slc12a-1

Overview
Nameslc12a-1 (AKN21475.1)
Smed IDSMED30022804
Length (bp)3395
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc12a-1 (SMED30022804) t-SNE clustered cells

Violin plots show distribution of expression levels for slc12a-1 (SMED30022804) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc12a-1 (SMED30022804) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc12a-1 (SMED30022804) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022804

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30022804SMESG000043221.1 SMESG000043220.1 dd_Smed_v4_4047_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30022804SMESG000043221.1 SMESG000043220.1 dd_Smed_v4_4047_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30022804SMESG000043221.1 SMESG000043220.1 dd_Smed_v4_4047_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30022804SMESG000043221.1 SMESG000043220.1 dd_Smed_v4_4047_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30022804SMESG000043221.1 SMESG000043220.1 dd_Smed_v4_4047_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022804SMESG000043221.1 SMESG000043220.1 dd_Smed_v4_4047_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30022804SMESG000043221.1 SMESG000043220.1 dd_Smed_v4_4047_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30022804SMESG000043221.1 SMESG000043220.1 dd_Smed_v4_4047_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022804SMESG000043221.1 SMESG000043220.1 dd_Smed_v4_4047_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30022804SMESG000043221.1 SMESG000043220.1 dd_Smed_v4_4047_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30022804SMESG000043221.1 SMESG000043220.1 dd_Smed_v4_4047_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
collecting ductSMED30022804SMESG000043221.1 SMESG000043220.1 Smed-slc12a-1smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc12a-1 vs. Ensembl Human
Match: SLC12A4 (solute carrier family 12 member 4 [Source:HGNC Symbol;Acc:HGNC:10913])

HSP 1 Score: 914.064 bits (2361), Expect = 0.000e+0
Identity = 479/1036 (46.24%), Postives = 667/1036 (64.38%), Query Frame = 2
Query:  314 DVKDETMALYQEDYSIMNSISGYL-RAMTYQTSVAGQKKN----------------PKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGF--VRSPERSEMVCFLGERLLTKSFWTI--------NKTLSCNKTMLEDYYCNG-NLTT-FCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVM----------PGVKGLGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSIS---CKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQA---RIDHLRKASLKDFHVDQSKL-VDTHQFTFS-PATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            D  D  +AL++E+  I   +S  L + ++Y     G K++                P +  ++GVYLP LQ+IFGVI+FLRL W++G +G LQ   +V ICC CT LT+ISMSAIATNG V +GGSYFMISR+LGP+FG A+G+ FYLG   A AMY++G IEILLTY+AP    F   P  +HD   A  NN R Y +  L  + ++V +GVK+V  FA + LACVIISI+ +Y GG   +  P     VC LG R L++  + I        N+T++   T L  ++C+  NLTT  CD YF  N V  +P +PG A+GV++ NLW  Y+ +G+++          P +K      V  D+ T+F VL+ I+FPSVTGIM GSN SGDL+D QK IP  TI A +TTS VY S V +F       VL DKYG  +   ++V  L WP  WV++IGS  ST GAGLQ L  APRLL AIAKD++IPFL+VF      GEP   LLL+   AE  +L+ ++D++AP++ +FFLM Y FVNLACA+Q +L  PNWRPRF+YYHW LS +G +L + ++F + WYY LV + +   IYKY+EY+GAEKEWGDGIRGL L+ A+Y+LL +EE   HTKNWRPQ+L+L K + DL +KYP+L++FA QLK G+GL I+ S+++G + +     +AQ  ++ +K  M   KVKGF Q +V S V+EG++ LIQS GLG ++ N+V++GWP+ W+  S++      F+D +    +A + +L+PK ++ YPS      +G ID+WWI+ DGG+LM+LP LL++H+VW +C +R+FTVA   DNSI MK  L  +LY LR++A VEVVE+ NSD ISAY +++TL+ME+R +++ QM+LT  E + E Q    R   LR  SL     D+S +  D  Q T++    + +  D        ++   + P+    ++MH AV+LN +I  +S +A LV+LN+PGPP+N    E Y+ +L VL+EGL RVLLVRG G+EVITIYS
Sbjct:   54 DYYDRNLALFEEELDIRPKVSSLLGKLVSYTNLTQGAKEHEEAESGEGTRRRAAEAPSMGTLMGVYLPCLQNIFGVILFLRLTWMVGTAGVLQALLIVLICCCCTLLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGLCFYLGTTFAAAMYILGAIEILLTYIAPPAAIFY--PSGAHDTSNATLNNMRVYGTIFLTFMTLVVFVGVKYVNKFASLFLACVIISILSIYAGGIKSIFDPPVFP-VCMLGNRTLSRDQFDICAKTAVVDNETVA---TQLWSFFCHSPNLTTDSCDPYFMLNNVTEIPGIPGAAAGVLQENLWSAYLEKGDIVEKHGLPSADAPSLKESLPLYVVADIATSFTVLVGIFFPSVTGIMAGSNRSGDLRDAQKSIPVGTILAIITTSLVYFSSVVLFGACIEGVVLRDKYGDGVSRNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHGKVNGEPTWALLLTALIAELGILIASLDMVAPILSMFFLMCYLFVNLACAVQTLLRTPNWRPRFKYYHWALSFLGMSLCLALMFVSSWYYALVAMLIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLLKLDEDLHVKYPRLLTFASQLKAGKGLTIVGSVIQGSFLES--YGEAQAAEQTIKNMMEIEKVKGFCQVVVASKVREGLAHLIQSCGLGGMRHNSVVLGWPYGWRQ-SEDPRAWKTFIDTVRCTTAAHLALLVPKNIAFYPSNHERYLEGHIDVWWIVHDGGMLMLLPFLLRQHKVWRKCRMRIFTVAQMDDNSIQMKKDLAVFLYHLRLEAEVEVVEMHNSD-ISAYTYERTLMMEQRSQMLRQMRLTKTEREREAQLVKDRHSALRLESLYSDEEDESAVGADKIQMTWTRDKYMTETWDPSHAPDNFRELVHIKPDQSNVRRMHTAVKLNEVIVTRSHDARLVLLNMPGPPRNSEGDENYMEFLEVLTEGLERVLLVRGGGREVITIYS 1079          
BLAST of slc12a-1 vs. Ensembl Human
Match: SLC12A4 (solute carrier family 12 member 4 [Source:HGNC Symbol;Acc:HGNC:10913])

HSP 1 Score: 914.064 bits (2361), Expect = 0.000e+0
Identity = 479/1036 (46.24%), Postives = 667/1036 (64.38%), Query Frame = 2
Query:  314 DVKDETMALYQEDYSIMNSISGYL-RAMTYQTSVAGQKKN----------------PKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGF--VRSPERSEMVCFLGERLLTKSFWTI--------NKTLSCNKTMLEDYYCNG-NLTT-FCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVM----------PGVKGLGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSIS---CKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQ---ARIDHLRKASLKDFHVDQSKL-VDTHQFTFS-PATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            D  D  +AL++E+  I   +S  L + ++Y     G K++                P +  ++GVYLP LQ+IFGVI+FLRL W++G +G LQ   +V ICC CT LT+ISMSAIATNG V +GGSYFMISR+LGP+FG A+G+ FYLG   A AMY++G IEILLTY+AP    F   P  +HD   A  NN R Y +  L  + ++V +GVK+V  FA + LACVIISI+ +Y GG   +  P     VC LG R L++  + I        N+T++   T L  ++C+  NLTT  CD YF  N V  +P +PG A+GV++ NLW  Y+ +G+++          P +K      V  D+ T+F VL+ I+FPSVTGIM GSN SGDL+D QK IP  TI A +TTS VY S V +F       VL DKYG  +   ++V  L WP  WV++IGS  ST GAGLQ L  APRLL AIAKD++IPFL+VF      GEP   LLL+   AE  +L+ ++D++AP++ +FFLM Y FVNLACA+Q +L  PNWRPRF+YYHW LS +G +L + ++F + WYY LV + +   IYKY+EY+GAEKEWGDGIRGL L+ A+Y+LL +EE   HTKNWRPQ+L+L K + DL +KYP+L++FA QLK G+GL I+ S+++G + +     +AQ  ++ +K  M   KVKGF Q +V S V+EG++ LIQS GLG ++ N+V++GWP+ W+  S++      F+D +    +A + +L+PK ++ YPS      +G ID+WWI+ DGG+LM+LP LL++H+VW +C +R+FTVA   DNSI MK  L  +LY LR++A VEVVE+ NSD ISAY +++TL+ME+R +++ QM+LT  E + E Q    R   LR  SL     D+S +  D  Q T++    + +  D        ++   + P+    ++MH AV+LN +I  +S +A LV+LN+PGPP+N    E Y+ +L VL+EGL RVLLVRG G+EVITIYS
Sbjct:   29 DYYDRNLALFEEELDIRPKVSSLLGKLVSYTNLTQGAKEHEEAESGEGTRRRAAEAPSMGTLMGVYLPCLQNIFGVILFLRLTWMVGTAGVLQALLIVLICCCCTLLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGLCFYLGTTFAAAMYILGAIEILLTYIAPPAAIFY--PSGAHDTSNATLNNMRVYGTIFLTFMTLVVFVGVKYVNKFASLFLACVIISILSIYAGGIKSIFDPPVFP-VCMLGNRTLSRDQFDICAKTAVVDNETVA---TQLWSFFCHSPNLTTDSCDPYFMLNNVTEIPGIPGAAAGVLQENLWSAYLEKGDIVEKHGLPSADAPSLKESLPLYVVADIATSFTVLVGIFFPSVTGIMAGSNRSGDLRDAQKSIPVGTILAIITTSLVYFSSVVLFGACIEGVVLRDKYGDGVSRNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHGKVNGEPTWALLLTALIAELGILIASLDMVAPILSMFFLMCYLFVNLACAVQTLLRTPNWRPRFKYYHWALSFLGMSLCLALMFVSSWYYALVAMLIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLLKLDEDLHVKYPRLLTFASQLKAGKGLTIVGSVIQGSFLES--YGEAQAAEQTIKNMMEIEKVKGFCQVVVASKVREGLAHLIQSCGLGGMRHNSVVLGWPYGWRQ-SEDPRAWKTFIDTVRCTTAAHLALLVPKNIAFYPSNHERYLEGHIDVWWIVHDGGMLMLLPFLLRQHKVWRKCRMRIFTVAQMDDNSIQMKKDLAVFLYHLRLEAEVEVVEMHNSD-ISAYTYERTLMMEQRSQMLRQMRLTKTEREREAQLVKDRHSALRLESLYSDEEDESAVGADKIQMTWTRDKYMTETWDPSHAPDNFRELVHIKPDQSNVRRMHTAVKLNEVIVTRSHDARLVLLNMPGPPRNSEGDENYMEFLEVLTEGLERVLLVRGGGREVITIYS 1054          
BLAST of slc12a-1 vs. Ensembl Human
Match: SLC12A4 (solute carrier family 12 member 4 [Source:HGNC Symbol;Acc:HGNC:10913])

HSP 1 Score: 914.064 bits (2361), Expect = 0.000e+0
Identity = 479/1036 (46.24%), Postives = 667/1036 (64.38%), Query Frame = 2
Query:  314 DVKDETMALYQEDYSIMNSISGYL-RAMTYQTSVAGQKKN----------------PKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGF--VRSPERSEMVCFLGERLLTKSFWTI--------NKTLSCNKTMLEDYYCNG-NLTT-FCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVM----------PGVKGLGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSIS---CKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQ---ARIDHLRKASLKDFHVDQSKL-VDTHQFTFS-PATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            D  D  +AL++E+  I   +S  L + ++Y     G K++                P +  ++GVYLP LQ+IFGVI+FLRL W++G +G LQ   +V ICC CT LT+ISMSAIATNG V +GGSYFMISR+LGP+FG A+G+ FYLG   A AMY++G IEILLTY+AP    F   P  +HD   A  NN R Y +  L  + ++V +GVK+V  FA + LACVIISI+ +Y GG   +  P     VC LG R L++  + I        N+T++   T L  ++C+  NLTT  CD YF  N V  +P +PG A+GV++ NLW  Y+ +G+++          P +K      V  D+ T+F VL+ I+FPSVTGIM GSN SGDL+D QK IP  TI A +TTS VY S V +F       VL DKYG  +   ++V  L WP  WV++IGS  ST GAGLQ L  APRLL AIAKD++IPFL+VF      GEP   LLL+   AE  +L+ ++D++AP++ +FFLM Y FVNLACA+Q +L  PNWRPRF+YYHW LS +G +L + ++F + WYY LV + +   IYKY+EY+GAEKEWGDGIRGL L+ A+Y+LL +EE   HTKNWRPQ+L+L K + DL +KYP+L++FA QLK G+GL I+ S+++G + +     +AQ  ++ +K  M   KVKGF Q +V S V+EG++ LIQS GLG ++ N+V++GWP+ W+  S++      F+D +    +A + +L+PK ++ YPS      +G ID+WWI+ DGG+LM+LP LL++H+VW +C +R+FTVA   DNSI MK  L  +LY LR++A VEVVE+ NSD ISAY +++TL+ME+R +++ QM+LT  E + E Q    R   LR  SL     D+S +  D  Q T++    + +  D        ++   + P+    ++MH AV+LN +I  +S +A LV+LN+PGPP+N    E Y+ +L VL+EGL RVLLVRG G+EVITIYS
Sbjct:   60 DYYDRNLALFEEELDIRPKVSSLLGKLVSYTNLTQGAKEHEEAESGEGTRRRAAEAPSMGTLMGVYLPCLQNIFGVILFLRLTWMVGTAGVLQALLIVLICCCCTLLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGLCFYLGTTFAAAMYILGAIEILLTYIAPPAAIFY--PSGAHDTSNATLNNMRVYGTIFLTFMTLVVFVGVKYVNKFASLFLACVIISILSIYAGGIKSIFDPPVFP-VCMLGNRTLSRDQFDICAKTAVVDNETVA---TQLWSFFCHSPNLTTDSCDPYFMLNNVTEIPGIPGAAAGVLQENLWSAYLEKGDIVEKHGLPSADAPSLKESLPLYVVADIATSFTVLVGIFFPSVTGIMAGSNRSGDLRDAQKSIPVGTILAIITTSLVYFSSVVLFGACIEGVVLRDKYGDGVSRNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHGKVNGEPTWALLLTALIAELGILIASLDMVAPILSMFFLMCYLFVNLACAVQTLLRTPNWRPRFKYYHWALSFLGMSLCLALMFVSSWYYALVAMLIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLLKLDEDLHVKYPRLLTFASQLKAGKGLTIVGSVIQGSFLES--YGEAQAAEQTIKNMMEIEKVKGFCQVVVASKVREGLAHLIQSCGLGGMRHNSVVLGWPYGWRQ-SEDPRAWKTFIDTVRCTTAAHLALLVPKNIAFYPSNHERYLEGHIDVWWIVHDGGMLMLLPFLLRQHKVWRKCRMRIFTVAQMDDNSIQMKKDLAVFLYHLRLEAEVEVVEMHNSD-ISAYTYERTLMMEQRSQMLRQMRLTKTEREREAQLVKDRHSALRLESLYSDEEDESAVGADKIQMTWTRDKYMTETWDPSHAPDNFRELVHIKPDQSNVRRMHTAVKLNEVIVTRSHDARLVLLNMPGPPRNSEGDENYMEFLEVLTEGLERVLLVRGGGREVITIYS 1085          
BLAST of slc12a-1 vs. Ensembl Human
Match: SLC12A6 (solute carrier family 12 member 6 [Source:HGNC Symbol;Acc:HGNC:10914])

HSP 1 Score: 910.598 bits (2352), Expect = 0.000e+0
Identity = 486/1091 (44.55%), Postives = 672/1091 (61.59%), Query Frame = 2
Query:  143 QNGDQNALLLNDENREHSVSFRDRHSIINDQKIGKLEVRKVSSGLTDNVEEGHESDDDVKDETMALYQEDYSIMNSISGYLRAMTYQTSVA--------------GQKK---NPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEM-VCFLGERLLTKSFWTI-NKTLSCNK----TMLEDYYCNGN--LTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVM--PGVKG------LGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSIS---CKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRKASLKDFHVDQSKLVDTHQFTFSPATLAQMKDVLEMKTTTKKSK---------KLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            Q+ D+  L  N    EHS    D H             +K  +   +N    +E  D+  D+ +AL++E+      +S  L  M   T++               G+KK    P++   +GVYLP LQ+IFGVI+FLRL W++G +G LQ F +V ICC CT LT+ISMSAIATNG V +GGSYFMISR LGP+FG A+G+ FYLG   A AMY++G IEI L Y+ P    F S    +  +  AM NN R Y +  L L+ ++V +GV++V  FA + LACVI+SI+ +Y G    S       VC LG R L+     + +KT   N     + L  ++CN +      CD+YF  N V  +  +PG ASG+I  NLW  Y+ +GE++  P  K       L    V  D+ T+F +L+ I+FPSVTGIM GSN SGDLKD QK IP  TI A LTTSFVYLS V +F       VL DK+G ++ G ++V  L WP  WV++IGS  ST GAGLQ L  APRLL AIAKD++IPFL+VF      GEP   LLL+   AE  +L+ ++DL+AP++ +FFLM Y FVNLACALQ +L  PNWRPRFRYYHW LS +G ++ + ++F + WYY +V + +   IYKY+EY+GAEKEWGDGIRGL L+ A+++LL +EE   HTKNWRPQ+L+L K + DL +K+P+L++FA QLK G+GL I+ S++ G++ +     +A   ++ +K  M   KVKGF Q +V + ++EGIS LIQS GLG +K NTV++GWP+ W+  S++      F+  +    +A + +L+ K +S +PS      +G ID+WWI+ DGG+LM+LP LLK+H+VW +C +R+FTVA   DNSI MK  L  +LY LRI+A VEVVE+ +SD ISAY +++TL+ME+R +++  M+L+  E D E Q   D      L     D+ +  +T+Q       +   KD   M +  +K+K          + P+    ++MH AV+LN +I  KS  A LV+LN+PGPP+N    E Y+ +L VL+EGL RVLLVRG G EVITIYS
Sbjct:   34 QDSDEPDLSQNSITGEHSQLLDDGH-------------KKARNAYLNN--SNYEEGDEYFDKNLALFEEEMDTRPKVSSLLNRMANYTNLTQGAKEHEEAENITEGKKKPTKTPQMGTFMGVYLPCLQNIFGVILFLRLTWVVGTAGVLQAFAIVLICCCCTMLTAISMSAIATNGVVPAGGSYFMISRALGPEFGGAVGLCFYLGTTFAAAMYILGAIEIFLVYIVPRAAIFHSD--DALKESAAMLNNMRVYGTAFLVLMVLVVFIGVRYVNKFASLFLACVIVSILAIYAGAIKSSFAPPHFPVCMLGNRTLSSRHIDVCSKTKEINNMTVPSKLWGFFCNSSQFFNATCDEYFVHNNVTSIQGIPGLASGIITENLWSNYLPKGEIIEKPSAKSSDVLGSLNHEYVLVDITTSFTLLVGIFFPSVTGIMAGSNRSGDLKDAQKSIPIGTILAILTTSFVYLSNVVLFGACIEGVVLRDKFGDAVKGNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHSKANGEPTWALLLTAAIAELGILIASLDLVAPILSMFFLMCYLFVNLACALQTLLRTPNWRPRFRYYHWALSFMGMSICLALMFISSWYYAIVAMVIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARFALLRLEEGPPHTKNWRPQLLVLLKLDEDLHVKHPRLLTFASQLKAGKGLTIVGSVIVGNFLEN--YGEALAAEQTIKHLMEAEKVKGFCQLVVAAKLREGISHLIQSCGLGGMKHNTVVMGWPNGWRQ-SEDARAWKTFIGTVRVTTAAHLALLVAKNISFFPSNVEQFSEGNIDVWWIVHDGGMLMLLPFLLKQHKVWRKCSIRIFTVAQLEDNSIQMKKDLATFLYHLRIEAEVEVVEMHDSD-ISAYTYERTLMMEQRSQMLRHMRLSKTERDREAQLVKDRNSMLRLTSIGSDEDEETETYQ---EKVHMTWTKDKY-MASRGQKAKSMEGFQDLLNMRPDQSNVRRMHTAVKLNEVIVNKSHEAKLVLLNMPGPPRNPEGDENYMEFLEVLTEGLERVLLVRGGGSEVITIYS 1099          
BLAST of slc12a-1 vs. Ensembl Human
Match: SLC12A4 (solute carrier family 12 member 4 [Source:HGNC Symbol;Acc:HGNC:10913])

HSP 1 Score: 907.901 bits (2345), Expect = 0.000e+0
Identity = 468/982 (47.66%), Postives = 647/982 (65.89%), Query Frame = 2
Query:  425 KNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGF--VRSPERSEMVCFLGERLLTKSFWTI--------NKTLSCNKTMLEDYYCNG-NLTT-FCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVM----------PGVKGLGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSIS---CKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQA---RIDHLRKASLKDFHVDQSKL-VDTHQFTFS-PATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            + P +  ++GVYLP LQ+IFGVI+FLRL W++G +G LQ   +V ICC CT LT+ISMSAIATNG V +GGSYFMISR+LGP+FG A+G+ FYLG   A AMY++G IEILLTY+AP    F   P  +HD   A  NN R Y +  L  + ++V +GVK+V  FA + LACVIISI+ +Y GG   +  P     VC LG R L++  + I        N+T++   T L  ++C+  NLTT  CD YF  N V  +P +PG A+GV++ NLW  Y+ +G+++          P +K      V  D+ T+F VL+ I+FPSVTGIM GSN SGDL+D QK IP  TI A +TTS VY S V +F       VL DKYG  +   ++V  L WP  WV++IGS  ST GAGLQ L  APRLL AIAKD++IPFL+VF      GEP   LLL+   AE  +L+ ++D++AP++ +FFLM Y FVNLACA+Q +L  PNWRPRF+YYHW LS +G +L + ++F + WYY LV + +   IYKY+EY+GAEKEWGDGIRGL L+ A+Y+LL +EE   HTKNWRPQ+L+L K + DL +KYP+L++FA QLK G+GL I+ S+++G + +     +AQ  ++ +K  M   KVKGF Q +V S V+EG++ LIQS GLG ++ N+V++GWP+ W+  S++      F+D +    +A + +L+PK ++ YPS      +G ID+WWI+ DGG+LM+LP LL++H+VW +C +R+FTVA   DNSI MK  L  +LY LR++A VEVVE+ NSD ISAY +++TL+ME+R +++ QM+LT  E + E Q    R   LR  SL     D+S +  D  Q T++    + +  D        ++   + P+    ++MH AV+LN +I  +S +A LV+LN+PGPP+N    E Y+ +L VL+EGL RVLLVRG G+EVITIYS
Sbjct:   66 EAPSMGTLMGVYLPCLQNIFGVILFLRLTWMVGTAGVLQALLIVLICCCCTLLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGLCFYLGTTFAAAMYILGAIEILLTYIAPPAAIFY--PSGAHDTSNATLNNMRVYGTIFLTFMTLVVFVGVKYVNKFASLFLACVIISILSIYAGGIKSIFDPPVFP-VCMLGNRTLSRDQFDICAKTAVVDNETVA---TQLWSFFCHSPNLTTDSCDPYFMLNNVTEIPGIPGAAAGVLQENLWSAYLEKGDIVEKHGLPSADAPSLKESLPLYVVADIATSFTVLVGIFFPSVTGIMAGSNRSGDLRDAQKSIPVGTILAIITTSLVYFSSVVLFGACIEGVVLRDKYGDGVSRNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHGKVNGEPTWALLLTALIAELGILIASLDMVAPILSMFFLMCYLFVNLACAVQTLLRTPNWRPRFKYYHWALSFLGMSLCLALMFVSSWYYALVAMLIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLLKLDEDLHVKYPRLLTFASQLKAGKGLTIVGSVIQGSFLES--YGEAQAAEQTIKNMMEIEKVKGFCQVVVASKVREGLAHLIQSCGLGGMRHNSVVLGWPYGWRQ-SEDPRAWKTFIDTVRCTTAAHLALLVPKNIAFYPSNHERYLEGHIDVWWIVHDGGMLMLLPFLLRQHKVWRKCRMRIFTVAQMDDNSIQMKKDLAVFLYHLRLEAEVEVVEMHNSD-ISAYTYERTLMMEQRSQMLRQMRLTKTEREREAQLVKDRHSALRLESLYSDEEDESAVGADKIQMTWTRDKYMTETWDPSHAPDNFRELVHIKPDQSNVRRMHTAVKLNEVIVTRSHDARLVLLNMPGPPRNSEGDENYMEFLEVLTEGLERVLLVRGGGREVITIYS 1037          
BLAST of slc12a-1 vs. Ensembl Celegans
Match: kcc-1 (K+/Cl-Cotransporter [Source:UniProtKB/TrEMBL;Acc:S6FWN4])

