-7758.25calcyphosine like [Source:NCBI gene;Acc:103021302][more]
capsla3.619e-7060.87calcyphosin-like protein [Source:NCBI gene;Acc:103... [more]
si:rp71-17i16.44.170e-828.85troponin C, skeletal muscle [Source:NCBI gene;Acc:... [more]
si:rp71-17i16.45.087e-828.85troponin C, skeletal muscle [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Calcyphosin protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:rp71-17i16.42.800e-927.33si:rp71-17i16.4 [Source:ZFIN;Acc:ZDB-GENE-090312-2... [more]
CETN11.048e-730.85centrin 1 [Source:HGNC Symbol;Acc:HGNC:1866][more]
ENSPMAT00000006008.12.487e-729.47pep scaffold:Pmarinus_7.0:GL476713:142259:146509:-... [more]
CALM33.683e-729.47calmodulin 3 [Source:HGNC Symbol;Acc:HGNC:1449][more]
CALML33.827e-729.47calmodulin like 3 [Source:HGNC Symbol;Acc:HGNC:145... [more]
back to top
BLAST of Calcyphosin protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calcyphosin protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO329617.183e-8263.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329621.942e-4450.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337231.113e-3145.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO377273.677e-1932.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407751.277e-934.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calcyphosin protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
capslb8.324e-8058.94calcyphosine like [Source:NCBI gene;Acc:101171382][more]
si:rp71-17i16.41.140e-729.70troponin C, skeletal muscle [Source:NCBI gene;Acc:... [more]
tnnc24.030e-728.85troponin C, skeletal muscle [Source:NCBI gene;Acc:... [more]
calm2a1.805e-629.47calmodulin 2 [Source:NCBI gene;Acc:100049420][more]
ENSORLT00000008599.21.805e-629.47calmodulin 3 [Source:NCBI gene;Acc:100049421][more]
back to top
BLAST of Calcyphosin protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025859.12.756e-13599.51SMESG000025859.1[more]
SMESG000005291.13.258e-9368.93SMESG000005291.1[more]
SMESG000005291.15.670e-9368.93SMESG000005291.1[more]
SMESG000017753.11.326e-6250.97SMESG000017753.1[more]
SMESG000072346.13.632e-1660.81SMESG000072346.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022806 ID=SMED30022806|Name=Calcyphosin protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1387bp
TTAAAAAATAATCAACTTTTCAAAATTATTTGTAAAGTTGACTGATGTTG
ATATTGTTACATTTTGGTGATTTGGCGGCCATCTTGAATTAAGTGTTATT
ATTATCATCATCATCATTATCATTATCATTATCATCTAAAATAGTTATTT
TCATGATGATCGCCTAAATAAAAATGTCTTTTTATCTCAAAACAACATTC
TTTTAAATGTTTGTGAGTGATGATTAAGATTACATGTTTTACTGTTGTTT
AATTATTCTATCCGAAATATTTAGATAGTTAATTGTTCGGATAAATTGCA
ATCATTTCCTTCTCGCTGTTCATTGCTTTGGAATGAGAGAAGCATATTTG
ATGTTTTATATTTTTTATCCACTATTTTCAATTCAGTTCGACAAAAATTT
AAATAATAACTTAATTCTTGATTGTTTTCTCCAAACCTTACTAAGTATGG
CTCTAACTAATCGTGGAAACAGAGAATTGCAAATGAAATCAAAAGAAAAA
TTAAAGAGTGCTTCTGATCCAATGGAAAAGCTTCGTTTGCAATGTTTAGC
AAGAGGAGCTACAGGAATTAAAGGTTTAGGAAGAGCTTTTAAAATATATG
ATGACGATGGAAATAATACTTTGGATTTCAGAGAATTTAATAAAGGAGTT
AATGATTATGGATGCGATTTATCAAAGGAAGAAGTTCAATTCATTTTTGA
AGGTCTCGACAAAGACAAAAGTGGCACCTTGGATTTTGACGAATTCCTCA
TAGCTTTGCGACCACCAATGACAAAAAGTCGAGTTGCACTAGTTATTCAG
GCATTCAACAAATTAGATAAAACCAAAGACGGATTTGTAACAGTTGAAGA
CCTCAAAGGAGTTTACAATGTCAGCAAGCATCCAAAATATATCAGTGGAG
AAAGAACAGAAGAAGAATTGTTCTTGGAATTTTTGAAGAATTTTGAAGCT
CCAGATGAGATAGATGGAAAGGTTACTAAAGAGGAATTCCTCAATTATTA
CAGCGGGGTCAGCGCATCAATCGACAACGATGCGTATTTCGACCTAATGA
TGAGGAACGCGTATAAATTGTGACTGATTCCTCTATTAAAGTCATCACCA
AGCGAGAATTCCTCAATTATTATTCGGCAGTTAGCTGCTCTATTGACAAT
GATGCCTATTTTGATTTGATGATGAGAAATGCCTATAAACTGTGAATCAT
GTGGAACTTGTGTTTCGTAATATTTCAATCAAATTTGTATGAGGGGTCCT
CCTTGAGTCTTCATGAATGTTGCTGTCTGATGCTATAGTTTGGCATTTGC
AGATGATTTGGAAATATTTATATTTTATATTTTTTTCAAATTTTAATCTC
AATAAAAATTACTTAAATGTTGTTTTAAGTTGAAAGT
back to top

protein sequence of SMED30022806-orf-1

>SMED30022806-orf-1 ID=SMED30022806-orf-1|Name=SMED30022806-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=247bp
MREAYLMFYIFYPLFSIQFDKNLNNNLILDCFLQTLLSMALTNRGNRELQ
MKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFR
EFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSR
VALVIQAFNKLDKTKDGFVTVEDLKGVYNVSKHPKYISGERTEEELFLEF
LKNFEAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAYKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR002048EF_hand_dom
IPR011992EF-hand-dom_pair
IPR018247EF_Hand_1_Ca_BS
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002048EF-hand domainSMARTSM00054efh_1coord: 153..181
e-value: 4.3
score: 12.6
coord: 117..145
e-value: 0.0018
score: 27.5
coord: 81..109
e-value: 1.3
score: 17.0
IPR002048EF-hand domainPFAMPF13499EF-hand_7coord: 82..142
e-value: 1.7E-10
score: 41.2
IPR002048EF-hand domainPFAMPF13202EF-hand_5coord: 156..176
e-value: 5.6E-4
score: 19.3
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 113..148
score: 13.147
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 149..184
score: 11.194
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 77..112
score: 11.222
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 211..229
score: 6.424
IPR002048EF-hand domainCDDcd00051EFhcoord: 84..139
e-value: 8.98496E-14
score: 62.1801
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 61..146
e-value: 7.5E-22
score: 78.9
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 147..246
e-value: 7.0E-34
score: 118.4
NoneNo IPR availablePANTHERPTHR23064TROPONINcoord: 37..246
NoneNo IPR availablePANTHERPTHR23064:SF36coord: 37..246
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 126..138
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 90..102
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 79..244