HSP 1 Score: 832.402 bits (2149), Expect = 0.000e+0
Identity = 475/1085 (43.78%), Postives = 678/1085 (62.49%), Query Frame = 2
Query:  155 QNALLLNDENREHSVSFRDRHSIINDQKIGKLEVRKVSSGLTDNVEEGHESDDDVKDETMALYQEDYSIMNSISGYLRA--------MTYQTSVAGQKKNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMF----NNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRS--PERSEMVCFLGERLLTKSFWTINKTL---------SCNKTMLEDYYCNG--NLTTFCDDYFKANPVQYLPAMPGYASG-VIKSNLWPVYMSEGEVMPGVKGLGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCK---TNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSD--VKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHE-FLDAIHRVVSAEICMLIPKGVSEYPS--ISCKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMK----------LTAKEVDLEPQARIDHLRKASLKDFHVDQSKLVDTHQFTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPP--KNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVIT 3268
            Q+  +++ EN  + ++  D H  I+   +G  E+    +           + D   +  +AL++E    M   S YL+A            +S  G      L  ++GVYLPT+QHI GV MF+RL+W++G +G  Q F ++F+CC CTFLT IS+SA+ATNG V+SGG+YFMISRNLGP+FGSA+GILFYL N +AT+MYLVG +EILL Y+ P L  F    G  HD  T+MF    N+ R Y++ LL + F IVA+GVKFVQ+ AP++L CVI+SI+  Y GG  ++  P+  + VC   +RLL  S   +N+++         + N T L D  C G  N TT        +P + +   PG+  G  +  NL P Y+ +GE   G +     DV +D+ T+FFVLLAIYFP+VTGI TG+NMSGDLK+PQ  IP  TIAA LTTSFVY S   IF G     VL DK G S+GG M+VA L WP  WVLLIGS  STFGA LQCLCSAPRLL AIAKD+VIP L  F  +T   EPF  L+L+   AE A+L+G++D IA +VD FFLM YAFVN+ C L ++L APNWRPRF+YYHWFLSL+GA L  FI+F+T+W Y +V   L L IYKYVE++GA+KEWGDGIRGL L  A+YSL+ IE+ E H KNWRPQ+L+L     +   + ++Y  L++ A QLK G+GL ++ + ++GD    D + K ++VK  +   M   +++GF +T+V S+  V+  +STL+QS+GLG LKPNT+++ WP   +   +E+  E+  F++ +H     ++ +++ KG+ ++PS      G ID++WI+ DGGL +++  LLK+H+VW  C++RV  +A +SDN++ M++ L K++Y LRI A + +VEL + + IS    ++TL+MEER  ++  ++          L        P   +   R+A+ KD   D+    ++ + T   +T    +     +T TKK +    +  +  KMH AV LN L+ + S N+ L++LNLP PP  K++ +L+ Y++YL V+++ L RV+ VRGTGKEVIT
Sbjct:   10 QSDTVISPENAGNGLA--DHHRNISTASVGDRELYAWGT-----------NKDAGGNHNLALFEEPS--MPFFSSYLKAHITPGPLERAQSSSHGGHGAKADLGVLLGVYLPTIQHILGVTMFIRLFWLVGIAGLGQTFLLLFLCCFCTFLTCISISAVATNGVVESGGAYFMISRNLGPEFGSAVGILFYLANTVATSMYLVGGVEILLLYIFPGL-TFGGVEGQ-HD--TSMFGTMTNSLRFYSTILLLIEFAIVAMGVKFVQMLAPVSLVCVILSILACYAGGVTKTIYPDSGQYVCMYNDRLLQSSA-VLNESIPLDEICNYCNINNTFLADRVCGGRCNSTTIP----HVSPFRCINGFPGFQGGQTLLENLGPNYLEKGEAAHGTQADTKSDVYQDVRTSFFVLLAIYFPAVTGIFTGANMSGDLKNPQASIPAGTIAANLTTSFVYFSLAFIFGGAIDNAVLRDKNGQSVGGQMVVALLSWPSPWVLLIGSFLSTFGAALQCLCSAPRLLQAIAKDEVIPLLSPFKKVTANNEPFLGLILTTIIAEIAILMGSMDTIAAVVDFFFLMCYAFVNIICTLHSLLGAPNWRPRFKYYHWFLSLLGAVLCFFIMFSTHWDYAIVACLLCLVIYKYVEWKGAKKEWGDGIRGLALTTAQYSLMKIEDKEPHPKNWRPQLLLLLSMQWSKEIIDVRYLNLLNLASQLKAGKGLTVVTAFLQGDPTSPDDKKKGEQVKARMDFDMNQVRLRGFAKTLVHSEDQVRGSMSTLVQSVGLGGLKPNTMLISWPVHER---EEDMTEYNTFIEKVHAASINDMAIVVAKGIIDFPSAVFRMSGMIDVYWIVHDGGLCLLMGYLLKQHKVWRGCKLRVIGIAQESDNNVKMQEDLQKYVYQLRIDAKIMIVELADPE-ISKNAFERTLLMEERTMMMRDLQKVSGGGMSLSLPPANAPRAPSPLVTSERRANSKD--SDEGTPTESEETTEKKSTSTDNEQA-NQETKTKKERMKALDRSKVSKMHTAVRLNELLLQHSANSQLILLNLPKPPVHKDQQALDDYVHYLEVMTDKLNRVIFVRGTGKEVIT 1063          
BLAST of slc12a-1 vs. Ensembl Celegans
Match: kcc-1 (K+/Cl-Cotransporter [Source:UniProtKB/TrEMBL;Acc:S6FWN4])

HSP 1 Score: 832.402 bits (2149), Expect = 0.000e+0
Identity = 475/1085 (43.78%), Postives = 678/1085 (62.49%), Query Frame = 2
Query:  155 QNALLLNDENREHSVSFRDRHSIINDQKIGKLEVRKVSSGLTDNVEEGHESDDDVKDETMALYQEDYSIMNSISGYLRA--------MTYQTSVAGQKKNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMF----NNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRS--PERSEMVCFLGERLLTKSFWTINKTL---------SCNKTMLEDYYCNG--NLTTFCDDYFKANPVQYLPAMPGYASG-VIKSNLWPVYMSEGEVMPGVKGLGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCK---TNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSD--VKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHE-FLDAIHRVVSAEICMLIPKGVSEYPS--ISCKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMK----------LTAKEVDLEPQARIDHLRKASLKDFHVDQSKLVDTHQFTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPP--KNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVIT 3268
            Q+  +++ EN  + ++  D H  I+   +G  E+    +           + D   +  +AL++E    M   S YL+A            +S  G      L  ++GVYLPT+QHI GV MF+RL+W++G +G  Q F ++F+CC CTFLT IS+SA+ATNG V+SGG+YFMISRNLGP+FGSA+GILFYL N +AT+MYLVG +EILL Y+ P L  F    G  HD  T+MF    N+ R Y++ LL + F IVA+GVKFVQ+ AP++L CVI+SI+  Y GG  ++  P+  + VC   +RLL  S   +N+++         + N T L D  C G  N TT        +P + +   PG+  G  +  NL P Y+ +GE   G +     DV +D+ T+FFVLLAIYFP+VTGI TG+NMSGDLK+PQ  IP  TIAA LTTSFVY S   IF G     VL DK G S+GG M+VA L WP  WVLLIGS  STFGA LQCLCSAPRLL AIAKD+VIP L  F  +T   EPF  L+L+   AE A+L+G++D IA +VD FFLM YAFVN+ C L ++L APNWRPRF+YYHWFLSL+GA L  FI+F+T+W Y +V   L L IYKYVE++GA+KEWGDGIRGL L  A+YSL+ IE+ E H KNWRPQ+L+L     +   + ++Y  L++ A QLK G+GL ++ + ++GD    D + K ++VK  +   M   +++GF +T+V S+  V+  +STL+QS+GLG LKPNT+++ WP   +   +E+  E+  F++ +H     ++ +++ KG+ ++PS      G ID++WI+ DGGL +++  LLK+H+VW  C++RV  +A +SDN++ M++ L K++Y LRI A + +VEL + + IS    ++TL+MEER  ++  ++          L        P   +   R+A+ KD   D+    ++ + T   +T    +     +T TKK +    +  +  KMH AV LN L+ + S N+ L++LNLP PP  K++ +L+ Y++YL V+++ L RV+ VRGTGKEVIT
Sbjct:  100 QSDTVISPENAGNGLA--DHHRNISTASVGDRELYAWGT-----------NKDAGGNHNLALFEEPS--MPFFSSYLKAHITPGPLERAQSSSHGGHGAKADLGVLLGVYLPTIQHILGVTMFIRLFWLVGIAGLGQTFLLLFLCCFCTFLTCISISAVATNGVVESGGAYFMISRNLGPEFGSAVGILFYLANTVATSMYLVGGVEILLLYIFPGL-TFGGVEGQ-HD--TSMFGTMTNSLRFYSTILLLIEFAIVAMGVKFVQMLAPVSLVCVILSILACYAGGVTKTIYPDSGQYVCMYNDRLLQSSA-VLNESIPLDEICNYCNINNTFLADRVCGGRCNSTTIP----HVSPFRCINGFPGFQGGQTLLENLGPNYLEKGEAAHGTQADTKSDVYQDVRTSFFVLLAIYFPAVTGIFTGANMSGDLKNPQASIPAGTIAANLTTSFVYFSLAFIFGGAIDNAVLRDKNGQSVGGQMVVALLSWPSPWVLLIGSFLSTFGAALQCLCSAPRLLQAIAKDEVIPLLSPFKKVTANNEPFLGLILTTIIAEIAILMGSMDTIAAVVDFFFLMCYAFVNIICTLHSLLGAPNWRPRFKYYHWFLSLLGAVLCFFIMFSTHWDYAIVACLLCLVIYKYVEWKGAKKEWGDGIRGLALTTAQYSLMKIEDKEPHPKNWRPQLLLLLSMQWSKEIIDVRYLNLLNLASQLKAGKGLTVVTAFLQGDPTSPDDKKKGEQVKARMDFDMNQVRLRGFAKTLVHSEDQVRGSMSTLVQSVGLGGLKPNTMLISWPVHER---EEDMTEYNTFIEKVHAASINDMAIVVAKGIIDFPSAVFRMSGMIDVYWIVHDGGLCLLMGYLLKQHKVWRGCKLRVIGIAQESDNNVKMQEDLQKYVYQLRIDAKIMIVELADPE-ISKNAFERTLLMEERTMMMRDLQKVSGGGMSLSLPPANAPRAPSPLVTSERRANSKD--SDEGTPTESEETTEKKSTSTDNEQA-NQETKTKKERMKALDRSKVSKMHTAVRLNELLLQHSANSQLILLNLPKPPVHKDQQALDDYVHYLEVMTDKLNRVIFVRGTGKEVIT 1153          
BLAST of slc12a-1 vs. Ensembl Celegans
Match: kcc-1 (K+/Cl-Cotransporter [Source:UniProtKB/TrEMBL;Acc:S6FWN4])

HSP 1 Score: 831.632 bits (2147), Expect = 0.000e+0
Identity = 475/1085 (43.78%), Postives = 678/1085 (62.49%), Query Frame = 2
Query:  155 QNALLLNDENREHSVSFRDRHSIINDQKIGKLEVRKVSSGLTDNVEEGHESDDDVKDETMALYQEDYSIMNSISGYLRA--------MTYQTSVAGQKKNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMF----NNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRS--PERSEMVCFLGERLLTKSFWTINKTL---------SCNKTMLEDYYCNG--NLTTFCDDYFKANPVQYLPAMPGYASG-VIKSNLWPVYMSEGEVMPGVKGLGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCK---TNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSD--VKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHE-FLDAIHRVVSAEICMLIPKGVSEYPS--ISCKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMK----------LTAKEVDLEPQARIDHLRKASLKDFHVDQSKLVDTHQFTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPP--KNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVIT 3268
            Q+  +++ EN  + ++  D H  I+   +G  E+    +           + D   +  +AL++E    M   S YL+A            +S  G      L  ++GVYLPT+QHI GV MF+RL+W++G +G  Q F ++F+CC CTFLT IS+SA+ATNG V+SGG+YFMISRNLGP+FGSA+GILFYL N +AT+MYLVG +EILL Y+ P L  F    G  HD  T+MF    N+ R Y++ LL + F IVA+GVKFVQ+ AP++L CVI+SI+  Y GG  ++  P+  + VC   +RLL  S   +N+++         + N T L D  C G  N TT        +P + +   PG+  G  +  NL P Y+ +GE   G +     DV +D+ T+FFVLLAIYFP+VTGI TG+NMSGDLK+PQ  IP  TIAA LTTSFVY S   IF G     VL DK G S+GG M+VA L WP  WVLLIGS  STFGA LQCLCSAPRLL AIAKD+VIP L  F  +T   EPF  L+L+   AE A+L+G++D IA +VD FFLM YAFVN+ C L ++L APNWRPRF+YYHWFLSL+GA L  FI+F+T+W Y +V   L L IYKYVE++GA+KEWGDGIRGL L  A+YSL+ IE+ E H KNWRPQ+L+L     +   + ++Y  L++ A QLK G+GL ++ + ++GD    D + K ++VK  +   M   +++GF +T+V S+  V+  +STL+QS+GLG LKPNT+++ WP   +   +E+  E+  F++ +H     ++ +++ KG+ ++PS      G ID++WI+ DGGL +++  LLK+H+VW  C++RV  +A +SDN++ M++ L K++Y LRI A + +VEL + + IS    ++TL+MEER  ++  ++          L        P   +   R+A+ KD   D+    ++ + T   +T    +     +T TKK +    +  +  KMH AV LN L+ + S N+ L++LNLP PP  K++ +L+ Y++YL V+++ L RV+ VRGTGKEVIT
Sbjct:   42 QSDTVISPENAGNGLA--DHHRNISTASVGDRELYAWGT-----------NKDAGGNHNLALFEEPS--MPFFSSYLKAHITPGPLERAQSSSHGGHGAKADLGVLLGVYLPTIQHILGVTMFIRLFWLVGIAGLGQTFLLLFLCCFCTFLTCISISAVATNGVVESGGAYFMISRNLGPEFGSAVGILFYLANTVATSMYLVGGVEILLLYIFPGL-TFGGVEGQ-HD--TSMFGTMTNSLRFYSTILLLIEFAIVAMGVKFVQMLAPVSLVCVILSILACYAGGVTKTIYPDSGQYVCMYNDRLLQSSA-VLNESIPLDEICNYCNINNTFLADRVCGGRCNSTTIP----HVSPFRCINGFPGFQGGQTLLENLGPNYLEKGEAAHGTQADTKSDVYQDVRTSFFVLLAIYFPAVTGIFTGANMSGDLKNPQASIPAGTIAANLTTSFVYFSLAFIFGGAIDNAVLRDKNGQSVGGQMVVALLSWPSPWVLLIGSFLSTFGAALQCLCSAPRLLQAIAKDEVIPLLSPFKKVTANNEPFLGLILTTIIAEIAILMGSMDTIAAVVDFFFLMCYAFVNIICTLHSLLGAPNWRPRFKYYHWFLSLLGAVLCFFIMFSTHWDYAIVACLLCLVIYKYVEWKGAKKEWGDGIRGLALTTAQYSLMKIEDKEPHPKNWRPQLLLLLSMQWSKEIIDVRYLNLLNLASQLKAGKGLTVVTAFLQGDPTSPDDKKKGEQVKARMDFDMNQVRLRGFAKTLVHSEDQVRGSMSTLVQSVGLGGLKPNTMLISWPVHER---EEDMTEYNTFIEKVHAASINDMAIVVAKGIIDFPSAVFRMSGMIDVYWIVHDGGLCLLMGYLLKQHKVWRGCKLRVIGIAQESDNNVKMQEDLQKYVYQLRIDAKIMIVELADPE-ISKNAFERTLLMEERTMMMRDLQKVSGGGMSLSLPPANAPRAPSPLVTSERRANSKD--SDEGTPTESEETTEKKSTSTDNEQA-NQETKTKKERMKALDRSKVSKMHTAVRLNELLLQHSANSQLILLNLPKPPVHKDQQALDDYVHYLEVMTDKLNRVIFVRGTGKEVIT 1095          
BLAST of slc12a-1 vs. Ensembl Celegans
Match: kcc-1 (K+/Cl-Cotransporter [Source:UniProtKB/TrEMBL;Acc:S6FWN4])

HSP 1 Score: 831.632 bits (2147), Expect = 0.000e+0
Identity = 467/1033 (45.21%), Postives = 658/1033 (63.70%), Query Frame = 2
Query:  311 DDVKDETMALYQEDYSIMNSISGYLRA--------MTYQTSVAGQKKNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMF----NNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRS--PERSEMVCFLGERLLTKSFWTINKTL---------SCNKTMLEDYYCNG--NLTTFCDDYFKANPVQYLPAMPGYASG-VIKSNLWPVYMSEGEVMPGVKGLGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCK---TNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSD--VKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHE-FLDAIHRVVSAEICMLIPKGVSEYPS--ISCKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMK----------LTAKEVDLEPQARIDHLRKASLKDFHVDQSKLVDTHQFTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPP--KNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVIT 3268
            D   +  +AL++E    M   S YL+A            +S  G      L  ++GVYLPT+QHI GV MF+RL+W++G +G  Q F ++F+CC CTFLT IS+SA+ATNG V+SGG+YFMISRNLGP+FGSA+GILFYL N +AT+MYLVG +EILL Y+ P L  F    G  HD  T+MF    N+ R Y++ LL + F IVA+GVKFVQ+ AP++L CVI+SI+  Y GG  ++  P+  + VC   +RLL  S   +N+++         + N T L D  C G  N TT        +P + +   PG+  G  +  NL P Y+ +GE   G +     DV +D+ T+FFVLLAIYFP+VTGI TG+NMSGDLK+PQ  IP  TIAA LTTSFVY S   IF G     VL DK G S+GG M+VA L WP  WVLLIGS  STFGA LQCLCSAPRLL AIAKD+VIP L  F  +T   EPF  L+L+   AE A+L+G++D IA +VD FFLM YAFVN+ C L ++L APNWRPRF+YYHWFLSL+GA L  FI+F+T+W Y +V   L L IYKYVE++GA+KEWGDGIRGL L  A+YSL+ IE+ E H KNWRPQ+L+L     +   + ++Y  L++ A QLK G+GL ++ + ++GD    D + K ++VK  +   M   +++GF +T+V S+  V+  +STL+QS+GLG LKPNT+++ WP   +   +E+  E+  F++ +H     ++ +++ KG+ ++PS      G ID++WI+ DGGL +++  LLK+H+VW  C++RV  +A +SDN++ M++ L K++Y LRI A + +VEL + + IS    ++TL+MEER  ++  ++          L        P   +   R+A+ KD   D+    ++ + T   +T    +     +T TKK +    +  +  KMH AV LN L+ + S N+ L++LNLP PP  K++ +L+ Y++YL V+++ L RV+ VRGTGKEVIT
Sbjct:   94 DAGGNHNLALFEEPS--MPFFSSYLKAHITPGPLERAQSSSHGGHGAKADLGVLLGVYLPTIQHILGVTMFIRLFWLVGIAGLGQTFLLLFLCCFCTFLTCISISAVATNGVVESGGAYFMISRNLGPEFGSAVGILFYLANTVATSMYLVGGVEILLLYIFPGL-TFGGVEGQ-HD--TSMFGTMTNSLRFYSTILLLIEFAIVAMGVKFVQMLAPVSLVCVILSILACYAGGVTKTIYPDSGQYVCMYNDRLLQSSA-VLNESIPLDEICNYCNINNTFLADRVCGGRCNSTTIP----HVSPFRCINGFPGFQGGQTLLENLGPNYLEKGEAAHGTQADTKSDVYQDVRTSFFVLLAIYFPAVTGIFTGANMSGDLKNPQASIPAGTIAANLTTSFVYFSLAFIFGGAIDNAVLRDKNGQSVGGQMVVALLSWPSPWVLLIGSFLSTFGAALQCLCSAPRLLQAIAKDEVIPLLSPFKKVTANNEPFLGLILTTIIAEIAILMGSMDTIAAVVDFFFLMCYAFVNIICTLHSLLGAPNWRPRFKYYHWFLSLLGAVLCFFIMFSTHWDYAIVACLLCLVIYKYVEWKGAKKEWGDGIRGLALTTAQYSLMKIEDKEPHPKNWRPQLLLLLSMQWSKEIIDVRYLNLLNLASQLKAGKGLTVVTAFLQGDPTSPDDKKKGEQVKARMDFDMNQVRLRGFAKTLVHSEDQVRGSMSTLVQSVGLGGLKPNTMLISWPVHER---EEDMTEYNTFIEKVHAASINDMAIVVAKGIIDFPSAVFRMSGMIDVYWIVHDGGLCLLMGYLLKQHKVWRGCKLRVIGIAQESDNNVKMQEDLQKYVYQLRIDAKIMIVELADPE-ISKNAFERTLLMEERTMMMRDLQKVSGGGMSLSLPPANAPRAPSPLVTSERRANSKD--SDEGTPTESEETTEKKSTSTDNEQA-NQETKTKKERMKALDRSKVSKMHTAVRLNELLLQHSANSQLILLNLPKPPVHKDQQALDDYVHYLEVMTDKLNRVIFVRGTGKEVIT 1108          
BLAST of slc12a-1 vs. Ensembl Celegans
Match: kcc-1 (K+/Cl-Cotransporter [Source:UniProtKB/TrEMBL;Acc:S6FWN4])

HSP 1 Score: 830.476 bits (2144), Expect = 0.000e+0
Identity = 467/1035 (45.12%), Postives = 659/1035 (63.67%), Query Frame = 2
Query:  305 SDDDVKDETMALYQEDYSIMNSISGYLRA--------MTYQTSVAGQKKNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMF----NNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRS--PERSEMVCFLGERLLTKSFWTINKTL---------SCNKTMLEDYYCNG--NLTTFCDDYFKANPVQYLPAMPGYASG-VIKSNLWPVYMSEGEVMPGVKGLGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCK---TNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSD--VKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHE-FLDAIHRVVSAEICMLIPKGVSEYPS--ISCKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMK----------LTAKEVDLEPQARIDHLRKASLKDFHVDQSKLVDTHQFTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPP--KNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVIT 3268
            + D   +  +AL++E    M   S YL+A            +S  G      L  ++GVYLPT+QHI GV MF+RL+W++G +G  Q F ++F+CC CTFLT IS+SA+ATNG V+SGG+YFMISRNLGP+FGSA+GILFYL N +AT+MYLVG +EILL Y+ P L  F    G  HD  T+MF    N+ R Y++ LL + F IVA+GVKFVQ+ AP++L CVI+SI+  Y GG  ++  P+  + VC   +RLL  S   +N+++         + N T L D  C G  N TT        +P + +   PG+  G  +  NL P Y+ +GE   G +     DV +D+ T+FFVLLAIYFP+VTGI TG+NMSGDLK+PQ  IP  TIAA LTTSFVY S   IF G     VL DK G S+GG M+VA L WP  WVLLIGS  STFGA LQCLCSAPRLL AIAKD+VIP L  F  +T   EPF  L+L+   AE A+L+G++D IA +VD FFLM YAFVN+ C L ++L APNWRPRF+YYHWFLSL+GA L  FI+F+T+W Y +V   L L IYKYVE++GA+KEWGDGIRGL L  A+YSL+ IE+ E H KNWRPQ+L+L     +   + ++Y  L++ A QLK G+GL ++ + ++GD    D + K ++VK  +   M   +++GF +T+V S+  V+  +STL+QS+GLG LKPNT+++ WP   +   +E+  E+  F++ +H     ++ +++ KG+ ++PS      G ID++WI+ DGGL +++  LLK+H+VW  C++RV  +A +SDN++ M++ L K++Y LRI A + +VEL + + IS    ++TL+MEER  ++  ++          L        P   +   R+A+ KD   D+    ++ + T   +T    +     +T TKK +    +  +  KMH AV LN L+ + S N+ L++LNLP PP  K++ +L+ Y++YL V+++ L RV+ VRGTGKEVIT
Sbjct:   16 NKDAGGNHNLALFEEPS--MPFFSSYLKAHITPGPLERAQSSSHGGHGAKADLGVLLGVYLPTIQHILGVTMFIRLFWLVGIAGLGQTFLLLFLCCFCTFLTCISISAVATNGVVESGGAYFMISRNLGPEFGSAVGILFYLANTVATSMYLVGGVEILLLYIFPGL-TFGGVEGQ-HD--TSMFGTMTNSLRFYSTILLLIEFAIVAMGVKFVQMLAPVSLVCVILSILACYAGGVTKTIYPDSGQYVCMYNDRLLQSSA-VLNESIPLDEICNYCNINNTFLADRVCGGRCNSTTIP----HVSPFRCINGFPGFQGGQTLLENLGPNYLEKGEAAHGTQADTKSDVYQDVRTSFFVLLAIYFPAVTGIFTGANMSGDLKNPQASIPAGTIAANLTTSFVYFSLAFIFGGAIDNAVLRDKNGQSVGGQMVVALLSWPSPWVLLIGSFLSTFGAALQCLCSAPRLLQAIAKDEVIPLLSPFKKVTANNEPFLGLILTTIIAEIAILMGSMDTIAAVVDFFFLMCYAFVNIICTLHSLLGAPNWRPRFKYYHWFLSLLGAVLCFFIMFSTHWDYAIVACLLCLVIYKYVEWKGAKKEWGDGIRGLALTTAQYSLMKIEDKEPHPKNWRPQLLLLLSMQWSKEIIDVRYLNLLNLASQLKAGKGLTVVTAFLQGDPTSPDDKKKGEQVKARMDFDMNQVRLRGFAKTLVHSEDQVRGSMSTLVQSVGLGGLKPNTMLISWPVHER---EEDMTEYNTFIEKVHAASINDMAIVVAKGIIDFPSAVFRMSGMIDVYWIVHDGGLCLLMGYLLKQHKVWRGCKLRVIGIAQESDNNVKMQEDLQKYVYQLRIDAKIMIVELADPE-ISKNAFERTLLMEERTMMMRDLQKVSGGGMSLSLPPANAPRAPSPLVTSERRANSKD--SDEGTPTESEETTEKKSTSTDNEQA-NQETKTKKERMKALDRSKVSKMHTAVRLNELLLQHSANSQLILLNLPKPPVHKDQQALDDYVHYLEVMTDKLNRVIFVRGTGKEVIT 1032          
BLAST of slc12a-1 vs. Ensembl Fly
Match: kcc (gene:FBgn0261794 transcript:FBtr0072136)

HSP 1 Score: 896.345 bits (2315), Expect = 0.000e+0
Identity = 487/1062 (45.86%), Postives = 673/1062 (63.37%), Query Frame = 2
Query:  176 DENREHSVSFRDRHSIINDQKIGKLEVRKVSSGLTDNVEEGHESDDDVKDETMALYQEDY-------SIMNSISGYLRAMTYQTSVAGQKKNP--KLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGF--VRSPERSEMVCFLGERLLTKSFWTINKTLSCNK--TMLEDYYC-NGNLTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVMP---------GVKGLGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSISCK--GTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRKASLKDFHVDQSKLVDTHQFTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKN--KHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            D N++ S S +    I +D+ +G+       SG     EE  +S     D  + LY +D        + ++SI+ Y   +   T    +   P  ++  +IGV+LP +Q+IFGVI+F+RL W++G +G + GF +V  CC  T LT+ISMSAIATNG V +GGSYFMISR+LGP+FG A+G+LFY G  +A AMY+VG +EI+LTY+AP    F    G    D  AM+NNFR Y + LL  + +IV LGVKFV  FA + LACVI+SI+ VY+G F  +   E+  M C LG+RLL           +C K  + L D YC +G     C++Y+ AN V  +  + G ASGV   N++P ++ +G+ +             G     +  D+ T+F +L+ I+FPSVTGIM GSN SGDL D QK IP  TI A LTTS VYLS V  FAGT    +L DK+G S+GG ++VA + WP++WV+LIGS  ST GAGLQ L  APRLL AIA+D++IPFL  F+  ++ GEP R LLL+    +C +LLGNVDL+APL+ +FFLM Y FVNLACA+Q +L  PNWRPRF++YHW LSL+G  L I ++  T WY+ L+ + + + IYKY+EYRGAEKEWGDGIRG+ L  A+YSLL +EE   HTKNWRPQIL+L K N +L  KY K+ SFA QLK G+GL I  S+++GD+    + +KA   K  L++ M   KVKGF   +V   + EG+S++IQ+IGLG +KPNTV++GWP++W+   +  +    F+  +  V +  + +++PKG++ YP  + K  G IDIWWI+ DGGLLM+LP LLK+HR W  C++R+FTVA   DNSI MK  L  +LY LRI+A VEVVE+ NSD ISAY +++TL+ME+R +++  + L  KE      +++D           +D  +  DT      P T +   +  E      KS  + P+    ++MH A++LN +I EKS +A LVI+NLPGPP+         Y+ +L VL+EGL +VL+VRG G+EVITIYS
Sbjct:   17 DYNQDESASGKLLGDI-HDETLGENYGSYDDSGDIHRAEENQKSS---IDPNLYLYDDDLETRPHISTFISSIANYENTIPAATDPDAKPAAPSARMGTLIGVFLPCIQNIFGVILFIRLTWVVGTAGAVCGFLIVLTCCCVTMLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGMLFYTGTTLAAAMYIVGAVEIVLTYMAPWASIF----GDFTKDADAMYNNFRVYGTLLLIFMGLIVFLGVKFVNKFATVALACVILSIIAVYVGIFDNIHGNEKLYM-CVLGKRLLKDI-----PLENCTKEDSFLRDIYCPDGK----CEEYYLANNVTKVKGIKGLASGVFYDNIFPSFLEKGQFISYGKSAIDIENTSGESYNQIMADITTSFTLLIGIFFPSVTGIMAGSNRSGDLADAQKSIPIGTICAILTTSTVYLSSVMFFAGTVDNLLLRDKFGQSIGGKLVVANIAWPNQWVILIGSFLSTLGAGLQSLTGAPRLLQAIARDEIIPFLAPFAKSSKRGEPTRALLLTIVICQCGILLGNVDLLAPLLSMFFLMCYGFVNLACAVQTLLRTPNWRPRFKFYHWSLSLIGLTLCISVMIMTSWYFALIAMGMAIIIYKYIEYRGAEKEWGDGIRGMALTAARYSLLRLEEGPPHTKNWRPQILVLSKLNDNLLPKYRKIFSFATQLKAGKGLTICVSVIKGDHT--KITNKAVDAKATLRKYMTDEKVKGFCDVLVAQQIGEGLSSVIQTIGLGGMKPNTVIIGWPYSWR--QEGRNSWKTFIQTVRTVAACHMALMVPKGINFYPESNHKIGGNIDIWWIVHDGGLLMLLPFLLKQHRTWRNCKLRIFTVAQIEDNSIQMKKDLKTFLYHLRIEADVEVVEMNNSD-ISAYTYERTLMMEQRNQMLRALGLNKKE-----NSKVDSQNDEKRNSIDLDGPENADT------PETTSNKDESTEKADGDFKS-SVKPDEFNVRRMHTAIKLNEVIVEKSQDAQLVIMNLPGPPREVRAERERNYMEFLEVLTEGLEKVLMVRGGGREVITIYS 1043          
BLAST of slc12a-1 vs. Ensembl Fly
Match: kcc (gene:FBgn0261794 transcript:FBtr0072138)

HSP 1 Score: 895.96 bits (2314), Expect = 0.000e+0
Identity = 485/1052 (46.10%), Postives = 667/1052 (63.40%), Query Frame = 2
Query:  209 DRHSIINDQKIGKL-EVRKVSSGLTDNVEEGHESDDDVKDETMALYQEDY-------SIMNSISGYLRAMTYQTSVAGQKKNP--KLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGF--VRSPERSEMVCFLGERLLTKSFWTINKTLSCNK--TMLEDYYC-NGNLTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVMP---------GVKGLGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSISCK--GTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRKASLKDFHVDQSKLVDTHQFTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKN--KHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            D   II  +  G + E +   SG     EE  +S     D  + LY +D        + ++SI+ Y   +   T    +   P  ++  +IGV+LP +Q+IFGVI+F+RL W++G +G + GF +V  CC  T LT+ISMSAIATNG V +GGSYFMISR+LGP+FG A+G+LFY G  +A AMY+VG +EI+LTY+AP    F    G    D  AM+NNFR Y + LL  + +IV LGVKFV  FA + LACVI+SI+ VY+G F  +   E+  M C LG+RLL           +C K  + L D YC +G     C++Y+ AN V  +  + G ASGV   N++P ++ +G+ +             G     +  D+ T+F +L+ I+FPSVTGIM GSN SGDL D QK IP  TI A LTTS VYLS V  FAGT    +L DK+G S+GG ++VA + WP++WV+LIGS  ST GAGLQ L  APRLL AIA+D++IPFL  F+  ++ GEP R LLL+    +C +LLGNVDL+APL+ +FFLM Y FVNLACA+Q +L  PNWRPRF++YHW LSL+G  L I ++  T WY+ L+ + + + IYKY+EYRGAEKEWGDGIRG+ L  A+YSLL +EE   HTKNWRPQIL+L K N +L  KY K+ SFA QLK G+GL I  S+++GD+    + +KA   K  L++ M   KVKGF   +V   + EG+S++IQ+IGLG +KPNTV++GWP++W+   +  +    F+  +  V +  + +++PKG++ YP  + K  G IDIWWI+ DGGLLM+LP LLK+HR W  C++R+FTVA   DNSI MK  L  +LY LRI+A VEVVE+ NSD ISAY +++TL+ME+R +++  + L  KE      +++D           +D  +  DT      P T +   +  E      KS  + P+    ++MH A++LN +I EKS +A LVI+NLPGPP+         Y+ +L VL+EGL +VL+VRG G+EVITIYS
Sbjct:   11 DEMEIIPSEHNGTVHETKNEDSGDIHRAEENQKSS---IDPNLYLYDDDLETRPHISTFISSIANYENTIPAATDPDAKPAAPSARMGTLIGVFLPCIQNIFGVILFIRLTWVVGTAGAVCGFLIVLTCCCVTMLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGMLFYTGTTLAAAMYIVGAVEIVLTYMAPWASIF----GDFTKDADAMYNNFRVYGTLLLIFMGLIVFLGVKFVNKFATVALACVILSIIAVYVGIFDNIHGNEKLYM-CVLGKRLLKDI-----PLENCTKEDSFLRDIYCPDGK----CEEYYLANNVTKVKGIKGLASGVFYDNIFPSFLEKGQFISYGKSAIDIENTSGESYNQIMADITTSFTLLIGIFFPSVTGIMAGSNRSGDLADAQKSIPIGTICAILTTSTVYLSSVMFFAGTVDNLLLRDKFGQSIGGKLVVANIAWPNQWVILIGSFLSTLGAGLQSLTGAPRLLQAIARDEIIPFLAPFAKSSKRGEPTRALLLTIVICQCGILLGNVDLLAPLLSMFFLMCYGFVNLACAVQTLLRTPNWRPRFKFYHWSLSLIGLTLCISVMIMTSWYFALIAMGMAIIIYKYIEYRGAEKEWGDGIRGMALTAARYSLLRLEEGPPHTKNWRPQILVLSKLNDNLLPKYRKIFSFATQLKAGKGLTICVSVIKGDHT--KITNKAVDAKATLRKYMTDEKVKGFCDVLVAQQIGEGLSSVIQTIGLGGMKPNTVIIGWPYSWR--QEGRNSWKTFIQTVRTVAACHMALMVPKGINFYPESNHKIGGNIDIWWIVHDGGLLMLLPFLLKQHRTWRNCKLRIFTVAQIEDNSIQMKKDLKTFLYHLRIEADVEVVEMNNSD-ISAYTYERTLMMEQRNQMLRALGLNKKE-----NSKVDSQNDEKRNSIDLDGPENADT------PETTSNKDESTEKADGDFKS-SVKPDEFNVRRMHTAIKLNEVIVEKSQDAQLVIMNLPGPPREVRAERERNYMEFLEVLTEGLEKVLMVRGGGREVITIYS 1028          
BLAST of slc12a-1 vs. Ensembl Fly
Match: kcc (gene:FBgn0261794 transcript:FBtr0072139)

HSP 1 Score: 894.804 bits (2311), Expect = 0.000e+0
Identity = 487/1072 (45.43%), Postives = 673/1072 (62.78%), Query Frame = 2
Query:  209 DRHSIINDQKIGKL-EVRKVSSGLTDNVEEGHESDDDVKDETMALYQEDY-------SIMNSISGYLRAMTYQTSVAGQKKNP--KLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGF--VRSPERSEMVCFLGERLLTKSFWTINKTLSCNK--TMLEDYYC-NGNLTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVMP---------GVKGLGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSISCK--GTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDH-------LRKASLKDFHVDQSKLVDTH-------------QFTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKN--KHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            D   II  +  G + E +   SG     EE  +S     D  + LY +D        + ++SI+ Y   +   T    +   P  ++  +IGV+LP +Q+IFGVI+F+RL W++G +G + GF +V  CC  T LT+ISMSAIATNG V +GGSYFMISR+LGP+FG A+G+LFY G  +A AMY+VG +EI+LTY+AP    F    G    D  AM+NNFR Y + LL  + +IV LGVKFV  FA + LACVI+SI+ VY+G F  +   E+  M C LG+RLL           +C K  + L D YC +G     C++Y+ AN V  +  + G ASGV   N++P ++ +G+ +             G     +  D+ T+F +L+ I+FPSVTGIM GSN SGDL D QK IP  TI A LTTS VYLS V  FAGT    +L DK+G S+GG ++VA + WP++WV+LIGS  ST GAGLQ L  APRLL AIA+D++IPFL  F+  ++ GEP R LLL+    +C +LLGNVDL+APL+ +FFLM Y FVNLACA+Q +L  PNWRPRF++YHW LSL+G  L I ++  T WY+ L+ + + + IYKY+EYRGAEKEWGDGIRG+ L  A+YSLL +EE   HTKNWRPQIL+L K N +L  KY K+ SFA QLK G+GL I  S+++GD+    + +KA   K  L++ M   KVKGF   +V   + EG+S++IQ+IGLG +KPNTV++GWP++W+   +  +    F+  +  V +  + +++PKG++ YP  + K  G IDIWWI+ DGGLLM+LP LLK+HR W  C++R+FTVA   DNSI MK  L  +LY LRI+A VEVVE+ NSD ISAY +++TL+ME+R +++  + L  KE     Q  +DH         K    D  +++++  D+              +   +P T +   +  E      KS  + P+    ++MH A++LN +I EKS +A LVI+NLPGPP+         Y+ +L VL+EGL +VL+VRG G+EVITIYS
Sbjct:   11 DEMEIIPSEHNGTVHETKNEDSGDIHRAEENQKSS---IDPNLYLYDDDLETRPHISTFISSIANYENTIPAATDPDAKPAAPSARMGTLIGVFLPCIQNIFGVILFIRLTWVVGTAGAVCGFLIVLTCCCVTMLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGMLFYTGTTLAAAMYIVGAVEIVLTYMAPWASIF----GDFTKDADAMYNNFRVYGTLLLIFMGLIVFLGVKFVNKFATVALACVILSIIAVYVGIFDNIHGNEKLYM-CVLGKRLLKDI-----PLENCTKEDSFLRDIYCPDGK----CEEYYLANNVTKVKGIKGLASGVFYDNIFPSFLEKGQFISYGKSAIDIENTSGESYNQIMADITTSFTLLIGIFFPSVTGIMAGSNRSGDLADAQKSIPIGTICAILTTSTVYLSSVMFFAGTVDNLLLRDKFGQSIGGKLVVANIAWPNQWVILIGSFLSTLGAGLQSLTGAPRLLQAIARDEIIPFLAPFAKSSKRGEPTRALLLTIVICQCGILLGNVDLLAPLLSMFFLMCYGFVNLACAVQTLLRTPNWRPRFKFYHWSLSLIGLTLCISVMIMTSWYFALIAMGMAIIIYKYIEYRGAEKEWGDGIRGMALTAARYSLLRLEEGPPHTKNWRPQILVLSKLNDNLLPKYRKIFSFATQLKAGKGLTICVSVIKGDHT--KITNKAVDAKATLRKYMTDEKVKGFCDVLVAQQIGEGLSSVIQTIGLGGMKPNTVIIGWPYSWR--QEGRNSWKTFIQTVRTVAACHMALMVPKGINFYPESNHKIGGNIDIWWIVHDGGLLMLLPFLLKQHRTWRNCKLRIFTVAQIEDNSIQMKKDLKTFLYHLRIEADVEVVEMNNSD-ISAYTYERTLMMEQRNQMLRALGLNKKENSKVVQTIVDHHYDATKTASKVRFADPTIEETQHHDSQNDEKRNSIDLDGPENADTPETTSNKDESTEKADGDFKS-SVKPDEFNVRRMHTAIKLNEVIVEKSQDAQLVIMNLPGPPREVRAERERNYMEFLEVLTEGLEKVLMVRGGGREVITIYS 1059          
BLAST of slc12a-1 vs. Ensembl Fly
Match: kcc (gene:FBgn0261794 transcript:FBtr0072137)

HSP 1 Score: 892.878 bits (2306), Expect = 0.000e+0
Identity = 489/1082 (45.19%), Postives = 679/1082 (62.75%), Query Frame = 2
Query:  176 DENREHSVSFRDRHSIINDQKIGKLEVRKVSSGLTDNVEEGHESDDDVKDETMALYQEDY-------SIMNSISGYLRAMTYQTSVAGQKKNP--KLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGF--VRSPERSEMVCFLGERLLTKSFWTINKTLSCNK--TMLEDYYC-NGNLTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVMP---------GVKGLGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSISCK--GTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDH-------LRKASLKDFHVDQSKLVDTH-------------QFTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKN--KHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            D N++ S S +    I +D+ +G+       SG     EE  +S     D  + LY +D        + ++SI+ Y   +   T    +   P  ++  +IGV+LP +Q+IFGVI+F+RL W++G +G + GF +V  CC  T LT+ISMSAIATNG V +GGSYFMISR+LGP+FG A+G+LFY G  +A AMY+VG +EI+LTY+AP    F    G    D  AM+NNFR Y + LL  + +IV LGVKFV  FA + LACVI+SI+ VY+G F  +   E+  M C LG+RLL           +C K  + L D YC +G     C++Y+ AN V  +  + G ASGV   N++P ++ +G+ +             G     +  D+ T+F +L+ I+FPSVTGIM GSN SGDL D QK IP  TI A LTTS VYLS V  FAGT    +L DK+G S+GG ++VA + WP++WV+LIGS  ST GAGLQ L  APRLL AIA+D++IPFL  F+  ++ GEP R LLL+    +C +LLGNVDL+APL+ +FFLM Y FVNLACA+Q +L  PNWRPRF++YHW LSL+G  L I ++  T WY+ L+ + + + IYKY+EYRGAEKEWGDGIRG+ L  A+YSLL +EE   HTKNWRPQIL+L K N +L  KY K+ SFA QLK G+GL I  S+++GD+    + +KA   K  L++ M   KVKGF   +V   + EG+S++IQ+IGLG +KPNTV++GWP++W+   +  +    F+  +  V +  + +++PKG++ YP  + K  G IDIWWI+ DGGLLM+LP LLK+HR W  C++R+FTVA   DNSI MK  L  +LY LRI+A VEVVE+ NSD ISAY +++TL+ME+R +++  + L  KE     Q  +DH         K    D  +++++  D+              +   +P T +   +  E      KS  + P+    ++MH A++LN +I EKS +A LVI+NLPGPP+         Y+ +L VL+EGL +VL+VRG G+EVITIYS
Sbjct:   17 DYNQDESASGKLLGDI-HDETLGENYGSYDDSGDIHRAEENQKSS---IDPNLYLYDDDLETRPHISTFISSIANYENTIPAATDPDAKPAAPSARMGTLIGVFLPCIQNIFGVILFIRLTWVVGTAGAVCGFLIVLTCCCVTMLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGMLFYTGTTLAAAMYIVGAVEIVLTYMAPWASIF----GDFTKDADAMYNNFRVYGTLLLIFMGLIVFLGVKFVNKFATVALACVILSIIAVYVGIFDNIHGNEKLYM-CVLGKRLLKDI-----PLENCTKEDSFLRDIYCPDGK----CEEYYLANNVTKVKGIKGLASGVFYDNIFPSFLEKGQFISYGKSAIDIENTSGESYNQIMADITTSFTLLIGIFFPSVTGIMAGSNRSGDLADAQKSIPIGTICAILTTSTVYLSSVMFFAGTVDNLLLRDKFGQSIGGKLVVANIAWPNQWVILIGSFLSTLGAGLQSLTGAPRLLQAIARDEIIPFLAPFAKSSKRGEPTRALLLTIVICQCGILLGNVDLLAPLLSMFFLMCYGFVNLACAVQTLLRTPNWRPRFKFYHWSLSLIGLTLCISVMIMTSWYFALIAMGMAIIIYKYIEYRGAEKEWGDGIRGMALTAARYSLLRLEEGPPHTKNWRPQILVLSKLNDNLLPKYRKIFSFATQLKAGKGLTICVSVIKGDHT--KITNKAVDAKATLRKYMTDEKVKGFCDVLVAQQIGEGLSSVIQTIGLGGMKPNTVIIGWPYSWR--QEGRNSWKTFIQTVRTVAACHMALMVPKGINFYPESNHKIGGNIDIWWIVHDGGLLMLLPFLLKQHRTWRNCKLRIFTVAQIEDNSIQMKKDLKTFLYHLRIEADVEVVEMNNSD-ISAYTYERTLMMEQRNQMLRALGLNKKENSKVVQTIVDHHYDATKTASKVRFADPTIEETQHHDSQNDEKRNSIDLDGPENADTPETTSNKDESTEKADGDFKS-SVKPDEFNVRRMHTAIKLNEVIVEKSQDAQLVIMNLPGPPREVRAERERNYMEFLEVLTEGLEKVLMVRGGGREVITIYS 1074          
BLAST of slc12a-1 vs. Ensembl Fly
Match: kcc (gene:FBgn0261794 transcript:FBtr0343300)

HSP 1 Score: 892.878 bits (2306), Expect = 0.000e+0
Identity = 483/1061 (45.52%), Postives = 669/1061 (63.05%), Query Frame = 2
Query:  239 IGKLEVRKVSSGLTDNVEEGHESDDDVKDETMALYQEDY-------SIMNSISGYLRAMTYQTSVAGQKKNP--KLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGF--VRSPERSEMVCFLGERLLTKSFWTINKTLSCNK--TMLEDYYC-NGNLTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVMP---------GVKGLGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSISCK--GTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDH-------LRKASLKDFHVDQSKLVDTH-------------QFTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKN--KHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            +G +    + SG     EE  +S     D  + LY +D        + ++SI+ Y   +   T    +   P  ++  +IGV+LP +Q+IFGVI+F+RL W++G +G + GF +V  CC  T LT+ISMSAIATNG V +GGSYFMISR+LGP+FG A+G+LFY G  +A AMY+VG +EI+LTY+AP    F    G    D  AM+NNFR Y + LL  + +IV LGVKFV  FA + LACVI+SI+ VY+G F  +   E+  M C LG+RLL           +C K  + L D YC +G     C++Y+ AN V  +  + G ASGV   N++P ++ +G+ +             G     +  D+ T+F +L+ I+FPSVTGIM GSN SGDL D QK IP  TI A LTTS VYLS V  FAGT    +L DK+G S+GG ++VA + WP++WV+LIGS  ST GAGLQ L  APRLL AIA+D++IPFL  F+  ++ GEP R LLL+    +C +LLGNVDL+APL+ +FFLM Y FVNLACA+Q +L  PNWRPRF++YHW LSL+G  L I ++  T WY+ L+ + + + IYKY+EYRGAEKEWGDGIRG+ L  A+YSLL +EE   HTKNWRPQIL+L K N +L  KY K+ SFA QLK G+GL I  S+++GD+    + +KA   K  L++ M   KVKGF   +V   + EG+S++IQ+IGLG +KPNTV++GWP++W+   +  +    F+  +  V +  + +++PKG++ YP  + K  G IDIWWI+ DGGLLM+LP LLK+HR W  C++R+FTVA   DNSI MK  L  +LY LRI+A VEVVE+ NSD ISAY +++TL+ME+R +++  + L  KE     Q  +DH         K    D  +++++  D+              +   +P T +   +  E      KS  + P+    ++MH A++LN +I EKS +A LVI+NLPGPP+         Y+ +L VL+EGL +VL+VRG G+EVITIYS
Sbjct:   29 LGDIHDETLDSGDIHRAEENQKSS---IDPNLYLYDDDLETRPHISTFISSIANYENTIPAATDPDAKPAAPSARMGTLIGVFLPCIQNIFGVILFIRLTWVVGTAGAVCGFLIVLTCCCVTMLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGMLFYTGTTLAAAMYIVGAVEIVLTYMAPWASIF----GDFTKDADAMYNNFRVYGTLLLIFMGLIVFLGVKFVNKFATVALACVILSIIAVYVGIFDNIHGNEKLYM-CVLGKRLLKDI-----PLENCTKEDSFLRDIYCPDGK----CEEYYLANNVTKVKGIKGLASGVFYDNIFPSFLEKGQFISYGKSAIDIENTSGESYNQIMADITTSFTLLIGIFFPSVTGIMAGSNRSGDLADAQKSIPIGTICAILTTSTVYLSSVMFFAGTVDNLLLRDKFGQSIGGKLVVANIAWPNQWVILIGSFLSTLGAGLQSLTGAPRLLQAIARDEIIPFLAPFAKSSKRGEPTRALLLTIVICQCGILLGNVDLLAPLLSMFFLMCYGFVNLACAVQTLLRTPNWRPRFKFYHWSLSLIGLTLCISVMIMTSWYFALIAMGMAIIIYKYIEYRGAEKEWGDGIRGMALTAARYSLLRLEEGPPHTKNWRPQILVLSKLNDNLLPKYRKIFSFATQLKAGKGLTICVSVIKGDHT--KITNKAVDAKATLRKYMTDEKVKGFCDVLVAQQIGEGLSSVIQTIGLGGMKPNTVIIGWPYSWR--QEGRNSWKTFIQTVRTVAACHMALMVPKGINFYPESNHKIGGNIDIWWIVHDGGLLMLLPFLLKQHRTWRNCKLRIFTVAQIEDNSIQMKKDLKTFLYHLRIEADVEVVEMNNSD-ISAYTYERTLMMEQRNQMLRALGLNKKENSKVVQTIVDHHYDATKTASKVRFADPTIEETQHHDSQNDEKRNSIDLDGPENADTPETTSNKDESTEKADGDFKS-SVKPDEFNVRRMHTAIKLNEVIVEKSQDAQLVIMNLPGPPREVRAERERNYMEFLEVLTEGLEKVLMVRGGGREVITIYS 1066          
BLAST of slc12a-1 vs. Ensembl Zebrafish
Match: slc12a4 (solute carrier family 12 member 4 [Source:ZFIN;Acc:ZDB-GENE-090218-27])

HSP 1 Score: 888.256 bits (2294), Expect = 0.000e+0
Identity = 467/1041 (44.86%), Postives = 666/1041 (63.98%), Query Frame = 2
Query:  311 DDVKDETMALYQEDYSIMNSISGYL-RAMTYQTSVAGQK----------------KNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGG---FVRSPERSEMVCFLGERLLTKSFWTINKTLSCNKTML-----------EDYYCNGNLTT-FCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVM-----PGVKGLGGRD-----VTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSISCK---GTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRKASLKDFHVDQSK-----LVDTHQFTFSPATL-AQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            +D  D  +AL++E+  I   +S  L R + Y     G K                K+P +  ++GVYLP LQ+IFGVI+FLRL WI+G +G +Q F +V +CC CT LT+ISMSAIATNG V +GG+YFMISR+LGP+FG A+G+ FYLG   A AMY++G IEI L Y+ P    F   P   H  + AM NN R Y +  L L+ V+V +GVK+V   A + LACVIISIV +Y G        PE    +C LG R L +  + +     C KT++           +++  + N+++  CD+YF  N V  +  +PG ASG+IK N+W  YM +G+++     P V   G  +     V+ D+ T+F +L+ I+FPS TGIM GSN SGDL+D QK IP  TI A  TTS VY S V +F       VL DK+G ++   ++V  L WP  WV++IGS  ST GAGLQ L  APRLL AIAKD++IPFL+VF      GEP   LLL+   AE  +L+ ++D++AP++ +FFLM Y FVNLACA+Q +L  PNWRPRFRYYHW LS +G ++ + ++F + WYY +V + +   IYKY+EY+GAEKEWGDGIRGL L+ A+YSLL +E    HTKNWRPQ+L+L K + DL +KYP+L++FA QLK G+GL I+ S+++G++   +   + Q  ++ +K  M   +VKGF Q +V S V+EGI+ LIQS GLG +K NTV++GWP+ W+  S++      F++ +    +A + +++PK VS YPS   +   G ID+WWI+ DGG+LM+LP LLK+H+VW +C++R+FTVA   DNSI MK  L  +LY LR++A VEVVE+ +SD ISAY +++TL+ME+R ++++QM+L++ E D E Q   D      +   + D+ +     L + +Q T++   + A+ ++        ++   + P+    ++MH AV+LN +I  KS +A LV+LN+PGPP+N+   E Y+ +L VL+EGL RVLLVRG G+EVITIYS
Sbjct:   68 NDFYDRNLALFEEELDIRPKVSSLLSRLVNYTNVTQGAKEHEEAESADASRRQAPKSPNMGTLMGVYLPCLQNIFGVILFLRLTWIVGTAGVVQSFLIVLMCCSCTMLTAISMSAIATNGVVPAGGAYFMISRSLGPEFGGAVGLCFYLGTTFAAAMYILGAIEIFLKYLIPQAAIFH--PADIHAGNGAMLNNMRVYGTICLSLMAVVVFVGVKYVNKLASLFLACVIISIVSIYAGAVKSIFHPPEFP--ICMLGNRTLVRDLFDV-----CGKTVVVGNETVPSKLWKNFCTSDNISSAHCDEYFFHNNVTEIKGIPGLASGIIKENMWGDYMEKGQILEKAKLPSVDVHGSMETFGFYVSADIATSFTLLVGIFFPSATGIMAGSNRSGDLRDAQKSIPIGTILAITTTSLVYFSSVVLFGACIEGVVLRDKFGDAVSKNLVVGTLSWPSPWVIVIGSFFSTVGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHGKANGEPTWALLLTGLIAELGILIASLDMVAPILSMFFLMCYLFVNLACAVQTLLRTPNWRPRFRYYHWALSFLGMSMCLALMFISSWYYAIVAMGIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARYSLLRLEAGPPHTKNWRPQLLVLLKLDEDLHVKYPRLLTFASQLKAGKGLTIVGSVIQGNFL--ECYGETQASEQAIKNMMEIERVKGFCQVVVASKVREGIAHLIQSCGLGGMKHNTVVMGWPYGWRQ-SEDPRAWKTFINTVRCTTAAHLALMVPKNVSFYPSNHERFTDGYIDVWWIVHDGGMLMLLPFLLKQHKVWRKCKMRIFTVAQMDDNSIQMKKDLATFLYQLRLEAEVEVVEMHDSD-ISAYTYERTLMMEQRSQMLKQMRLSSAERDREAQLVKDRHSLIRMGSLYSDEEEETIEILPEKNQMTWTSEKIEAERRNRNNAPENFRELISIKPDQSNVRRMHTAVKLNEVIVNKSHDARLVLLNMPGPPRNQEGDENYMEFLEVLTEGLERVLLVRGGGREVITIYS 1095          
BLAST of slc12a-1 vs. Ensembl Zebrafish
Match: slc12a7b (solute carrier family 12 member 7b [Source:ZFIN;Acc:ZDB-GENE-030829-61])

HSP 1 Score: 866.685 bits (2238), Expect = 0.000e+0
Identity = 460/1048 (43.89%), Postives = 662/1048 (63.17%), Query Frame = 2
Query:  299 HESDDDVKD----ETMALYQEDY-------SIMNSISGY------LRAMTYQTSVAGQKK----NPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEM--VCFLGERLL-TKSFWTINKTLSCNK----TMLEDYYCNG-NLTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGE-VMPGVKGLGGRDVTRDM--------MTNFFVLL-AIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEEE-THTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSIS--CKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQ----------ARIDHLRKASLKDFHVDQSK---LVDTHQFTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            + +DDD  +    + MAL++E+        S++N ++ Y      +R         G KK    +P++   IGVYLP LQ+I GVI+FLR+ WI+G +G L+ F +V +CC CT LT+ISMSAIATNG V +GGSY+MISR+LGP+FG A+G+ FYLG   A AMY++GTIEILLTY+ P+   F+++  +  D+  A+ NN R Y +  L L+ ++V +GVK+V   A + LACV++SI+ +Y  G +++     +  VC LG R L    F    KT   +     T L   +C+G  L   C++YF  N V  +  +PG  SGVI  N+W  Y   G  V   +  +   D ++D         +T FF LL  IYFPSVTGIM GSN SGDL+D Q+ IP  TI A  TT+ +YLS V +F       VL DK+G S+ G +++  L WP  WV++IGS  S  GAGLQ L  APRLL AIA+D ++PFL+VF      GEP   LLL+    E  +L+ ++D +AP++ +FFLM Y FVNLACALQ +L  PNWRPRF+YYHW LS +G +L + ++F + WYY LV + +   IYKY+EYRGAEKEWGDGIRGL L  A+Y+L+ +EE   HTKNWRPQ+L+L   +S+LC+K+P+L+SF  QLK G+GL I+ S++EG Y  ++  ++A++ ++N+K  M   K KGF   +V S++++GIS L+QS GLG +K N+V++ WP  W+  SD  +    F++ +    +A + +L+ K V  +P      +GTID+WWI+ DGG+LM+LP LL++H+VW++C++R+FTVA   DNSI MK  L  +LY LR+ A VEVVE+ +SD ISA+ ++KTLVME+R ++++QM+L+  E + E Q            ++    A+ +  H+  +K     +  + T + A++A ++D+  MK          P     + MH AV+LN +I  KS  A LV+LN+PGPPKN+   E Y+ ++ V+ EGL RVLLVRG G+EVITIYS
Sbjct:   26 NNTDDDKGNLYDGKNMALFEEEMDSNPMVSSLLNKLANYTNLTQGVREHEEADEDEGAKKQTVKSPQMGTFIGVYLPCLQNILGVILFLRMTWIVGTAGILEAFIIVSMCCSCTMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGTIEILLTYIVPSAAIFKAEDKA--DEAEALLNNMRVYGTCCLTLMALVVFVGVKYVNKLALVFLACVVLSILAIY-AGVIKTIFEPPVFPVCVLGNRTLQNHDFDKCMKTEIIDNVTVTTKLWSLFCSGPELNASCNEYFTLNSVTEIQGIPGLTSGVISENMWGKYGPAGMLVEKDIPSVSASDSSQDKYMPYVVNDITAFFTLLVGIYFPSVTGIMAGSNRSGDLRDAQRSIPIGTILAIATTTIIYLSCVVLFGACIEGVVLRDKFGDSVKGNLVIGTLSWPSPWVIVIGSFFSCCGAGLQSLTGAPRLLQAIARDGIVPFLEVFGHGKANGEPTWALLLTALICESGILIASLDAVAPILSMFFLMCYLFVNLACALQTLLRTPNWRPRFKYYHWALSFLGMSLCLALMFISSWYYALVAMLIAGCIYKYIEYRGAEKEWGDGIRGLSLNAARYALIRLEEAPPHTKNWRPQMLVLLNLDSELCVKHPRLLSFTTQLKAGKGLTIVGSVLEGTYLSRE--NQAKRAEQNIKSAMAAEKTKGFCHVVVSSNLRDGISHLVQSAGLGGMKHNSVLMAWPSNWRQSSDPHT-WRSFIETVRETTAAHLALLVAKNVDSFPHQERLTEGTIDVWWIVHDGGMLMLLPFLLRQHKVWKKCKMRIFTVAQMDDNSIQMKKDLQMFLYHLRLNAEVEVVEMHDSD-ISAFTYEKTLVMEQRSQMLKQMQLSRTEREREAQLIHDRNTASHTAMNDKADATPERVHMTWTKEKLFSERSRRTEANASMA-VRDLFNMK----------PNQSNVRCMHTAVKLNEVIVNKSQGAHLVLLNMPGPPKNRGGDENYMEFMEVMMEGLNRVLLVRGGGREVITIYS 1055          
BLAST of slc12a-1 vs. Ensembl Zebrafish
Match: slc12a7b (solute carrier family 12 member 7b [Source:ZFIN;Acc:ZDB-GENE-030829-61])

HSP 1 Score: 845.884 bits (2184), Expect = 0.000e+0
Identity = 451/1045 (43.16%), Postives = 646/1045 (61.82%), Query Frame = 2
Query:  299 HESDDDVKD----ETMALYQEDY-------SIMNSISGY------LRAMTYQTSVAGQKK----NPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEM--VCFLGERLL-TKSFWTINKTLSCNK----TMLEDYYCNG-NLTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGE-VMPGVKGLGGRDVTRDM--------MTNFFVLL-AIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEEE-THTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSIS--CKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRKASLKDFHVDQSKLVDTHQFTFSPATLAQMKDVLEMKTTTKKSK----------KLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            + +DDD  +    + MAL++E+        S++N ++ Y      +R         G KK    +P++   IGVYLP LQ+I GVI+FLR+ WI+G +G L+   ++   C+ T LT+ISMSAIATNG V +GGSY+MISR+LGP+FG A+G+ FYLG   A AMY++GTIEILLTY+ P+                A+ NN R Y +  L L+ ++V +GVK+V   A + LACV++SI+ +Y  G +++     +  VC LG R L    F    KT   +     T L   +C+G  L   C++YF  N V  +  +PG  SGVI  N+W  Y   G  V   +  +   D ++D         +T FF LL  IYFPSVTGIM GSN SGDL+D Q+ IP  TI A  TT+ +YLS V +F       VL DK+G S+ G +++  L WP  WV++IGS  S  GAGLQ L  APRLL AIA+D ++PFL+VF      GEP   LLL+    E  +L+ ++D +AP++ +FFLM Y FVNLACALQ +L  PNWRPRF+YYHW LS +G +L + ++F + WYY LV + +   IYKY+EYRGAEKEWGDGIRGL L  A+Y+L+ +EE   HTKNWRPQ+L+L   +S+LC+K+P+L+SF  QLK G+GL I+ S++EG Y  ++  ++A++ ++N+K  M   K KGF   +V S++++GIS L+QS GLG +K N+V++ WP  W+  SD  +    F++ +    +A + +L+ K V  +P      +GTID+WWI+ DGG+LM+LP LL++H+VW++C++R+FTVA   DNSI MK  L  +LY LR+ A VEVVE+ +SD ISA+ ++KTLVME+R ++++QM+L+  E + E Q+  D  R +  +    +   + D    T     +   K+ L  + + +              + P     + MH AV+LN +I  KS  A LV+LN+PGPPKN+   E Y+ ++ V+ EGL RVLLVRG G+EVITIYS
Sbjct:   26 NNTDDDKGNLYDGKNMALFEEEMDSNPMVSSLLNKLANYTNLTQGVREHEEADEDEGAKKQTVKSPQMGTFIGVYLPCLQNILGVILFLRMTWIVGTAGILE--LVIVFYCVFTMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGTIEILLTYIVPS---------------AALLNNMRVYGTCCLTLMALVVFVGVKYVNKLALVFLACVVLSILAIY-AGVIKTIFEPPVFPVCVLGNRTLQNHDFDKCMKTEIIDNVTVTTKLWSLFCSGPELNASCNEYFTLNSVTEIQGIPGLTSGVISENMWGKYGPAGMLVEKDIPSVSASDSSQDKYMPYVVNDITAFFTLLVGIYFPSVTGIMAGSNRSGDLRDAQRSIPIGTILAIATTTIIYLSCVVLFGACIEGVVLRDKFGDSVKGNLVIGTLSWPSPWVIVIGSFFSCCGAGLQSLTGAPRLLQAIARDGIVPFLEVFGHGKANGEPTWALLLTALICESGILIASLDAVAPILSMFFLMCYLFVNLACALQTLLRTPNWRPRFKYYHWALSFLGMSLCLALMFISSWYYALVAMLIAGCIYKYIEYRGAEKEWGDGIRGLSLNAARYALIRLEEAPPHTKNWRPQMLVLLNLDSELCVKHPRLLSFTTQLKAGKGLTIVGSVLEGTYLSRE--NQAKRAEQNIKSAMAAEKTKGFCHVVVSSNLRDGISHLVQSAGLGGMKHNSVLMAWPSNWRQSSDPHT-WRSFIETVRETTAAHLALLVAKNVDSFPHQERLTEGTIDVWWIVHDGGMLMLLPFLLRQHKVWKKCKMRIFTVAQMDDNSIQMKKDLQMFLYHLRLNAEVEVVEMHDSD-ISAFTYEKTLVMEQRSQMLKQMQLSRTEREREIQSITDESRSSIRRKNQSEAHTMNDKADATPERVHMTWTKEKLFSERSRRTEANASMAVRDLFNMKPNQSNVRCMHTAVKLNEVIVNKSQGAHLVLLNMPGPPKNRGGDENYMEFMEVMMEGLNRVLLVRGGGREVITIYS 1048          
BLAST of slc12a-1 vs. Ensembl Zebrafish
Match: slc12a7a (solute carrier family 12 member 7a [Source:ZFIN;Acc:ZDB-GENE-070912-696])

HSP 1 Score: 832.787 bits (2150), Expect = 0.000e+0
Identity = 456/1072 (42.54%), Postives = 646/1072 (60.26%), Query Frame = 2
Query:  302 ESDDDVKDETMALYQEDYSIMNSISGYLRAMTYQTSVA-------------GQKK----NPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEM-VCFLGERLLTKSFWTINKTLSCNKTMLED----------YYCNGNLTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVY-----MSEGEVMPGVKGLGGRD------VTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSIS---CKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARID----------------HLRKASLKDFHVDQSKLVDTHQFTFSPATLAQ----MKDVLEMKTTTKKSK-----------------KLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            + DD    + MALY+E+      +S  L  +   T++              G ++     P++   IGV+LP  Q+I GVI+FLRL WI+G +G L+   +VF+CC CT LT+ISMSAIATNG V +GGSY+MISR LGP+ G A+G+ FYLG   A +MY++GT+EI LTY+ P+   F++      ++ T M NN R Y +  L ++ ++V +GVK+V   + + L+CV++SI+ +Y G    + + S   +C LG R L + F    K   C KT + D          ++CNG     CD+YF  N +  + A+PG  S  I  NLW  Y       E E +     L          V  DM T F +L+ IYFPSVTGIM GSN SGDL+DPQ+ IP  TI A  TTSF+Y+S V +F       VL DKYG S+   ++VA L WP  WV++IGS  S  GAGLQ L  APR+L AIA+D ++PFL+VF      GEP   LLL+    E  +L+ ++D +AP++ +FFLM Y FVNLACA+Q +L  PNWRPRF++YHW LS +G +LS+ ++F + WYY LV + +   IYKY+EYRGA KEWGDG+RGL L  A+Y+L+ +EE + HTKNWRPQ+L+L K ++DL +K+P+L+SF  QLK G+GL I+ S++EG +  +     A+  ++N+K  M   K KGF   +V S+ ++G S LIQS GLG +K N V+V WP  WK      S ++ F++ +    +A   +L+ K V  +PS      +GTID+WWI+ DGGLLM+LP LL++H+VW +C++R+FTVA   DNSI MK  L  +LY LR+ A VEVVE+ N+  ISA+ ++KTLVME+R ++++QM+L+  E + E Q+  D                H  K  +   ++D+   +   + T S ATL +      D + M  T +K                    + P+    ++MH AV+LN ++ +KS  A LV+LN+PGPPKNK   E Y+ +L VL+EGL  VLLVRG G+EVITIYS
Sbjct:   56 DHDDSTYGKNMALYEEEMDSTPMVSSLLNKLANYTNITQGAVEHEEAESEDGIQRVTVNGPQMGTFIGVFLPCTQNILGVILFLRLTWIVGTAGILEALAVVFMCCACTMLTAISMSAIATNGVVPAGGSYYMISRALGPEIGGAVGLCFYLGTTFAGSMYILGTMEIFLTYIMPSAAVFEA------NNPTGMQNNMRIYGTCCLAIMTLVVFVGVKYVNKLSLVFLSCVVLSIMAIYAGVIQSAIKPSSFTICLLGNRTL-QHFGKSGKFDKCMKTEVIDNITKPTELWYHFCNGT----CDEYFNLNELTEISAVPGLLSNAITENLWSRYGEYRTTVEKENITSEAALSSEPEVLNSYVVNDMATFFTLLVGIYFPSVTGIMAGSNRSGDLRDPQRSIPTGTIMAIATTSFIYISCVVLFGACFEGVVLRDKYGDSVNKNLVVATLAWPSPWVIVIGSFFSCCGAGLQSLTGAPRILQAIARDGIMPFLQVFGRSKSGGEPTWALLLTAAICEIGILIASLDAVAPILSMFFLMCYLFVNLACAVQTLLRTPNWRPRFKFYHWSLSFLGMSLSLSLMFVSSWYYALVVILIAGCIYKYIEYRGAVKEWGDGLRGLSLNAARYALIKLEEAQPHTKNWRPQLLVLMKLDTDLTVKHPRLLSFTSQLKAGKGLTIVCSVLEGTFMVRGA--DAKLAEQNIKAAMAKEKTKGFCHVVVSSNQRDGFSHLIQSAGLGGMKHNAVLVAWPANWKQAESSLSWKN-FIETVRETTAAHQALLVAKNVDTFPSNQDRLAEGTIDVWWIVHDGGLLMLLPFLLRQHKVWRKCKMRIFTVAQMDDNSIQMKKDLQMFLYHLRLDAKVEVVEM-NAGDISAFTYEKTLVMEQRSQMLKQMQLSKTEREREIQSISDESRISIRRKPCGEKQTHNSKLKVATVNLDEEAQLIHDKNTKSHATLVEKATPTSDRVHMTWTKEKLIGERNRLRDASMHVRDIFNMKPDQTNVRRMHTAVKLNEVVVKKSKGAQLVLLNMPGPPKNKGGDENYMEFLEVLTEGLDHVLLVRGGGREVITIYS 1112          
BLAST of slc12a-1 vs. Ensembl Zebrafish
Match: slc12a7a (solute carrier family 12 member 7a [Source:ZFIN;Acc:ZDB-GENE-070912-696])

HSP 1 Score: 831.632 bits (2147), Expect = 0.000e+0
Identity = 454/1048 (43.32%), Postives = 641/1048 (61.16%), Query Frame = 2
Query:  302 ESDDDVKDETMALYQEDYSIMNSISGYLRAMTYQTSVA-------------GQKK----NPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEM-VCFLGERLLTKSFWTINKTLSCNKTMLED----------YYCNGNLTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVY-----MSEGEVMPGVKGLGGRD------VTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSIS---CKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRK--ASLKDFHVDQSKLVDTHQFTFSPATL-----------AQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            + DD    + MALY+E+      +S  L  +   T++              G ++     P++   IGV+LP  Q+I GVI+FLRL WI+G +G L+   +VF+CC CT LT+ISMSAIATNG V +GGSY+MISR LGP+ G A+G+ FYLG   A +MY++GT+EI LTY+ P+   F++      ++ T M NN R Y +  L ++ ++V +GVK+V   + + L+CV++SI+ +Y G    + + S   +C LG R L + F    K   C KT + D          ++CNG     CD+YF  N +  + A+PG  S  I  NLW  Y       E E +     L          V  DM T F +L+ IYFPSVTGIM GSN SGDL+DPQ+ IP  TI A  TTSF+Y+S V +F       VL DKYG S+   ++VA L WP  WV++IGS  S  GAGLQ L  APR+L AIA+D ++PFL+VF      GEP   LLL+    E  +L+ ++D +AP++ +FFLM Y FVNLACA+Q +L  PNWRPRF++YHW LS +G +LS+ ++F + WYY LV + +   IYKY+EYRGA KEWGDG+RGL L  A+Y+L+ +EE + HTKNWRPQ+L+L K ++DL +K+P+L+SF  QLK G+GL I+ S++EG +  +     A+  ++N+K  M   K KGF   +V S+ ++G S LIQS GLG +K N V+V WP  WK      S ++ F++ +    +A   +L+ K V  +PS      +GTID+WWI+ DGGLLM+LP LL++H+VW +C++R+FTVA   DNSI MK  L  +LY LR+ A VEVVE+ N+  ISA+ ++KTLVME+R ++++QM+L+  E + E Q   D   K  A+L +     S   D    T++   L             ++D+  MK   +     N +    ++MH AV+LN ++ +KS  A LV+LN+PGPPKNK   E Y+ +L VL+EGL  VLLVRG G+EVITIYS
Sbjct:   56 DHDDSTYGKNMALYEEEMDSTPMVSSLLNKLANYTNITQGAVEHEEAESEDGIQRVTVNGPQMGTFIGVFLPCTQNILGVILFLRLTWIVGTAGILEALAVVFMCCACTMLTAISMSAIATNGVVPAGGSYYMISRALGPEIGGAVGLCFYLGTTFAGSMYILGTMEIFLTYIMPSAAVFEA------NNPTGMQNNMRIYGTCCLAIMTLVVFVGVKYVNKLSLVFLSCVVLSIMAIYAGVIQSAIKPSSFTICLLGNRTL-QHFGKSGKFDKCMKTEVIDNITKPTELWYHFCNGT----CDEYFNLNELTEISAVPGLLSNAITENLWSRYGEYRTTVEKENITSEAALSSEPEVLNSYVVNDMATFFTLLVGIYFPSVTGIMAGSNRSGDLRDPQRSIPTGTIMAIATTSFIYISCVVLFGACFEGVVLRDKYGDSVNKNLVVATLAWPSPWVIVIGSFFSCCGAGLQSLTGAPRILQAIARDGIMPFLQVFGRSKSGGEPTWALLLTAAICEIGILIASLDAVAPILSMFFLMCYLFVNLACAVQTLLRTPNWRPRFKFYHWSLSFLGMSLSLSLMFVSSWYYALVVILIAGCIYKYIEYRGAVKEWGDGLRGLSLNAARYALIKLEEAQPHTKNWRPQLLVLMKLDTDLTVKHPRLLSFTSQLKAGKGLTIVCSVLEGTFMVRGA--DAKLAEQNIKAAMAKEKTKGFCHVVVSSNQRDGFSHLIQSAGLGGMKHNAVLVAWPANWKQAESSLSWKN-FIETVRETTAAHQALLVAKNVDTFPSNQDRLAEGTIDVWWIVHDGGLLMLLPFLLRQHKVWRKCKMRIFTVAQMDDNSIQMKKDLQMFLYHLRLDAKVEVVEM-NAGDISAFTYEKTLVMEQRSQMLKQMQLSKTEREREAQLIHDKNTKSHATLVEKATPTS---DRVHMTWTKEKLIGERNRLRDASMHVRDIFNMKPEWE-----NLDQTNVRRMHTAVKLNEVVVKKSKGAQLVLLNMPGPPKNKGGDENYMEFLEVLTEGLDHVLLVRGGGREVITIYS 1080          
BLAST of slc12a-1 vs. Ensembl Xenopus
Match: ENSXETT00000004203.1 (solute carrier family 12 (potassium/chloride transporter), member 4 [Source:NCBI gene;Acc:100493471])

HSP 1 Score: 899.427 bits (2323), Expect = 0.000e+0
Identity = 472/1028 (45.91%), Postives = 657/1028 (63.91%), Query Frame = 2
Query:  323 DETMALYQEDYSIMNSISGYL-RAMTYQTSVAGQ-------------KKNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGF--VRSPERSEMVCFLGERLLTKSFWTI-NKTLSCNK-----TMLEDYYCNGNLTTF-CDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVM-----PGVKGLGGRD-----VTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSIS---CKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRKASLKDFH------VDQSKLVDTHQFTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            D+ +AL++E+  I   +S +L R + Y     G               K+P +  ++GVYLP +Q+I GVI+FLRL WI+G  G LQ   +  ICC CT LT+ISMSAIATNG V +GGSYFMISR+LGP+FG A+G+ FYLG   A AMY++G IEILL Y+ P    F S   ++H+D +A  NN R Y +  L L+ +IV +GVK+V  FA + LACVIISI+ +Y G    +  P     +C LG R L++  + I  KT+  +      T+ E +  + N +T  CD YF  N V  +  +PG ASG++K NLW  Y+ +GE++       V  LG +      V  D+   F VL+ I+FPSVTGIM GSN SGDL+D QK IP  TI A +TTSF+Y S V +F       VL DKYG ++   ++V  L WP  WV++IGS  ST GAGLQ L  APRLL AIA D++IPFL+VF      GEP   LLL+ F AE  +L+ ++D++AP++ +FFLM Y FVNLACA+Q +L  PNWRPRF+YYHW LS  G ++ + ++F   WYY L+ + +   IYKY+EY+GAEKEWGDGIRGL L+ A+Y+LL +EE   HTKNWRPQ+L+L K + DL +KYP+L++F+ QLK G+GL I+ + ++G++ +     + Q  ++ +K  M   KVKGF Q +V S+V +GIS LIQS GLG +K NTV++GWP+ W+   D  S +  F+DA+    +A + +++PK VS YPS      +G ID+WWI+ DGG+LM+LP LLK+H+VW++C++R+FTVA   DNSI MK  L  +LY LR++A VEVVE+ NSD ISAY +++TL+ME+R +++ QM+LT  E D E Q   D      ++ ++        + +L   H         AQ K+        ++   + P+    ++MH AV+LN +I  +S +A LV+LN+PGPPKN    E Y+ +L VL+EGL RVLLVRG G+EVITIYS
Sbjct:   70 DKNLALFEEELDIRPKVSSFLSRLVNYTNLTQGAKEHEEAEEARRKVNKSPCMGTVMGVYLPCMQNILGVILFLRLTWIVGTGGVLQTLLITLICCCCTLLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGAIEILLMYIVPEAAIFHSP--NTHEDSSAKLNNMRVYGTVFLTLMAIIVFVGVKYVNKFASLFLACVIISILSIYAGSIKSIFDPPVFP-ICMLGNRTLSRDRFEICAKTIILDNVTKPTTLWEQFCGSSNFSTSSCDQYFLKNNVTEIAGIPGAASGILKDNLWSNYLQKGEILEKSQLSSVDELGSKSNLHLYVLTDISATFTVLVGIFFPSVTGIMAGSNRSGDLRDAQKSIPVGTILAIITTSFIYFSTVVLFGACIEGVVLRDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIANDNIIPFLRVFGQGKVNGEPTWALLLTAFIAELGILIASLDMVAPILSMFFLMCYLFVNLACAVQTLLRTPNWRPRFKYYHWALSFFGMSICLALMFVCSWYYALIAMLIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLLKLDEDLHVKYPRLLTFSSQLKAGKGLTIIGTTLQGNFLES--YGEVQAAEQTIKNMMEIEKVKGFSQVVVSSEVCDGISHLIQSCGLGGMKHNTVLLGWPYGWRQSEDPRSWK-TFIDAVRCTTAARLALMVPKNVSFYPSNHERYLEGNIDVWWIVHDGGMLMLLPFLLKQHKVWKKCKMRIFTVAQLDDNSIQMKKDLATFLYHLRLEAEVEVVEMHNSD-ISAYTYERTLMMEQRSQMLRQMRLTKTERDREAQLVKDRNSIIPVESYYSDEEDEEPELELAKIHMTWTKDKYNAQWKNRNNETMHFRELADIKPDQSNVRRMHTAVKLNEVIVTRSHDAKLVLLNMPGPPKNTDGDENYMEFLEVLTEGLERVLLVRGGGREVITIYS 1090          
BLAST of slc12a-1 vs. Ensembl Xenopus
Match: ENSXETT00000003001.1 (solute carrier family 12 (potassium/chloride transporter), member 4 [Source:NCBI gene;Acc:100493471])

HSP 1 Score: 894.034 bits (2309), Expect = 0.000e+0
Identity = 471/1029 (45.77%), Postives = 654/1029 (63.56%), Query Frame = 2
Query:  320 KDETMALYQEDYSIMNSISGYL-RAMTYQTSVAGQ-------------KKNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGF--VRSPERSEMVCFLGERLLTKSFWTI-NKTLSCNK-----TMLEDYYCNGNLTTF-CDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVM-----PGVKGLGGRD-----VTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSIS---CKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRKASLKDFH------VDQSKLVDTHQFTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            K   +A + E+  I   +S +L R + Y     G               K+P +  ++GVYLP +Q+I GVI+FLRL WI+G  G LQ   +  ICC CT LT+ISMSAIATNG V +GGSYFMISR+LGP+FG A+G+ FYLG   A AMY++G IEILL Y+ P    F S   ++H+D +A  NN R Y +  L L+ +IV +GVK+V  FA + LACVIISI+ +Y G    +  P     +C LG R L++  + I  KT+  +      T+ E +  + N +T  CD YF  N V  +  +PG ASG++K NLW  Y+ +GE++       V  LG +      V  D+   F VL+ I+FPSVTGIM GSN SGDL+D QK IP  TI A +TTSF+Y S V +F       VL DKYG ++   ++V  L WP  WV++IGS  ST GAGLQ L  APRLL AIA D++IPFL+VF      GEP   LLL+ F AE  +L+ ++D++AP++ +FFLM Y FVNLACA+Q +L  PNWRPRF+YYHW LS  G ++ + ++F   WYY L+ + +   IYKY+EY+GAEKEWGDGIRGL L+ A+Y+LL +EE   HTKNWRPQ+L+L K + DL +KYP+L++F+ QLK G+GL I+ + ++G++ +     + Q  ++ +K  M   KVKGF Q +V S+V +GIS LIQS GLG +K NTV++GWP+ W+   D  S +  F+DA+    +A + +++PK VS YPS      +G ID+WWI+ DGG+LM+LP LLK+H+VW++C++R+FTVA   DNSI MK  L  +LY LR++A VEVVE+ NSD ISAY +++TL+ME+R +++ QM+LT  E D E Q   D      ++ ++        + +L   H         AQ K+        ++   + P+    ++MH AV+LN +I  +S +A LV+LN+PGPPKN    E Y+ +L VL+EGL RVLLVRG G+EVITIYS
Sbjct:    5 KKSILAEHSEELDIRPKVSSFLSRLVNYTNLTQGAKEHEEAEEARRKVNKSPCMGTVMGVYLPCMQNILGVILFLRLTWIVGTGGVLQTLLITLICCCCTLLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGAIEILLMYIVPEAAIFHSP--NTHEDSSAKLNNMRVYGTVFLTLMAIIVFVGVKYVNKFASLFLACVIISILSIYAGSIKSIFDPPVFP-ICMLGNRTLSRDRFEICAKTIILDNVTKPTTLWEQFCGSSNFSTSSCDQYFLKNNVTEIAGIPGAASGILKDNLWSNYLQKGEILEKSQLSSVDELGSKSNLHLYVLTDISATFTVLVGIFFPSVTGIMAGSNRSGDLRDAQKSIPVGTILAIITTSFIYFSTVVLFGACIEGVVLRDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIANDNIIPFLRVFGQGKVNGEPTWALLLTAFIAELGILIASLDMVAPILSMFFLMCYLFVNLACAVQTLLRTPNWRPRFKYYHWALSFFGMSICLALMFVCSWYYALIAMLIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLLKLDEDLHVKYPRLLTFSSQLKAGKGLTIIGTTLQGNFLES--YGEVQAAEQTIKNMMEIEKVKGFSQVVVSSEVCDGISHLIQSCGLGGMKHNTVLLGWPYGWRQSEDPRSWK-TFIDAVRCTTAARLALMVPKNVSFYPSNHERYLEGNIDVWWIVHDGGMLMLLPFLLKQHKVWKKCKMRIFTVAQLDDNSIQMKKDLATFLYHLRLEAEVEVVEMHNSD-ISAYTYERTLMMEQRSQMLRQMRLTKTERDREAQLVKDRNSIIPVESYYSDEEDEEPELELAKIHMTWTKDKYNAQWKNRNNETMHFRELADIKPDQSNVRRMHTAVKLNEVIVTRSHDAKLVLLNMPGPPKNTDGDENYMEFLEVLTEGLERVLLVRGGGREVITIYS 1026          
BLAST of slc12a-1 vs. Ensembl Xenopus
Match: ENSXETT00000002965.1 (solute carrier family 12 (potassium/chloride transporter), member 4 [Source:NCBI gene;Acc:100493471])

HSP 1 Score: 892.878 bits (2306), Expect = 0.000e+0
Identity = 462/981 (47.09%), Postives = 639/981 (65.14%), Query Frame = 2
Query:  422 KKNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGF--VRSPERSEMVCFLGERLLTKSFWTI-NKTLSCNK-----TMLEDYYCNGNLTTF-CDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVM-----PGVKGLGGRD-----VTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSIS---CKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRKASLKDFH------VDQSKLVDTHQFTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
             K+P +  ++GVYLP +Q+I GVI+FLRL WI+G  G LQ   +  ICC CT LT+ISMSAIATNG V +GGSYFMISR+LGP+FG A+G+ FYLG   A AMY++G IEILL Y+ P    F S   ++H+D +A  NN R Y +  L L+ +IV +GVK+V  FA + LACVIISI+ +Y G    +  P     +C LG R L++  + I  KT+  +      T+ E +  + N +T  CD YF  N V  +  +PG ASG++K NLW  Y+ +GE++       V  LG +      V  D+   F VL+ I+FPSVTGIM GSN SGDL+D QK IP  TI A +TTSF+Y S V +F       VL DKYG ++   ++V  L WP  WV++IGS  ST GAGLQ L  APRLL AIA D++IPFL+VF      GEP   LLL+ F AE  +L+ ++D++AP++ +FFLM Y FVNLACA+Q +L  PNWRPRF+YYHW LS  G ++ + ++F   WYY L+ + +   IYKY+EY+GAEKEWGDGIRGL L+ A+Y+LL +EE   HTKNWRPQ+L+L K + DL +KYP+L++F+ QLK G+GL I+ + ++G++ +     + Q  ++ +K  M   KVKGF Q +V S+V +GIS LIQS GLG +K NTV++GWP+ W+   D  S +  F+DA+    +A + +++PK VS YPS      +G ID+WWI+ DGG+LM+LP LLK+H+VW++C++R+FTVA   DNSI MK  L  +LY LR++A VEVVE+ NSD ISAY +++TL+ME+R +++ QM+LT  E D E Q   D      ++ ++        + +L   H         AQ K+        ++   + P+    ++MH AV+LN +I  +S +A LV+LN+PGPPKN    E Y+ +L VL+EGL RVLLVRG G+EVITIYS
Sbjct:   39 NKSPCMGTVMGVYLPCMQNILGVILFLRLTWIVGTGGVLQTLLITLICCCCTLLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGAIEILLMYIVPEAAIFHSP--NTHEDSSAKLNNMRVYGTVFLTLMAIIVFVGVKYVNKFASLFLACVIISILSIYAGSIKSIFDPPVFP-ICMLGNRTLSRDRFEICAKTIILDNVTKPTTLWEQFCGSSNFSTSSCDQYFLKNNVTEIAGIPGAASGILKDNLWSNYLQKGEILEKSQLSSVDELGSKSNLHLYVLTDISATFTVLVGIFFPSVTGIMAGSNRSGDLRDAQKSIPVGTILAIITTSFIYFSTVVLFGACIEGVVLRDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIANDNIIPFLRVFGQGKVNGEPTWALLLTAFIAELGILIASLDMVAPILSMFFLMCYLFVNLACAVQTLLRTPNWRPRFKYYHWALSFFGMSICLALMFVCSWYYALIAMLIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLLKLDEDLHVKYPRLLTFSSQLKAGKGLTIIGTTLQGNFLES--YGEVQAAEQTIKNMMEIEKVKGFSQVVVSSEVCDGISHLIQSCGLGGMKHNTVLLGWPYGWRQSEDPRSWK-TFIDAVRCTTAARLALMVPKNVSFYPSNHERYLEGNIDVWWIVHDGGMLMLLPFLLKQHKVWKKCKMRIFTVAQLDDNSIQMKKDLATFLYHLRLEAEVEVVEMHNSD-ISAYTYERTLMMEQRSQMLRQMRLTKTERDREAQLVKDRNSIIPVESYYSDEEDEEPELELAKIHMTWTKDKYNAQWKNRNNETMHFRELADIKPDQSNVRRMHTAVKLNEVIVTRSHDAKLVLLNMPGPPKNTDGDENYMEFLEVLTEGLERVLLVRGGGREVITIYS 1012          
BLAST of slc12a-1 vs. Ensembl Xenopus
Match: ENSXETT00000002952.1 (solute carrier family 12 (potassium/chloride transporter), member 4 [Source:NCBI gene;Acc:100493471])

HSP 1 Score: 892.493 bits (2305), Expect = 0.000e+0
Identity = 462/981 (47.09%), Postives = 639/981 (65.14%), Query Frame = 2
Query:  422 KKNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGF--VRSPERSEMVCFLGERLLTKSFWTI-NKTLSCNK-----TMLEDYYCNGNLTTF-CDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVM-----PGVKGLGGRD-----VTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSIS---CKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRKASLKDFH------VDQSKLVDTHQFTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
             K+P +  ++GVYLP +Q+I GVI+FLRL WI+G  G LQ   +  ICC CT LT+ISMSAIATNG V +GGSYFMISR+LGP+FG A+G+ FYLG   A AMY++G IEILL Y+ P    F S   ++H+D +A  NN R Y +  L L+ +IV +GVK+V  FA + LACVIISI+ +Y G    +  P     +C LG R L++  + I  KT+  +      T+ E +  + N +T  CD YF  N V  +  +PG ASG++K NLW  Y+ +GE++       V  LG +      V  D+   F VL+ I+FPSVTGIM GSN SGDL+D QK IP  TI A +TTSF+Y S V +F       VL DKYG ++   ++V  L WP  WV++IGS  ST GAGLQ L  APRLL AIA D++IPFL+VF      GEP   LLL+ F AE  +L+ ++D++AP++ +FFLM Y FVNLACA+Q +L  PNWRPRF+YYHW LS  G ++ + ++F   WYY L+ + +   IYKY+EY+GAEKEWGDGIRGL L+ A+Y+LL +EE   HTKNWRPQ+L+L K + DL +KYP+L++F+ QLK G+GL I+ + ++G++ +     + Q  ++ +K  M   KVKGF Q +V S+V +GIS LIQS GLG +K NTV++GWP+ W+   D  S +  F+DA+    +A + +++PK VS YPS      +G ID+WWI+ DGG+LM+LP LLK+H+VW++C++R+FTVA   DNSI MK  L  +LY LR++A VEVVE+ NSD ISAY +++TL+ME+R +++ QM+LT  E D E Q   D      ++ ++        + +L   H         AQ K+        ++   + P+    ++MH AV+LN +I  +S +A LV+LN+PGPPKN    E Y+ +L VL+EGL RVLLVRG G+EVITIYS
Sbjct:   60 NKSPCMGTVMGVYLPCMQNILGVILFLRLTWIVGTGGVLQTLLITLICCCCTLLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGAIEILLMYIVPEAAIFHSP--NTHEDSSAKLNNMRVYGTVFLTLMAIIVFVGVKYVNKFASLFLACVIISILSIYAGSIKSIFDPPVFP-ICMLGNRTLSRDRFEICAKTIILDNVTKPTTLWEQFCGSSNFSTSSCDQYFLKNNVTEIAGIPGAASGILKDNLWSNYLQKGEILEKSQLSSVDELGSKSNLHLYVLTDISATFTVLVGIFFPSVTGIMAGSNRSGDLRDAQKSIPVGTILAIITTSFIYFSTVVLFGACIEGVVLRDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIANDNIIPFLRVFGQGKVNGEPTWALLLTAFIAELGILIASLDMVAPILSMFFLMCYLFVNLACAVQTLLRTPNWRPRFKYYHWALSFFGMSICLALMFVCSWYYALIAMLIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLLKLDEDLHVKYPRLLTFSSQLKAGKGLTIIGTTLQGNFLES--YGEVQAAEQTIKNMMEIEKVKGFSQVVVSSEVCDGISHLIQSCGLGGMKHNTVLLGWPYGWRQSEDPRSWK-TFIDAVRCTTAARLALMVPKNVSFYPSNHERYLEGNIDVWWIVHDGGMLMLLPFLLKQHKVWKKCKMRIFTVAQLDDNSIQMKKDLATFLYHLRLEAEVEVVEMHNSD-ISAYTYERTLMMEQRSQMLRQMRLTKTERDREAQLVKDRNSIIPVESYYSDEEDEEPELELAKIHMTWTKDKYNAQWKNRNNETMHFRELADIKPDQSNVRRMHTAVKLNEVIVTRSHDAKLVLLNMPGPPKNTDGDENYMEFLEVLTEGLERVLLVRGGGREVITIYS 1033          
BLAST of slc12a-1 vs. Ensembl Xenopus
Match: il4i1 (interleukin 4 induced 1 [Source:Xenbase;Acc:XB-GENE-6037585])

HSP 1 Score: 891.338 bits (2302), Expect = 0.000e+0
Identity = 480/1050 (45.71%), Postives = 668/1050 (63.62%), Query Frame = 2
Query:  257 RKVSSGLTDNVEEGHESDD-DVKDETMALYQEDY-------SIMNSISGYLR----AMTYQTSVAGQKK---NPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEM-VCFLGERLLTKSFWTINKTL--SCNKTMLEDY---YCN--GNLTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEV-----MPGVKGLGGRD---VTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYP---SISCKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRKASLK------DFHVDQSKLVDTHQFTFSPATLAQMKDVLEMKTTTKKSKKLN--PENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            R+ SS L  N    H  D+ D  D  +AL++E+        S++N ++ Y      A  ++    G+KK    P++  I+GVYLP LQ+IFGVI+FLRL W++G +G L  F +VF CC CT LT+ISMSAIATNG V +GG+YFMISR LGP+FG A+G+ FYLG   ATAMY++G IEI L Y++P    F  +     ++  AM NN R Y +G L ++ +IV +GV++V   A + L CVI+SI+ +Y G    +    +  +C LG R L+K  +T    +  S N T++ D    +C+    L   CD+YF  N V  +  +PG  SG+I  NLW  Y+ +G++     +P  + L  +    V  D+ T+F +L+ I+FPSVTGIM GSN SGDLKD QK IP  TI A LTTS VYLS V +F  +    VL DK+G ++ G ++V  L WP  WV++IGS  ST GAGLQ L  APRLL AIAKD +IPFL+VF      GEP   LLL+   AE  +L+ ++DL+AP++ +FFLM Y FVNLAC LQ +L++PNWRPRF YYHW LS +G AL + ++F + WYY L+++ +   IYKY+EY+GAEKEWGDGIRGL L+ A+++LL +EE   HTKNWRPQ+L+L K +SDL +  P+L+SFA QLK G+GL I+ S++ GDY +     +AQ  ++ LK  M   KVKGF Q +V   +KEG+S LIQS GLG ++ NTV++ WP +W+  SD+      F+  I    +A   +L+ K VS +P    I  +G ID+WWI+ DGG+LM+LP LLK+H+VW +C++R+FTVA   DNSI MK  L  +LY LRI A VEVVE+ +SD ISAY +++TL+ME+R +++ QM+L+  + D E +A++   R + L+      D   D   + D    T++      ++ V + K        LN  P+    ++MH AV+LN +I  KS +A LV+LN+PGPP+N    E Y+ +L VL+EGL  VLLVRG G EVITIYS
Sbjct:   82 RRKSSVLYQN----HTDDEGDSYDRNLALFEEEMDTRPKVSSLLNRLANYTNLPQGAKEHEEESEGKKKAAKTPRMGTIMGVYLPCLQNIFGVILFLRLPWVVGTAGVLHAFCIVFACCCCTMLTAISMSAIATNGVVPAGGAYFMISRALGPEFGGAVGLCFYLGTTFATAMYILGAIEIFLVYISPQAVIFHGE--GVAEESAAMLNNMRVYGTGFLIIMSIIVFVGVRYVNKLASVFLTCVIMSILAIYAGALKSAFSPPDFPICLLGNRTLSKHHFTECAKIVESDNMTIVTDLWNLFCHPSDQLNGTCDEYFAHNNVTLVQGIPGLKSGIISENLWSNYLQKGDIIEKASLPSTEYLAVQSQEYVLADITTSFTLLVGIFFPSVTGIMAGSNRSGDLKDAQKSIPIGTILAILTTSLVYLSNVILFGASIDGVVLRDKFGDAVKGTLVVGALSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDGIIPFLRVFGHGKSNGEPTWALLLTAVIAELGILIASLDLVAPILSMFFLMCYLFVNLACGLQTLLHSPNWRPRFHYYHWTLSFLGMALCLALMFISSWYYALISMVIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARFALLRLEEGPPHTKNWRPQLLVLVKLDSDLHVSQPRLLSFASQLKAGKGLTIVGSVLLGDYLEN--HAEAQAAEQALKHLMEQEKVKGFCQVVVAQKLKEGLSHLIQSCGLGGMRHNTVIMSWPSSWRQ-SDDSRAWKSFITTIRVTTAARQALLVAKNVSLFPGSREILAEGHIDVWWIVHDGGMLMLLPFLLKQHKVWRKCKMRIFTVAQMEDNSIQMKKDLATFLYHLRIAADVEVVEMHDSD-ISAYTYERTLMMEQRSQMLRQMRLS--KTDREKEAQLVKDRNSMLRLTSVGSDDDEDTEAVPDRVHMTWTKDKHHAVR-VAQSKPMPSFQDLLNIRPDQSNVRRMHTAVKLNEVIVNKSHDAKLVLLNMPGPPRNPQGDENYMEFLEVLTEGLEHVLLVRGGGTEVITIYS 1118          
BLAST of slc12a-1 vs. Ensembl Mouse
Match: Slc12a4 (solute carrier family 12, member 4 [Source:MGI Symbol;Acc:MGI:1309465])

HSP 1 Score: 920.613 bits (2378), Expect = 0.000e+0
Identity = 481/1039 (46.29%), Postives = 669/1039 (64.39%), Query Frame = 2
Query:  311 DDVKDETMALYQEDYSIMNSISGYL-RAMTYQTSVAGQK----------------KNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGF--VRSPERSEMVCFLGERLLTKSFWTINKTLSCNKTMLED----------YYCNG-NLTT-FCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEV-----MPGVKGLGGRD-----VTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSISCK---GTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRKASLKDFHVDQSKL----VDTHQFTFS-PATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            +D  D  +AL++E+  I   +S  L + ++Y     G K                K P +  ++GVYLP LQ+IFGVI+FLRL W++G +G LQ   +V ICC CT LT+ISMSAIATNG V +GGSYFMISR+LGP+FG A+G+ FYLG   A AMY++G IEILLTY+AP    F   P  +HD  +A  NN R Y +  L L+ ++V +GVK+V  FA + LACVIISI+ +Y GG   +  P     VC LG R L++  + I     C KT++ D          ++C+  NLT   CD YF  N V  +P +PG A+GV++ NLW  Y+ +GEV     +P    LG ++     V  D+ T+F VL+ I+FPSVTGIM GSN SGDL+D QK IP  TI A +TTS VY S V +F       VL DKYG  +   ++V  L WP  WV+++GS  ST GAGLQ L  APRLL AIAKD++IPFL+VF      GEP   LLL+   AE  +L+ ++D++AP++ +FFLM Y FVNLACA+Q +L  PNWRPRF+YYHW LS +G +L + ++F + WYY LV + +   IYKY+EY+GAEKEWGDGIRGL L+ A+Y+LL +EE   HTKNWRPQ+L+L K + DL +KYP+L++FA QLK G+GL I+ S+++G + +     +AQ  ++ +K  M   KVKGF Q +V S V+EG++ LIQS GLG ++ N+V++GWP+ W+  S++      F+D +    +A + +L+PK ++ YPS   +   G ID+WWI+ DGG+LM+LP LL++H+VW++C +R+FTVA   DNSI MK  L  +LY LR++A VEVVE+ NSD ISAY +++TL+ME+R +++ QM+LT  E D E Q   D      L+  + D+ +      D  Q T++    +A+  D        ++   + P+    ++MH AV+LN +I  +S +A LV+LN+PGPPKN    E Y+ +L VL+EGL RVLLVRG G+EVITIYS
Sbjct:   59 NDYYDRNLALFEEELDIRPKVSSLLGKLVSYTNLTQGAKEHEEAESGEGGRRRAAKAPSMGTLMGVYLPCLQNIFGVILFLRLTWMVGTAGVLQALLIVLICCCCTLLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGLCFYLGTTFAAAMYILGAIEILLTYIAPPAAIFY--PSGTHDMSSATLNNMRVYGTIFLTLMTLVVFVGVKYVNKFASLFLACVIISILSIYAGGIKSIFDPPVFP-VCMLGNRTLSRDQFDI-----CAKTVVVDNETVATRLWTFFCHSPNLTADSCDPYFLLNNVTEIPGIPGAAAGVLQENLWSAYLEKGEVVEKHGLPSTDTLGLKESLSLYVVADIATSFTVLVGIFFPSVTGIMAGSNRSGDLRDAQKSIPVGTILAIVTTSLVYFSSVILFGACIEGVVLRDKYGDGVSRNLVVGTLAWPSPWVIVVGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHGKANGEPTWALLLTALIAELGILIASLDMVAPILSMFFLMCYLFVNLACAVQTLLRTPNWRPRFKYYHWTLSFLGMSLCLALMFVSSWYYALVAMLIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLLKLDEDLHVKYPRLLTFASQLKAGKGLTIVGSVIQGSFLES--YGEAQAAEQTIKNMMDIEKVKGFCQVVVASKVREGLAHLIQSCGLGGMRHNSVVLGWPYGWRQ-SEDPRAWKTFIDTVRCTTAAHLALLVPKNIAFYPSNHERYLDGHIDVWWIVHDGGMLMLLPFLLRQHKVWKKCRMRIFTVAQMDDNSIQMKKDLAIFLYHLRLEAEVEVVEMHNSD-ISAYTYERTLMMEQRSQMLRQMRLTKTERDREAQLVKDRHSALRLESLYSDEEEESVAGADKIQMTWTRDKYMAEPWDPSHAPDNFRELVHIKPDQSNVRRMHTAVKLNEVIVTRSHDARLVLLNMPGPPKNSEGDENYMEFLEVLTEGLERVLLVRGGGREVITIYS 1085          
BLAST of slc12a-1 vs. Ensembl Mouse
Match: Slc12a4 (solute carrier family 12, member 4 [Source:MGI Symbol;Acc:MGI:1309465])

HSP 1 Score: 920.228 bits (2377), Expect = 0.000e+0
Identity = 481/1039 (46.29%), Postives = 669/1039 (64.39%), Query Frame = 2
Query:  311 DDVKDETMALYQEDYSIMNSISGYL-RAMTYQTSVAGQK----------------KNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGF--VRSPERSEMVCFLGERLLTKSFWTINKTLSCNKTMLED----------YYCNG-NLTT-FCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEV-----MPGVKGLGGRD-----VTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSISCK---GTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRKASLKDFHVDQSKL----VDTHQFTFS-PATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            +D  D  +AL++E+  I   +S  L + ++Y     G K                K P +  ++GVYLP LQ+IFGVI+FLRL W++G +G LQ   +V ICC CT LT+ISMSAIATNG V +GGSYFMISR+LGP+FG A+G+ FYLG   A AMY++G IEILLTY+AP    F   P  +HD  +A  NN R Y +  L L+ ++V +GVK+V  FA + LACVIISI+ +Y GG   +  P     VC LG R L++  + I     C KT++ D          ++C+  NLT   CD YF  N V  +P +PG A+GV++ NLW  Y+ +GEV     +P    LG ++     V  D+ T+F VL+ I+FPSVTGIM GSN SGDL+D QK IP  TI A +TTS VY S V +F       VL DKYG  +   ++V  L WP  WV+++GS  ST GAGLQ L  APRLL AIAKD++IPFL+VF      GEP   LLL+   AE  +L+ ++D++AP++ +FFLM Y FVNLACA+Q +L  PNWRPRF+YYHW LS +G +L + ++F + WYY LV + +   IYKY+EY+GAEKEWGDGIRGL L+ A+Y+LL +EE   HTKNWRPQ+L+L K + DL +KYP+L++FA QLK G+GL I+ S+++G + +     +AQ  ++ +K  M   KVKGF Q +V S V+EG++ LIQS GLG ++ N+V++GWP+ W+  S++      F+D +    +A + +L+PK ++ YPS   +   G ID+WWI+ DGG+LM+LP LL++H+VW++C +R+FTVA   DNSI MK  L  +LY LR++A VEVVE+ NSD ISAY +++TL+ME+R +++ QM+LT  E D E Q   D      L+  + D+ +      D  Q T++    +A+  D        ++   + P+    ++MH AV+LN +I  +S +A LV+LN+PGPPKN    E Y+ +L VL+EGL RVLLVRG G+EVITIYS
Sbjct:   61 NDYYDRNLALFEEELDIRPKVSSLLGKLVSYTNLTQGAKEHEEAESGEGGRRRAAKAPSMGTLMGVYLPCLQNIFGVILFLRLTWMVGTAGVLQALLIVLICCCCTLLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGLCFYLGTTFAAAMYILGAIEILLTYIAPPAAIFY--PSGTHDMSSATLNNMRVYGTIFLTLMTLVVFVGVKYVNKFASLFLACVIISILSIYAGGIKSIFDPPVFP-VCMLGNRTLSRDQFDI-----CAKTVVVDNETVATRLWTFFCHSPNLTADSCDPYFLLNNVTEIPGIPGAAAGVLQENLWSAYLEKGEVVEKHGLPSTDTLGLKESLSLYVVADIATSFTVLVGIFFPSVTGIMAGSNRSGDLRDAQKSIPVGTILAIVTTSLVYFSSVILFGACIEGVVLRDKYGDGVSRNLVVGTLAWPSPWVIVVGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHGKANGEPTWALLLTALIAELGILIASLDMVAPILSMFFLMCYLFVNLACAVQTLLRTPNWRPRFKYYHWTLSFLGMSLCLALMFVSSWYYALVAMLIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLLKLDEDLHVKYPRLLTFASQLKAGKGLTIVGSVIQGSFLES--YGEAQAAEQTIKNMMDIEKVKGFCQVVVASKVREGLAHLIQSCGLGGMRHNSVVLGWPYGWRQ-SEDPRAWKTFIDTVRCTTAAHLALLVPKNIAFYPSNHERYLDGHIDVWWIVHDGGMLMLLPFLLRQHKVWKKCRMRIFTVAQMDDNSIQMKKDLAIFLYHLRLEAEVEVVEMHNSD-ISAYTYERTLMMEQRSQMLRQMRLTKTERDREAQLVKDRHSALRLESLYSDEEEESVAGADKIQMTWTRDKYMAEPWDPSHAPDNFRELVHIKPDQSNVRRMHTAVKLNEVIVTRSHDARLVLLNMPGPPKNSEGDENYMEFLEVLTEGLERVLLVRGGGREVITIYS 1087          
BLAST of slc12a-1 vs. Ensembl Mouse
Match: Slc12a6 (solute carrier family 12, member 6 [Source:MGI Symbol;Acc:MGI:2135960])

HSP 1 Score: 906.746 bits (2342), Expect = 0.000e+0
Identity = 481/1051 (45.77%), Postives = 657/1051 (62.51%), Query Frame = 2
Query:  278 TDNVEEGHESDDDVKDETMALYQEDYSIMNSISGYLRAMTYQTSVA--------------GQKK---NPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEM-VCFLGERLLTKSFWTINKTLSCNKTMLED----------YYCNGN--LTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVM--PGVKG------LGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSIS---CKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRKASLKDFHVDQSKLVDTHQFTFSPATLAQMKDVLEMKTTTKKSK---------KLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
              N EEG    D+  D+ +AL++E+      +S  L  M   T++               G+KK   +P++   +GVYLP LQ+IFGVI+FLRL W++G +G LQ F +V ICC CT LT+ISMSAIATNG V +GGSYFMISR LGP+FG A+G+ FYLG   A AMY++G IEI L Y+ P    F+S    +  +  AM NN R Y +  L L+ ++V +GV++V  FA + LACVI+SI+ +Y G    S       VC LG R L+     I     C+KT   D          ++CN +      CD+YF  N V  +  +PG ASG+I  NLW  Y+ +GE++  P  K       L    V  D+ T+F +L+ I+FPSVTGIM GSN SGDLKD QK IP  TI A LTTSFVYLS V +F       VL DK+G ++ G ++V  L WP  WV++IGS  ST GAGLQ L  APRLL AIAKD++IPFL+VF      GEP   LLL+   AE  +L+ ++DL+AP++ +FFLM Y FVNLACALQ +L  PNWRPRFRYYHW LS +G ++ + ++F + WYY +V + +   IYKY+EY+GAEKEWGDGIRGL L+ A+++LL +EE   HTKNWRPQ+L+L K + DL +K+P+L++FA QLK G+GL I+ S++ G++ +      A   ++ +K  M   KVKGF Q +V + +KEGIS LIQS GLG +K NTV++GWP+ W+  S++      F+  +    +A + +L+ K VS +PS      +G ID+WWI+ DGG+LM+LP LLK+H+VW +C +R+FTVA   DNSI MK  L  +LY LRI+A VEVVE+ +SD ISAY +++TL+ME+R +++  M+L+  E D E Q   D      L     D+ +  +T+Q       +   KD   M +  +K K          + P+    ++MH AV+LN +I  KS  A LV+LN+PGPP+N    E Y+ +L VL+EGL RVLLVRG G EVITIYS
Sbjct:   68 NSNYEEG----DEYFDKNLALFEEEMDTRPKVSSLLNRMANYTNLTQGAKEHEEAENITEGKKKPTKSPQMGTFMGVYLPCLQNIFGVILFLRLTWVVGTAGILQAFAIVLICCCCTMLTAISMSAIATNGVVPAGGSYFMISRALGPEFGGAVGLCFYLGTTFAAAMYILGAIEIFLVYIVPRAAIFRSD--DALKESAAMLNNMRVYGTAFLVLMVLVVFIGVRYVNKFASLFLACVIVSILAIYAGAIKSSFAPPHFPVCMLGNRTLSSRHLDI-----CSKTKEVDNMTVPSKLWGFFCNSSQFFNATCDEYFVHNNVISIQGIPGLASGIITENLWSNYLPKGEIIEKPSAKSSDVLGNLNHEYVLADITTSFTLLVGIFFPSVTGIMAGSNRSGDLKDAQKSIPIGTILAILTTSFVYLSNVVLFGACIEGVVLRDKFGDAVKGNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHSKANGEPTWALLLTAAIAELGILIASLDLVAPILSMFFLMCYLFVNLACALQTLLRTPNWRPRFRYYHWALSFMGMSICLALMFISSWYYAIVAMVIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARFALLRLEEGPPHTKNWRPQLLVLLKLDEDLHVKHPRLLTFASQLKAGKGLTIVGSVIVGNFLEN--YGDALAAEQTIKHLMEAEKVKGFCQLVVAAKLKEGISHLIQSCGLGGMKHNTVVMGWPNGWRQ-SEDARAWKTFIGTVRVTTAAHLALLVAKNVSFFPSNVEQFSEGNIDVWWIVHDGGMLMLLPFLLKQHKVWRKCSIRIFTVAQLEDNSIQMKKDLATFLYHLRIEAEVEVVEMHDSD-ISAYTYERTLMMEQRSQMLRHMRLSKTERDREAQLVKDRNSMLRLTSIGSDEDEETETYQ---EKVHMTWTKDKY-MASRGQKVKSMEGFQDLLNMRPDQSNVRRMHTAVKLNEVIVNKSHEAKLVLLNMPGPPRNPEGDENYMEFLEVLTEGLERVLLVRGGGSEVITIYS 1099          
BLAST of slc12a-1 vs. Ensembl Mouse
Match: Slc12a6 (solute carrier family 12, member 6 [Source:MGI Symbol;Acc:MGI:2135960])

HSP 1 Score: 905.975 bits (2340), Expect = 0.000e+0
Identity = 481/1049 (45.85%), Postives = 657/1049 (62.63%), Query Frame = 2
Query:  284 NVEEGHESDDDVKDETMALYQEDYSIMNSISGYLRAMTYQTSVA--------------GQKK---NPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEM-VCFLGERLLTKSFWTINKTLSCNKTMLED----------YYCNGN--LTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVM--PGVKG------LGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSIS---CKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRKASLKDFHVDQSKLVDTHQFTFSPATLAQMKDVLEMKTTTKKSK---------KLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            N EEG    D+  D+ +AL++E+      +S  L  M   T++               G+KK   +P++   +GVYLP LQ+IFGVI+FLRL W++G +G LQ F +V ICC CT LT+ISMSAIATNG V +GGSYFMISR LGP+FG A+G+ FYLG   A AMY++G IEI L Y+ P    F+S    +  +  AM NN R Y +  L L+ ++V +GV++V  FA + LACVI+SI+ +Y G    S       VC LG R L+     I     C+KT   D          ++CN +      CD+YF  N V  +  +PG ASG+I  NLW  Y+ +GE++  P  K       L    V  D+ T+F +L+ I+FPSVTGIM GSN SGDLKD QK IP  TI A LTTSFVYLS V +F       VL DK+G ++ G ++V  L WP  WV++IGS  ST GAGLQ L  APRLL AIAKD++IPFL+VF      GEP   LLL+   AE  +L+ ++DL+AP++ +FFLM Y FVNLACALQ +L  PNWRPRFRYYHW LS +G ++ + ++F + WYY +V + +   IYKY+EY+GAEKEWGDGIRGL L+ A+++LL +EE   HTKNWRPQ+L+L K + DL +K+P+L++FA QLK G+GL I+ S++ G++ +      A   ++ +K  M   KVKGF Q +V + +KEGIS LIQS GLG +K NTV++GWP+ W+  S++      F+  +    +A + +L+ K VS +PS      +G ID+WWI+ DGG+LM+LP LLK+H+VW +C +R+FTVA   DNSI MK  L  +LY LRI+A VEVVE+ +SD ISAY +++TL+ME+R +++  M+L+  E D E Q   D      L     D+ +  +T+Q       +   KD   M +  +K K          + P+    ++MH AV+LN +I  KS  A LV+LN+PGPP+N    E Y+ +L VL+EGL RVLLVRG G EVITIYS
Sbjct:  121 NYEEG----DEYFDKNLALFEEEMDTRPKVSSLLNRMANYTNLTQGAKEHEEAENITEGKKKPTKSPQMGTFMGVYLPCLQNIFGVILFLRLTWVVGTAGILQAFAIVLICCCCTMLTAISMSAIATNGVVPAGGSYFMISRALGPEFGGAVGLCFYLGTTFAAAMYILGAIEIFLVYIVPRAAIFRSD--DALKESAAMLNNMRVYGTAFLVLMVLVVFIGVRYVNKFASLFLACVIVSILAIYAGAIKSSFAPPHFPVCMLGNRTLSSRHLDI-----CSKTKEVDNMTVPSKLWGFFCNSSQFFNATCDEYFVHNNVISIQGIPGLASGIITENLWSNYLPKGEIIEKPSAKSSDVLGNLNHEYVLADITTSFTLLVGIFFPSVTGIMAGSNRSGDLKDAQKSIPIGTILAILTTSFVYLSNVVLFGACIEGVVLRDKFGDAVKGNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHSKANGEPTWALLLTAAIAELGILIASLDLVAPILSMFFLMCYLFVNLACALQTLLRTPNWRPRFRYYHWALSFMGMSICLALMFISSWYYAIVAMVIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARFALLRLEEGPPHTKNWRPQLLVLLKLDEDLHVKHPRLLTFASQLKAGKGLTIVGSVIVGNFLEN--YGDALAAEQTIKHLMEAEKVKGFCQLVVAAKLKEGISHLIQSCGLGGMKHNTVVMGWPNGWRQ-SEDARAWKTFIGTVRVTTAAHLALLVAKNVSFFPSNVEQFSEGNIDVWWIVHDGGMLMLLPFLLKQHKVWRKCSIRIFTVAQLEDNSIQMKKDLATFLYHLRIEAEVEVVEMHDSD-ISAYTYERTLMMEQRSQMLRHMRLSKTERDREAQLVKDRNSMLRLTSIGSDEDEETETYQ---EKVHMTWTKDKY-MASRGQKVKSMEGFQDLLNMRPDQSNVRRMHTAVKLNEVIVNKSHEAKLVLLNMPGPPRNPEGDENYMEFLEVLTEGLERVLLVRGGGSEVITIYS 1150          
BLAST of slc12a-1 vs. Ensembl Mouse
Match: Slc12a5 (solute carrier family 12, member 5 [Source:MGI Symbol;Acc:MGI:1862037])

HSP 1 Score: 873.233 bits (2255), Expect = 0.000e+0
Identity = 480/1126 (42.63%), Postives = 677/1126 (60.12%), Query Frame = 2
Query:  212 RHSIINDQKIGKLEVR-----KVSSGLTD--NVEEGHESDDDVKDETMALYQEDYSIMNSISGYLRAMTYQTSV--------------AGQKK---NPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEM-VCFLGERLLT--------KSFWTINKTLSCNKTMLEDYYCNGNL-TTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEV-----MPGVKGLGGRDVTRDM------MTNFFVLL-AIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSIS---CKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRKASLKD--------FHVDQSKLVDTHQ--------------------------------FTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEA--------------KKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            RHS+ + +++ + +V+     K SS   +  + E+G E D       MAL++E+      +S  L  +   T++               G+KK    P++   +GVYLP LQ+IFGVI+FLRL W++G +G ++ F MVFICC CT LT+ISMSAIATNG V +GGSY+MISR+LGP+FG A+G+ FYLG   A AMY++GTIEILL Y+ P +  F+++  S   +  AM NN R Y + +L  +  +V +GVK+V  FA + L CVI+SI+ +Y G    + +     +C LG R L+        K  W  N+T++   T L   +C+  L    CD+YF  N V  +  +PG ASG+IK NLW  Y+++G +     MP V    G  V  D       MT++F LL  IYFPSVTGIM GSN SGDL+D QK IP  TI A  TTS VY+S V +F       VL DK+G ++ G ++V  L WP  WV++IGS  ST GAGLQ L  APRLL AI++D ++PFL+VF      GEP   LLL+    E  +L+ ++D +AP++ +FFLM Y FVNLACA+Q +L  PNWRPRFRYYHW LS +G +L + ++F   WYY LV + +   IYKY+EYRGAEKEWGDGIRGL L+ A+Y+LL +EE   HTKNWRPQ+L+L + + D  + +P+L+S   QLK G+GL I+ S++EG + D     +AQ+ +E+++  M   KVKGF Q ++ S++++G+S LIQS GLG L+ NTV+VGWP  W+   D ++    F++ +    +  + +L+ K VS +P       +G+ID+WWI+ DGG+LM+LP LL+ H+VW +C++R+FTVA   DNSI MK  L  +LY LRI A VEVVE+  SD ISAY ++KTLVME+R ++++QM LT  E + E Q+  D  R +  +          +V +    D  +                                 T     L   KD    K+  +K+K  +P + E               ++MH AV LN +I  KS +A LV+LN+PGPP+N++  E Y+ +L VL+E L RV+LVRG G+EVITIYS
Sbjct:   25 RHSVADPRRLPREDVKGDGNPKESSPFINSTDTEKGREYDG----RNMALFEEEMDTSPMVSSLLSGLANYTNLPQGSREHEEAENNEGGKKKPVQAPRMGTFMGVYLPCLQNIFGVILFLRLTWVVGIAGIMESFCMVFICCSCTMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGTIEILLAYLFPAMAIFKAEDASG--EAAAMLNNMRVYGTCVLTCMATVVFVGVKYVNKFALVFLGCVILSILAIYAGVIKSAFDPPNFPICLLGNRTLSRHGFDVCAKLAWEGNETVT---TRLWGLFCSSRLLNATCDEYFTRNNVTEIQGIPGAASGLIKENLWSSYLTKGVIVERRGMPSVGLADGTPVDMDHPYVFSDMTSYFTLLVGIYFPSVTGIMAGSNRSGDLRDAQKSIPTGTILAIATTSAVYISSVVLFGACIEGVVLRDKFGEAVNGNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAISRDGIVPFLQVFGHGKANGEPTWALLLTACICEIGILIASLDEVAPILSMFFLMCYMFVNLACAVQTLLRTPNWRPRFRYYHWTLSFLGMSLCLALMFICSWYYALVAMLIAGLIYKYIEYRGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLVRVDQDQNVVHPQLLSLTSQLKAGKGLTIVGSVLEGTFLDN--HPQAQRAEESIRRLMEAEKVKGFCQVVISSNLRDGVSHLIQSGGLGGLQHNTVLVGWPRNWRQKEDHQT-WRNFIELVRETTAGHLALLVTKNVSMFPGNPERFSEGSIDVWWIVHDGGMLMLLPFLLRHHKVWRKCKMRIFTVAQMDDNSIQMKKDLTTFLYHLRITAEVEVVEMHESD-ISAYTYEKTLVMEQRSQILKQMHLTKNEREREIQSITDESRGSIRRKNPANPRLRLNVPEETACDNEEKPEEEVQLIHDQSAPSCPSSSPSPGEEPEGERETDPEVHLTWTKD----KSVAEKNKGPSPVSSEGIKDFFSMKPNQSNVRRMHTAVRLNEVIVNKSRDAKLVLLNMPGPPRNRNGDENYMEFLEVLTEQLDRVMLVRGGGREVITIYS 1133          
BLAST of slc12a-1 vs. UniProt/SwissProt
Match: sp|Q63632|S12A4_RAT (Solute carrier family 12 member 4 OS=Rattus norvegicus OX=10116 GN=Slc12a4 PE=1 SV=1)

HSP 1 Score: 922.154 bits (2382), Expect = 0.000e+0
Identity = 483/1038 (46.53%), Postives = 670/1038 (64.55%), Query Frame = 2
Query:  311 DDVKDETMALYQEDYSIMNSISGYL-RAMTYQTSVAGQK----------------KNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEM-VCFLGERLLTKSFWTINKTLSCNKTMLED----------YYCNG-NLTT-FCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEV-----MPGVKGLGGRD-----VTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSIS---CKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQ---ARIDHLRKASLKDFHVDQSKL-VDTHQFTFS-PATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            +D  D  +AL++E+  I   +S  L + ++Y     G K                K P +  ++GVYLP LQ+IFGVI+FLRL W++G +G LQ   +V ICC CT LT+ISMSAIATNG V +GGSYFMISR+LGP+FG A+G+ FYLG   A AMY++G IEILLTY+AP    F   P  +HD  +A  NN R Y +  L  + ++V +GVK+V  FA + LACVIISI+ +Y+GG   + +     VC LG R L++  + I     C KT++ D          ++C+  NLT   CD YF  N V  +P +PG A+GV++ NLW  Y+ +GEV     +P    LG ++     V  D+ T+F VL+ I+FPSVTGIM GSN SGDL+D QK IP  TI A +TTS VY S V +F       VL DKYG  +   ++V  L WP  WV+++GS  ST GAGLQ L  APRLL AIAKD++IPFL+VF      GEP   LLL+   AE  +L+ ++D++AP++ +FFLM Y FVNLACA+Q +L  PNWRPRF+YYHW LS +G +L + ++F + WYY LV + +   IYKY+EY+GAEKEWGDGIRGL L+ A+Y+LL +EE   HTKNWRPQ+L+L K + DL +KYP+L++FA QLK G+GL I+ S+++G + +     +AQ  ++ +K  M   KVKGF Q +V S V+EG++ LIQS GLG ++ N+V++GWP+ W+  S++      F+D +    +A + +L+PK ++ YPS      +G ID+WWI+ DGG+LM+LP LL++H+VW++C +R+FTVA   DNSI MK  L  +LY LR++A VEVVE+ NSD ISAY +++TL+ME+R +++ QM+LT  E D E Q    R   LR  SL     D+S    D  Q T++    +A+  D        ++   + P+    ++MH AV+LN +I  +S +A LV+LN+PGPPKN    E Y+ +L VL+EGL RVLLVRG G+EVITIYS
Sbjct:   59 NDYYDRNLALFEEELDIRPKVSSLLGKLVSYTNLTQGAKEHEEAESGEGGRRRAAKAPSMGTLMGVYLPCLQNIFGVILFLRLTWMVGTAGVLQALLIVLICCCCTLLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGLCFYLGTTFAAAMYILGAIEILLTYIAPPAAIFY--PSGTHDMSSATLNNMRVYGTIFLTFMTLVVFVGVKYVNKFASLFLACVIISILSIYVGGIKSAFDPPVFPVCMLGNRTLSRDQFDI-----CAKTVVVDNETVATRLWTFFCHSPNLTADSCDPYFLLNNVTEIPGIPGAAAGVLQENLWSAYLEKGEVVEKHGLPSTDTLGLKESLSLYVVADIATSFTVLVGIFFPSVTGIMAGSNRSGDLRDAQKSIPVGTILAIVTTSLVYFSSVILFGACIEGVVLRDKYGDGVSRNLVVGTLAWPSPWVIVVGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHGKANGEPTWALLLTALIAELGILIASLDMVAPILSMFFLMCYLFVNLACAVQTLLRTPNWRPRFKYYHWALSFLGMSLCLALMFVSSWYYALVAMVIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLLKLDEDLHVKYPRLLTFASQLKAGKGLTIVGSVIQGSFLES--YGEAQAAEQTIKNMMEIEKVKGFCQVVVASKVREGLAHLIQSCGLGGMRHNSVVLGWPYGWRQ-SEDPRAWKTFIDTVRCTTAAHLALLVPKNIAFYPSNHERYLEGHIDVWWIVHDGGMLMLLPFLLRQHKVWKKCRMRIFTVAQMDDNSIQMKKDLAIFLYHLRLEAEVEVVEMHNSD-ISAYTYERTLMMEQRSQMLRQMRLTKTERDREAQLVKDRHSALRLESLYSDEEDESVTGADKIQMTWTRDKYMAEPWDPSHAPDNFRELVHIKPDQSNVRRMHTAVKLNEVIVTRSHDARLVLLNMPGPPKNSEGDENYMEFLEVLTEGLERVLLVRGGGREVITIYS 1085          
BLAST of slc12a-1 vs. UniProt/SwissProt
Match: sp|Q9JIS8|S12A4_MOUSE (Solute carrier family 12 member 4 OS=Mus musculus OX=10090 GN=Slc12a4 PE=1 SV=2)

HSP 1 Score: 920.613 bits (2378), Expect = 0.000e+0
Identity = 481/1039 (46.29%), Postives = 669/1039 (64.39%), Query Frame = 2
Query:  311 DDVKDETMALYQEDYSIMNSISGYL-RAMTYQTSVAGQK----------------KNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGF--VRSPERSEMVCFLGERLLTKSFWTINKTLSCNKTMLED----------YYCNG-NLTT-FCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEV-----MPGVKGLGGRD-----VTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSISCK---GTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRKASLKDFHVDQSKL----VDTHQFTFS-PATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            +D  D  +AL++E+  I   +S  L + ++Y     G K                K P +  ++GVYLP LQ+IFGVI+FLRL W++G +G LQ   +V ICC CT LT+ISMSAIATNG V +GGSYFMISR+LGP+FG A+G+ FYLG   A AMY++G IEILLTY+AP    F   P  +HD  +A  NN R Y +  L L+ ++V +GVK+V  FA + LACVIISI+ +Y GG   +  P     VC LG R L++  + I     C KT++ D          ++C+  NLT   CD YF  N V  +P +PG A+GV++ NLW  Y+ +GEV     +P    LG ++     V  D+ T+F VL+ I+FPSVTGIM GSN SGDL+D QK IP  TI A +TTS VY S V +F       VL DKYG  +   ++V  L WP  WV+++GS  ST GAGLQ L  APRLL AIAKD++IPFL+VF      GEP   LLL+   AE  +L+ ++D++AP++ +FFLM Y FVNLACA+Q +L  PNWRPRF+YYHW LS +G +L + ++F + WYY LV + +   IYKY+EY+GAEKEWGDGIRGL L+ A+Y+LL +EE   HTKNWRPQ+L+L K + DL +KYP+L++FA QLK G+GL I+ S+++G + +     +AQ  ++ +K  M   KVKGF Q +V S V+EG++ LIQS GLG ++ N+V++GWP+ W+  S++      F+D +    +A + +L+PK ++ YPS   +   G ID+WWI+ DGG+LM+LP LL++H+VW++C +R+FTVA   DNSI MK  L  +LY LR++A VEVVE+ NSD ISAY +++TL+ME+R +++ QM+LT  E D E Q   D      L+  + D+ +      D  Q T++    +A+  D        ++   + P+    ++MH AV+LN +I  +S +A LV+LN+PGPPKN    E Y+ +L VL+EGL RVLLVRG G+EVITIYS
Sbjct:   59 NDYYDRNLALFEEELDIRPKVSSLLGKLVSYTNLTQGAKEHEEAESGEGGRRRAAKAPSMGTLMGVYLPCLQNIFGVILFLRLTWMVGTAGVLQALLIVLICCCCTLLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGLCFYLGTTFAAAMYILGAIEILLTYIAPPAAIFY--PSGTHDMSSATLNNMRVYGTIFLTLMTLVVFVGVKYVNKFASLFLACVIISILSIYAGGIKSIFDPPVFP-VCMLGNRTLSRDQFDI-----CAKTVVVDNETVATRLWTFFCHSPNLTADSCDPYFLLNNVTEIPGIPGAAAGVLQENLWSAYLEKGEVVEKHGLPSTDTLGLKESLSLYVVADIATSFTVLVGIFFPSVTGIMAGSNRSGDLRDAQKSIPVGTILAIVTTSLVYFSSVILFGACIEGVVLRDKYGDGVSRNLVVGTLAWPSPWVIVVGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHGKANGEPTWALLLTALIAELGILIASLDMVAPILSMFFLMCYLFVNLACAVQTLLRTPNWRPRFKYYHWTLSFLGMSLCLALMFVSSWYYALVAMLIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLLKLDEDLHVKYPRLLTFASQLKAGKGLTIVGSVIQGSFLES--YGEAQAAEQTIKNMMDIEKVKGFCQVVVASKVREGLAHLIQSCGLGGMRHNSVVLGWPYGWRQ-SEDPRAWKTFIDTVRCTTAAHLALLVPKNIAFYPSNHERYLDGHIDVWWIVHDGGMLMLLPFLLRQHKVWKKCRMRIFTVAQMDDNSIQMKKDLAIFLYHLRLEAEVEVVEMHNSD-ISAYTYERTLMMEQRSQMLRQMRLTKTERDREAQLVKDRHSALRLESLYSDEEEESVAGADKIQMTWTRDKYMAEPWDPSHAPDNFRELVHIKPDQSNVRRMHTAVKLNEVIVTRSHDARLVLLNMPGPPKNSEGDENYMEFLEVLTEGLERVLLVRGGGREVITIYS 1085          
BLAST of slc12a-1 vs. UniProt/SwissProt
Match: sp|Q28677|S12A4_RABIT (Solute carrier family 12 member 4 OS=Oryctolagus cuniculus OX=9986 GN=SLC12A4 PE=1 SV=1)

HSP 1 Score: 917.146 bits (2369), Expect = 0.000e+0
Identity = 477/1032 (46.22%), Postives = 665/1032 (64.44%), Query Frame = 2
Query:  314 DVKDETMALYQEDYSIMNSISGYL-RAMTYQTSVAGQK----------------KNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEM-VCFLGERLLTKSFWTI--NKTLSCNKTM---LEDYYCNG-NLTT-FCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEV-----MPGVKGLGGRD-----VTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSIS---CKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRKASLKDFHVDQ----SKLVDTHQFTFS-PATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            D  D  +AL++E+  I   +S  L + ++Y     G K                K P +  ++GVYLP LQ+IFGVI+FLRL W++G +G LQ   +V ICC CT LT+ISMSAIATNG V +GGSYFMISR+LGP+FG A+G+ FYLG   A AMY++G IEILLTY+AP    F   P  +HD   A  NN R Y +  L  + ++V +GVK+V  FA + LACVIISI+ +Y GG     +     VC LG R L++  + I    T+  N+T+   L  ++C+  NLTT  CD YF  N V  +P +PG A+GV++ NLW  Y+ +GEV     +P    +G ++     V  D+ T+F VL+ I+FPSVTGIM GSN SGDL+D QK IP  TI A +TTS VY S V +F       VL DKYG  +   ++V  L WP  WV+++GS  ST GAGLQ L  APRLL AIAKD++IPFL+VF      GEP   LLL+   AE  +L+ ++D++AP++ +FFLM Y FVNLACA+Q +L  PNWRPRF+YYHW LS +G +L + ++F + WYY LV + +   IYKY+EY+GAEKEWGDGIRGL L+ A+Y+LL +EE   HTKNWRPQ+L+L K + DL +KYP+L++FA QLK G+GL I+ S+++G + +     +AQ  ++ +K  M   KVKGF Q +V S V+EG++ LIQS GLG ++ N+V++GWP+ W+  S++      F+D +    +A + +L+PK ++ YPS      +G ID+WWI+ DGG+LM+LP LL++H+VW +C +R+FTVA   DNSI MK  L  +LY LR++A VEVVE+ NSD ISAY +++TL+ME+R +++ QM+LT  E + E Q   D      L+  + D+    +   D  Q T++    + +  D        ++   + P+    ++MH AV+LN +I  +S +A LV+LN+PGPPKN    E Y+ +L VL+EGL RVLLVRG G+EVITIYS
Sbjct:   60 DYYDRNLALFEEELDIRPKVSSLLGKLVSYTNLTQGAKEHEEAESGEGTRRRAAKAPSMGTLMGVYLPCLQNIFGVILFLRLTWMVGTAGVLQALLIVLICCCCTLLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGLCFYLGTTFAAAMYILGAIEILLTYIAPPAAIFY--PSGTHDTSNATLNNMRVYGTVFLSFMTLVVFVGVKYVNKFASLFLACVIISILSIYAGGIKSMFDPPVFPVCMLGNRTLSRDQFDICAKTTMVDNETVATRLWSFFCHSPNLTTDSCDPYFLLNNVTEIPGIPGAAAGVLQENLWSAYLEKGEVVEKRGLPSTDAVGLKENLPLYVVADIATSFTVLVGIFFPSVTGIMAGSNRSGDLRDAQKSIPVGTILAIVTTSLVYFSSVVLFGACIEGVVLRDKYGDGVSRNLVVGTLAWPSPWVIVVGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHGKANGEPTWALLLTALIAELGILIASLDMVAPILSMFFLMCYLFVNLACAVQTLLRTPNWRPRFKYYHWALSFLGMSLCLALMFVSSWYYALVAMLIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLLKLDEDLHVKYPRLLTFASQLKAGKGLTIVGSVIQGSFLES--YGEAQAAEQTIKNMMKIEKVKGFCQVVVASKVREGLAHLIQSCGLGGMRHNSVVLGWPYGWRQ-SEDPRAWKTFIDTVRCTTAAHLALLVPKNIAFYPSNHERYLEGHIDVWWIVHDGGMLMLLPFLLRQHKVWRKCRMRIFTVAQMDDNSIQMKKDLAVFLYHLRLEAEVEVVEMHNSD-ISAYTYERTLMMEQRSQMLRQMRLTKTEREREAQLVKDRHSALRLESLYSDEEDEAAAGADKIQMTWTRDKYMTEPWDPSHTPDNFRELVHIKPDQSNVRRMHTAVKLNEVIVTRSHDARLVLLNMPGPPKNSEGDENYMEFLEVLTEGLERVLLVRGGGREVITIYS 1085          
BLAST of slc12a-1 vs. UniProt/SwissProt
Match: sp|Q9UP95|S12A4_HUMAN (Solute carrier family 12 member 4 OS=Homo sapiens OX=9606 GN=SLC12A4 PE=1 SV=2)

HSP 1 Score: 914.064 bits (2361), Expect = 0.000e+0
Identity = 479/1036 (46.24%), Postives = 667/1036 (64.38%), Query Frame = 2
Query:  314 DVKDETMALYQEDYSIMNSISGYL-RAMTYQTSVAGQKKN----------------PKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGF--VRSPERSEMVCFLGERLLTKSFWTI--------NKTLSCNKTMLEDYYCNG-NLTT-FCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVM----------PGVKGLGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSIS---CKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQ---ARIDHLRKASLKDFHVDQSKL-VDTHQFTFS-PATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            D  D  +AL++E+  I   +S  L + ++Y     G K++                P +  ++GVYLP LQ+IFGVI+FLRL W++G +G LQ   +V ICC CT LT+ISMSAIATNG V +GGSYFMISR+LGP+FG A+G+ FYLG   A AMY++G IEILLTY+AP    F   P  +HD   A  NN R Y +  L  + ++V +GVK+V  FA + LACVIISI+ +Y GG   +  P     VC LG R L++  + I        N+T++   T L  ++C+  NLTT  CD YF  N V  +P +PG A+GV++ NLW  Y+ +G+++          P +K      V  D+ T+F VL+ I+FPSVTGIM GSN SGDL+D QK IP  TI A +TTS VY S V +F       VL DKYG  +   ++V  L WP  WV++IGS  ST GAGLQ L  APRLL AIAKD++IPFL+VF      GEP   LLL+   AE  +L+ ++D++AP++ +FFLM Y FVNLACA+Q +L  PNWRPRF+YYHW LS +G +L + ++F + WYY LV + +   IYKY+EY+GAEKEWGDGIRGL L+ A+Y+LL +EE   HTKNWRPQ+L+L K + DL +KYP+L++FA QLK G+GL I+ S+++G + +     +AQ  ++ +K  M   KVKGF Q +V S V+EG++ LIQS GLG ++ N+V++GWP+ W+  S++      F+D +    +A + +L+PK ++ YPS      +G ID+WWI+ DGG+LM+LP LL++H+VW +C +R+FTVA   DNSI MK  L  +LY LR++A VEVVE+ NSD ISAY +++TL+ME+R +++ QM+LT  E + E Q    R   LR  SL     D+S +  D  Q T++    + +  D        ++   + P+    ++MH AV+LN +I  +S +A LV+LN+PGPP+N    E Y+ +L VL+EGL RVLLVRG G+EVITIYS
Sbjct:   60 DYYDRNLALFEEELDIRPKVSSLLGKLVSYTNLTQGAKEHEEAESGEGTRRRAAEAPSMGTLMGVYLPCLQNIFGVILFLRLTWMVGTAGVLQALLIVLICCCCTLLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGLCFYLGTTFAAAMYILGAIEILLTYIAPPAAIFY--PSGAHDTSNATLNNMRVYGTIFLTFMTLVVFVGVKYVNKFASLFLACVIISILSIYAGGIKSIFDPPVFP-VCMLGNRTLSRDQFDICAKTAVVDNETVA---TQLWSFFCHSPNLTTDSCDPYFMLNNVTEIPGIPGAAAGVLQENLWSAYLEKGDIVEKHGLPSADAPSLKESLPLYVVADIATSFTVLVGIFFPSVTGIMAGSNRSGDLRDAQKSIPVGTILAIITTSLVYFSSVVLFGACIEGVVLRDKYGDGVSRNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHGKVNGEPTWALLLTALIAELGILIASLDMVAPILSMFFLMCYLFVNLACAVQTLLRTPNWRPRFKYYHWALSFLGMSLCLALMFVSSWYYALVAMLIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLLKLDEDLHVKYPRLLTFASQLKAGKGLTIVGSVIQGSFLES--YGEAQAAEQTIKNMMEIEKVKGFCQVVVASKVREGLAHLIQSCGLGGMRHNSVVLGWPYGWRQ-SEDPRAWKTFIDTVRCTTAAHLALLVPKNIAFYPSNHERYLEGHIDVWWIVHDGGMLMLLPFLLRQHKVWRKCRMRIFTVAQMDDNSIQMKKDLAVFLYHLRLEAEVEVVEMHNSD-ISAYTYERTLMMEQRSQMLRQMRLTKTEREREAQLVKDRHSALRLESLYSDEEDESAVGADKIQMTWTRDKYMTETWDPSHAPDNFRELVHIKPDQSNVRRMHTAVKLNEVIVTRSHDARLVLLNMPGPPRNSEGDENYMEFLEVLTEGLERVLLVRGGGREVITIYS 1085          
BLAST of slc12a-1 vs. UniProt/SwissProt
Match: sp|Q9UHW9|S12A6_HUMAN (Solute carrier family 12 member 6 OS=Homo sapiens OX=9606 GN=SLC12A6 PE=1 SV=2)

HSP 1 Score: 906.746 bits (2342), Expect = 0.000e+0
Identity = 478/1045 (45.74%), Postives = 658/1045 (62.97%), Query Frame = 2
Query:  281 DNVEEGHESDDDVKDETMALYQEDYSIMNSISGYLRAMTYQTSVA--------------GQKK---NPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEM-VCFLGERLLTKSFWTI-NKTLSCNK----TMLEDYYCNGN--LTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVM--PGVKG------LGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSIS---CKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRKASLKDFHVDQSKLVDTHQFTFSPATLAQMKDVLEMKTTTKKSK---------KLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
             N EEG    D+  D+ +AL++E+      +S  L  M   T++               G+KK    P++   +GVYLP LQ+IFGVI+FLRL W++G +G LQ F +V ICC CT LT+ISMSAIATNG V +GGSYFMISR LGP+FG A+G+ FYLG   A AMY++G IEI L Y+ P    F S    +  +  AM NN R Y +  L L+ ++V +GV++V  FA + LACVI+SI+ +Y G    S       VC LG R L+     + +KT   N     + L  ++CN +      CD+YF  N V  +  +PG ASG+I  NLW  Y+ +GE++  P  K       L    V  D+ T+F +L+ I+FPSVTGIM GSN SGDLKD QK IP  TI A LTTSFVYLS V +F       VL DK+G ++ G ++V  L WP  WV++IGS  ST GAGLQ L  APRLL AIAKD++IPFL+VF      GEP   LLL+   AE  +L+ ++DL+AP++ +FFLM Y FVNLACALQ +L  PNWRPRFRYYHW LS +G ++ + ++F + WYY +V + +   IYKY+EY+GAEKEWGDGIRGL L+ A+++LL +EE   HTKNWRPQ+L+L K + DL +K+P+L++FA QLK G+GL I+ S++ G++ +     +A   ++ +K  M   KVKGF Q +V + ++EGIS LIQS GLG +K NTV++GWP+ W+  S++      F+  +    +A + +L+ K +S +PS      +G ID+WWI+ DGG+LM+LP LLK+H+VW +C +R+FTVA   DNSI MK  L  +LY LRI+A VEVVE+ +SD ISAY +++TL+ME+R +++  M+L+  E D E Q   D      L     D+ +  +T+Q       +   KD   M +  +K+K          + P+    ++MH AV+LN +I  KS  A LV+LN+PGPP+N    E Y+ +L VL+EGL RVLLVRG G EVITIYS
Sbjct:  120 SNYEEG----DEYFDKNLALFEEEMDTRPKVSSLLNRMANYTNLTQGAKEHEEAENITEGKKKPTKTPQMGTFMGVYLPCLQNIFGVILFLRLTWVVGTAGVLQAFAIVLICCCCTMLTAISMSAIATNGVVPAGGSYFMISRALGPEFGGAVGLCFYLGTTFAAAMYILGAIEIFLVYIVPRAAIFHSD--DALKESAAMLNNMRVYGTAFLVLMVLVVFIGVRYVNKFASLFLACVIVSILAIYAGAIKSSFAPPHFPVCMLGNRTLSSRHIDVCSKTKEINNMTVPSKLWGFFCNSSQFFNATCDEYFVHNNVTSIQGIPGLASGIITENLWSNYLPKGEIIEKPSAKSSDVLGSLNHEYVLVDITTSFTLLVGIFFPSVTGIMAGSNRSGDLKDAQKSIPIGTILAILTTSFVYLSNVVLFGACIEGVVLRDKFGDAVKGNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHSKANGEPTWALLLTAAIAELGILIASLDLVAPILSMFFLMCYLFVNLACALQTLLRTPNWRPRFRYYHWALSFMGMSICLALMFISSWYYAIVAMVIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARFALLRLEEGPPHTKNWRPQLLVLLKLDEDLHVKHPRLLTFASQLKAGKGLTIVGSVIVGNFLEN--YGEALAAEQTIKHLMEAEKVKGFCQLVVAAKLREGISHLIQSCGLGGMKHNTVVMGWPNGWRQ-SEDARAWKTFIGTVRVTTAAHLALLVAKNISFFPSNVEQFSEGNIDVWWIVHDGGMLMLLPFLLKQHKVWRKCSIRIFTVAQLEDNSIQMKKDLATFLYHLRIEAEVEVVEMHDSD-ISAYTYERTLMMEQRSQMLRHMRLSKTERDREAQLVKDRNSMLRLTSIGSDEDEETETYQ---EKVHMTWTKDKY-MASRGQKAKSMEGFQDLLNMRPDQSNVRRMHTAVKLNEVIVNKSHEAKLVLLNMPGPPRNPEGDENYMEFLEVLTEGLERVLLVRGGGSEVITIYS 1150          
BLAST of slc12a-1 vs. TrEMBL
Match: A0A0H3YEZ5 (Slc12a-1 OS=Schmidtea mediterranea OX=79327 GN=slc12a-1 PE=2 SV=1)

HSP 1 Score: 2164.81 bits (5608), Expect = 0.000e+0
Identity = 1045/1045 (100.00%), Postives = 1045/1045 (100.00%), Query Frame = 2
Query:  143 QNGDQNALLLNDENREHSVSFRDRHSIINDQKIGKLEVRKVSSGLTDNVEEGHESDDDVKDETMALYQEDYSIMNSISGYLRAMTYQTSVAGQKKNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEMVCFLGERLLTKSFWTINKTLSCNKTMLEDYYCNGNLTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVMPGVKGLGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEEETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSISCKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRKASLKDFHVDQSKLVDTHQFTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            QNGDQNALLLNDENREHSVSFRDRHSIINDQKIGKLEVRKVSSGLTDNVEEGHESDDDVKDETMALYQEDYSIMNSISGYLRAMTYQTSVAGQKKNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEMVCFLGERLLTKSFWTINKTLSCNKTMLEDYYCNGNLTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVMPGVKGLGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEEETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSISCKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRKASLKDFHVDQSKLVDTHQFTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS
Sbjct:   20 QNGDQNALLLNDENREHSVSFRDRHSIINDQKIGKLEVRKVSSGLTDNVEEGHESDDDVKDETMALYQEDYSIMNSISGYLRAMTYQTSVAGQKKNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEMVCFLGERLLTKSFWTINKTLSCNKTMLEDYYCNGNLTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVMPGVKGLGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEEETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSISCKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRKASLKDFHVDQSKLVDTHQFTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 1064          
BLAST of slc12a-1 vs. TrEMBL
Match: A0A5S6QAR5 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 1050.04 bits (2714), Expect = 0.000e+0
Identity = 543/1092 (49.73%), Postives = 722/1092 (66.12%), Query Frame = 2
Query:  245 KLEVRKVSSGLTDNVEEGHESDDDV----------KDETMALYQEDYSIMNSISGYLRAMTY----QTSVAGQKKNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEMVCFLGERLLTKSFWTINKTLS--CNKTM---LEDYYC---NGNLTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVMPGVKGLGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEEETHT--KNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWK-GISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSIS--CKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRK----------------------------ASLKDFHVDQSKLVDTHQFTFSP-ATLAQMKD----------------------VLEMKTT---TKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            K E RK   GL D  +  +  + D+            + ++LY++D S M +I+ YLR+ T     +   A  +K   L  +IGVYLPT+QHI GV MFLRL+WI+G +G  + F MV +CC+CTFLTSIS+SAIATNG ++SGG+YFMISRNLGPQFG A+GIL+Y  NA AT+MYLVG +EILL Y+AP+LPQF         D   +FNNFR YASGLL + F IVALGV FVQ FAP++LACV++SI+ +Y+G FV S   S  +C LG RLL K F +    LS  C K     +   YC   N +    CD +F  N +     +PG+++ +   N    YM  GEV PGV G+  R++T+D+ TNFF+LLAI++PSVTGI TG+NMSGDLK+P K IP  TIAAQ+TTSF+YLSFV IF GT R  +L DKYG S+   M+VA L WP +W+LLIGS TSTFGA LQCLCSAPRLL +IAKDDVIPFL+ FS +T+  EPFR LL++   AECA+L+G +D IAP+VD FFLM Y FVNL CALQ +L APNWRPR+R+YHW LSL+GA + +FI+F+T+WYY LV   L   IYKY+EY+GA+KEWGDG+RG  L+ A+YSLL IE+  H+  KNWRPQ+LIL K +        K + FA QLK GRGL I+A+++EGD AD   ++  +KVK  LK  +  +KV+GFVQ +V   + + +STLIQS+G+G L+PNT+MVGWP++WK  +   +     FLDAIHR  +A++C+L+PKG+ E+P  +   +GTID+WWI+ DGGLL++LP LL +H+VW +C++RVFTVA   DNS+ MK  L  W+Y LRI ATV+VVE  +S  ISAY +++TL+MEER +L   + L+++E  LEPQ   D  R+                            +  K    + ++  ++   +  P A  A+  D                        +M +T   TKK K    ++++ +KM+ A++LN  IKEKS ++ LVILNLP PPK +H L  Y++YL VL+EGL RVLLVRG+GKEVIT+YS
Sbjct:   18 KKERRKSKDGLGDECKPLNRKESDMFRKLSQRSFAHAQGLSLYEDDVSSMPTIAAYLRSFTLPGPKENEEADGRKRAGLGTLIGVYLPTVQHILGVQMFLRLFWIVGIAGIGESFAMVLLCCICTFLTSISISAIATNGVIESGGAYFMISRNLGPQFGGAVGILYYFANAFATSMYLVGGVEILLMYLAPSLPQFGDPTARRETD---VFNNFRAYASGLLLIEFCIVALGVTFVQFFAPVSLACVVMSILSIYIGAFVTSDAASPEICMLGNRLL-KHFPSDQGNLSSWCTKAADGPIWSAYCKRSNSSAAVECDPFFNQNTLSITAGLPGFSAALFSENFPASYMDHGEVTPGVAGVNSREITQDIATNFFMLLAIFYPSVTGIFTGANMSGDLKEPHKSIPVGTIAAQMTTSFIYLSFVLIFGGTIRGALLRDKYGESLENNMVVALLGWPSKWILLIGSFTSTFGAALQCLCSAPRLLQSIAKDDVIPFLRGFSSVTKQNEPFRALLVTTAVAECAILIGGIDYIAPIVDFFFLMCYCFVNLVCALQTLLRAPNWRPRYRFYHWSLSLLGAVMCLFIMFSTHWYYALVVCILCATIYKYIEYKGAKKEWGDGLRGFALSTAQYSLLQIEDSVHSHPKNWRPQLLILLKVDKLSEKVNTKALQFAHQLKAGRGLTIVATILEGDLADHQTQEMVEKVKLRLKHDIEDSKVRGFVQVVVAEHLAQNVSTLIQSVGIGGLRPNTIMVGWPYSWKDSVHQADQNYWNFLDAIHRAATADMCLLVPKGLLEFPDSNDRVQGTIDVWWIIHDGGLLLLLPFLLHQHKVWRQCKLRVFTVAQMHDNSVKMKQDLQNWVYQLRIDATVDVVEFADS-TISAYTYERTLIMEERTRLALDLHLSSREFLLEPQLLADRHRRRLNANRDDSSPDVGDQKKSTMTTELSCHSQFKGLQSEDAETSESISLSSKPSADGAEQNDGKDDITERDVHEDANENGNNRVRFDMSSTNEVTKKHKFARLDHDKVRKMNTAMKLNDAIKEKSSDSQLVILNLPRPPKMRHGLPNYMDYLEVLTEGLERVLLVRGSGKEVITMYS 1104          
BLAST of slc12a-1 vs. TrEMBL
Match: A0A085MGU9 (Uncharacterized protein OS=Trichuris suis OX=68888 GN=M513_02549 PE=4 SV=1)

HSP 1 Score: 1021.92 bits (2641), Expect = 0.000e+0
Identity = 536/1092 (49.08%), Postives = 719/1092 (65.84%), Query Frame = 2
Query:  245 KLEVRKVSSGLTDNVEEGHESDDDV----------KDETMALYQEDYSIMNSISGYLRAMTY----QTSVAGQKKNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEMVCFLGERLLTKSFWTINKTLS--CNKTM---LEDYYC---NGNLTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVMPGVKGLGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEEETHT--KNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEH-EFLDAIHRVVSAEICMLIPKGVSEYPSISCK--GTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQ-------------------------------ARIDHLRKASLKD--FHVDQS---------------------KLVDTHQFTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            K E RK   G  D  +  +  + D+            + ++LY++D + M +I+ YLR+ T     +   A  +K+  L  +IGVYLPT+QHI GV MFLRL+WI+G +G  + F MV +CC+CTFLTSIS+SAIATNG ++SGG+YFMISRNLGP+FG A+GIL+Y  NA AT+MYLVG +EILL Y+AP+LPQF         D   +FNNFR YAS LL   F IVA+GVKFVQ FAPI+LACV++SI+ +Y+G FV S   S  +C LG RLL K F + +  LS  C K +   +   YC   N +    CD +F  N +     +PG++S +   N    YM  GEV PG+ G+  R+VT+D+ TNFF+LLAI++PSVTGI TG+NMSGDLK+P + IP  TIAAQ+TTSF+YLSFV +F GT R  +L DKYG S+   M+VA L WP +WVLLIGS TSTFGA LQCLCSAPRLL +IAKDDVIPFL+ FS +T+  EPF+ LL++   AECA+L+G +D IAP+VD FFLM Y FVNL CALQ +L APNWRPR+R+YHW LSL+GA L +FI+F+T+WYY LV   L   IYKY+EY+GA+KEWGDG+RG  L+ A+YSLL IE+  HT  KNWRPQ+LIL K +        K + FA QLK GRGL I+A+++EG+ AD D ++  + VK  LK+ +  +KV+GFVQ +V   + + +STLIQS+G+G L+PNT+MVGWP++WK    +  P +  FLDAIHR  +A++C+L+PKG+ ++P  + +  GTID+WWI+ DGGLL++LP LL +H+VW +C++RVFTVA   DNS+ MK  L  W+Y LRI ATV+VVE  +S  ISAY +++TL+MEER +L   + L+++E   EPQ                                 +D L K+S  +   H D+                      +  D H+ + +        D+       KK +    + E+ +KM+ A++LN  IKEKS ++ L+ILNLP PPK +  L  Y++YL VL+EGL RVLLVRG+GKEVIT+YS
Sbjct:   17 KKEKRKSKDGHWDESKPLNRKESDMFHKLSQRSFGHAQGLSLYEDDVTSMPTIAAYLRSFTLPGPKEHEEADGRKHAGLGTLIGVYLPTVQHILGVQMFLRLFWIVGIAGIGESFSMVLLCCICTFLTSISISAIATNGVIESGGAYFMISRNLGPEFGGAVGILYYFANAFATSMYLVGGVEILLMYLAPSLPQFGDPIARRETD---VFNNFRVYASALLLFEFCIVAMGVKFVQFFAPISLACVVMSILSIYVGAFVTSDSTSPEICMLGNRLL-KQFPSEHGNLSSWCTKAVGGPIWSAYCKRSNESGMVECDPFFNQNTLSLTAGIPGFSSALFSENFPSSYMEHGEVTPGIAGVNSREVTQDITTNFFLLLAIFYPSVTGIFTGANMSGDLKEPHRSIPVGTIAAQMTTSFIYLSFVLVFGGTIRGALLRDKYGESLENNMVVALLGWPSKWVLLIGSFTSTFGAALQCLCSAPRLLQSIAKDDVIPFLREFSSVTKRNEPFKALLITTAVAECAILIGGIDYIAPVVDFFFLMCYCFVNLVCALQTLLRAPNWRPRYRFYHWSLSLLGALLCLFIMFSTHWYYALVVCVLCATIYKYIEYKGAKKEWGDGLRGFALSTAQYSLLQIEDSVHTHPKNWRPQLLILLKVDKRSDKVNAKALQFAHQLKAGRGLTIVATILEGNLADHDTQELLEAVKVRLKQDVQDSKVRGFVQVVVAEHLSQNVSTLIQSVGIGGLRPNTIMVGWPYSWKDSIHQADPHYWNFLDAIHRAATADMCLLVPKGLLDFPDSNDRVHGTIDVWWIIHDGGLLLLLPFLLHQHKVWRQCKLRVFTVAQMHDNSVKMKQDLENWVYQLRIDATVDVVEFADS-TISAYTYERTLIMEERTRLALDLHLSSREFLQEPQLLADRHRRRLHAHRDDGSSDASDQKSPTVAEQPVDSLYKSSQPEDAEHFDEKPSSSNPSLDSGDQTDEKTENVEHADDHEESAANGNNRVRFDISSANEEAKKKRFARLDREKVRKMNTAMKLNEAIKEKSSDSQLIILNLPRPPKMRRGLPNYMDYLEVLTEGLERVLLVRGSGKEVITMYS 1103          
BLAST of slc12a-1 vs. TrEMBL
Match: A0A077Z8J7 (Amino acid permease OS=Trichuris trichiura OX=36087 GN=TTRE_0000423701 PE=4 SV=1)

HSP 1 Score: 1018.45 bits (2632), Expect = 0.000e+0
Identity = 528/1054 (50.09%), Postives = 711/1054 (67.46%), Query Frame = 2
Query:  326 ETMALYQEDYSIMNSISGYLRAMTY----QTSVAGQKKNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEMVCFLGERLLTKSFWTINKTLS--CNKTM---LEDYYC---NGNLTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVMPGVKGLGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEEETHT--KNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEH-EFLDAIHRVVSAEICMLIPKGVSEYPSISCK--GTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHL------------------RKASLKDFHVD----QSKLVDTHQFTFSP----------------------------ATLAQMKDVLEMKTTTKKSKK---LNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            + ++LY++D + M +I+ YLR+ T     +   A  +K+  L  +IGVYLPT+QHI GV MFLRL+WI+G +G  + F MV +CC+CTFLTSIS+SAIATNG ++SGG+YFMISRNLGP+FG A+GIL+Y  NA AT+MYLVG +EILL Y+AP+LPQF         D   +FNNFR YAS LL L F IVA+GVKFVQ FAPI+LACV++SI+ +Y+G FV S   S  +C LG RLL K F +    +S  C K +   +   YC   N +    CD +F  N +     +PG++S +   N    YM  GEV PG+ G+  R+VT+D+ TNFF+LLAI++PSVTGI TG+NMSGDLK+P + IP  TIAAQ+TTSF+YLSFV +F GT R  +L DKYG S+   M+VA L WP +W+LLIGS TSTFGA LQCLCSAPRLL +IAKDDVIPFL+ FS +T+  EPF+ LL++   AECA+L+G +D IAP+VD FFLM Y FVNL CALQ +L APNWRPR+R+YHW LSL+GA L +FI+F+T+WYY L+   L   IYKY+EY+GA+KEWGDG+RG  L+ A+YSLL IE+  HT  KNWRPQ+LIL K +        K + FA QLK GRGL I+A+++EG+ AD D ++  + VK  LK+ +  +KV+GFVQ +V   + + +STLIQS+G+G L+PNT+MVGWP++WK    +  P +  FLDAIHR  +A++C+L+PKG+ ++P  + +  GTID+WWI+ DGGLL++LP LL +H+VW +C++RVFTVA   DNS+ MK  L  W+Y LRI ATV+VVE  +S  ISAY +++TL+MEER +L   + L+++E   EPQ   D                    +  ++ +  VD     S+  D   F   P                            AT    +   ++ +T +++KK      + E+ +KM+ A++LN  IKEKS ++ L+ILNLP PPK +  L  Y++YL VL+EGL RVLLVRG+GKEVIT+YS
Sbjct:   54 QGLSLYEDDVTSMPTIAAYLRSFTLPGPKEHEEADGRKHAGLGTLIGVYLPTVQHILGVQMFLRLFWIVGIAGIGESFSMVLLCCICTFLTSISISAIATNGVIESGGAYFMISRNLGPEFGGAVGILYYFANAFATSMYLVGGVEILLMYLAPSLPQFGDPIARRETD---VFNNFRVYASALLLLEFCIVAMGVKFVQFFAPISLACVVMSILSIYVGAFVTSDSTSPEICMLGNRLL-KQFPSEQTNVSNWCTKAVGSPIWSAYCKRSNESGMVECDPFFNQNTLSLTAGIPGFSSALFSENFPSSYMEHGEVTPGIAGVNSREVTQDITTNFFLLLAIFYPSVTGIFTGANMSGDLKEPHRSIPVGTIAAQMTTSFIYLSFVLVFGGTIRGALLRDKYGESLENNMVVALLGWPSKWILLIGSFTSTFGAALQCLCSAPRLLQSIAKDDVIPFLREFSSVTKRNEPFKALLITTAVAECAILIGGIDYIAPVVDFFFLMCYCFVNLVCALQTLLRAPNWRPRYRFYHWSLSLLGALLCLFIMFSTHWYYALIVCVLCATIYKYIEYKGAKKEWGDGLRGFALSTAQYSLLQIEDSVHTHPKNWRPQLLILLKVDKRSDKVNAKALQFAHQLKAGRGLTIVATILEGNLADHDTQELMEVVKLRLKQDVQDSKVRGFVQVVVAEHLSQNVSTLIQSVGIGGLRPNTIMVGWPYSWKDSIHQADPHYWNFLDAIHRAATADMCLLVPKGLLDFPDSNNRVHGTIDVWWIIHDGGLLLLLPFLLHQHKVWRQCKLRVFTVAQMHDNSVKMKQDLENWVYQLRIDATVDVVEFADS-TISAYTYERTLIMEERTRLALDLHLSSREYLQEPQLLADRHRRRLHAHRDDGSSDASDQKSPTVIEQPVDPVYKSSQPEDGEHFDEKPSSSNPSLDGGDQADEKTDSAETEDREGSATNGNNRVRFDISSTNEETKKKKFARLDREKVRKMNTAMKLNEAIKEKSSDSQLIILNLPRPPKMRRGLPNYMDYLEVLTEGLERVLLVRGSGKEVITMYS 1102          
BLAST of slc12a-1 vs. TrEMBL
Match: A0A267F799 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002002g2 PE=4 SV=1)

HSP 1 Score: 978.393 bits (2528), Expect = 0.000e+0
Identity = 509/964 (52.80%), Postives = 656/964 (68.05%), Query Frame = 2
Query:  155 QNALLLNDENREHSVSFRDRHSIINDQKIGKLEVRKVSSGLTDNVEEGHESDD-----DVKDETMALYQED-----YSIMNSISGYLRAMTYQTSVAGQKKNPK-----------LNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEMVCFLGERLLTK-SFWTINKTLSCNKTMLEDYYC-----NGNLTTF--CDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVMPGVKGLGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE--ETHTKNWRPQILILCKT-----NSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHE---FLDAIHRVVSAEICMLIPKGVSEYPSISC---KGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRKAS 2920
            Q   ++ DE   H VSFR R SII++  +  +     S G          ++D        D  +A++ E+        + +++ YLR  T+ + +  +K+              L  I+GVYLPT+QHIFGV+MFLRL+WI+G SG  +   +VFICC CT LTSISMSAIATNG V+SGG YFMISRNLGP+FGSA+G+LFYL NA+AT+MYLVG +E+LL Y+ PTLP+F       H     MFNNFR YAS LL + FVIVA+GV+FVQLFAPI+L+CVI+S++ +Y G F  SP+R   VC LG+ LL + + +  N  L CNKT LE  YC     + N   F  C++ +  N  + +PA PG+ SGV K N+   Y  +GE  PGV G   RDV +D+ T FF+LLAIYFPSVTGIMTGSNMSGDL DPQK IP  TIAAQ TTSFVYLS +  F GT    VL DK+G S+   ++ A+L WP  W+LLIGS TSTFGA LQCLCSAPRLL +IAKD+V+PFL+ F+ + RFGEPF  LL++   AEC +L+G +D IAP+VD FFLM Y FVNL CALQ ++ APNWRPRFRYYHW LSL+GAAL  FI+FATYWYY LV   L  AIYKYVEY GA KEWGDGIRGL L+ A+YSLL IEE  E H KNWRPQ+L L KT      + +  K  +++  AGQLK G+GL++ A+L+EGD +D   R  A++ +E LK CM   K KGF Q ++C++  EG+S LIQS+G+GAL+PNTV+VGWP  WK     ESPE E   FLDAI +V S+ +C+LIPKG  ++P  S     G ID+WW+M DGGLL++LP LL +HRVW  C +RVF+VA  +DN++ M++ L + +Y LRI A V VVEL +SD ++AY HQKTL ME+R  L+++++L+ K +  +PQ  +D LR+ S
Sbjct:    8 QKETMVEDEEHPH-VSFRHRPSIIDNLVVSTVRKPTASGGAGGAAAAAGGAEDTRPLKSEADAELAVFVEEDGDGPTGPLPTLNAYLR--TFTSPMRNEKEESSDQQKKAPKKAKLGVILGVYLPTIQHIFGVLMFLRLFWIVGVSGVWESGAIVFICCFCTLLTSISMSAIATNGVVESGGVYFMISRNLGPEFGSAVGVLFYLANAMATSMYLVGGVEMLLVYLLPTLPKFGEADEFGHIAEADMFNNFRIYASILLLIEFVIVAIGVRFVQLFAPISLSCVIVSVLAMYAGAFAASPDRGPKVCLLGDVLLRQHALYENNTYLGCNKTALERLYCAYTNSSENEAGFYRCEESYMRNDFREVPAFPGFLSGVFKENMQSQYTKKGEAAPGVVGNKQRDVVQDIATGFFILLAIYFPSVTGIMTGSNMSGDLADPQKSIPVGTIAAQFTTSFVYLSLIFAFGGTVNGAVLRDKFGYSLNT-LVTAKLAWPSHWILLIGSFTSTFGAALQCLCSAPRLLQSIAKDEVLPFLRPFATLNRFGEPFYALLITTVIAECGILVGAIDHIAPIVDFFFLMCYGFVNLVCALQTLVRAPNWRPRFRYYHWSLSLLGAALCAFIMFATYWYYALVVCGLCAAIYKYVEYAGARKEWGDGIRGLALSTARYSLLRIEEAGEQHCKNWRPQLLALVKTAPLGEEAPVEGKCQQIVGLAGQLKAGKGLLMAATLLEGDVSDPVSRSAARQSREQLKSCMDREKAKGFSQAVICTNRSEGLSVLIQSLGIGALRPNTVVVGWPTQWKA----ESPESEYYDFLDAIQKVTSSGMCLLIPKG-DDFPLNSGPKQSGNIDVWWVMHDGGLLLLLPFLLLQHRVWRHCRIRVFSVAGPTDNTLKMREDLRRMIYQLRITAEVSVVELGDSD-LTAYTHQKTLQMEKRTALMQKLRLSQKALSSQPQLLLDALRRGS 961          

HSP 2 Score: 88.9669 bits (219), Expect = 5.900e-14
Identity = 44/69 (63.77%), Postives = 53/69 (76.81%), Query Frame = 2
Query: 3071 KKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            KKMH+A+ LN  I E S ++ LVI+NLP PP+N+  L  Y+ YL  L+EGL RVLLVRGTGKEVITIYS
Sbjct: 1094 KKMHSAIRLNRKISELSGDSKLVIINLPKPPRNRDGLNNYICYLDALTEGLNRVLLVRGTGKEVITIYS 1162          
BLAST of slc12a-1 vs. Ensembl Cavefish
Match: SLC12A6 (solute carrier family 12 member 6 [Source:NCBI gene;Acc:103029714])

HSP 1 Score: 883.634 bits (2282), Expect = 0.000e+0
Identity = 480/1091 (44.00%), Postives = 661/1091 (60.59%), Query Frame = 2
Query:  308 DDDVKDETMALYQEDYSIMNSISGYLRAMTYQTSVA------------GQK----KNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRS-PERSEMVCFLGERLLTK---------------------SFWTINKTLSCNKTM-------------LEDYYCNGN-LTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVMPGVKGLGGRDVT--------------RDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSIS---CKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQ---ARIDHLRKASL-----------------------KDFHVDQSK-----LVDTHQFTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            DDD  D  +AL++E+      +S  L  +   T++             G+K    K+P++   +GVYLP LQ+IFGVI+FLRL W++G +G LQ   +VFICC CT LT+ISMSAIATNG V +GGSYFMISR+LGP+FG A+G+ FYLG   A +MY++G IEILL Y+AP+   F S       +  AM NN R Y S  L L+ ++V +GVK+V   A + LACVI+SI+ +Y G  V +    S  VC LG R L++                         +N + S N T+             L   +CN + L   CD+YF  N V  +  +PG ASGVI  N+W  Y+S+GE++       G D T               D+ T+F +L+ I+FPSVTGIM GSN SGDLKD Q+ IP  TI A LTTS VYLS V +F       +L DK+G S+ G ++V  L WP  WV++IGS  ST GAGLQ L  APRLL AIAKD++IPFL+VF      GEP   LLL+ F AE  +L+ ++DL+AP++ +FFLM Y FVNLACALQ +L  PNWRPRF YYHW LS +G  + + ++F + WYY +V +A+   IYKY+EY GAEKEWGDGIRGL L+ A+Y+LL +EE   HTKNWRPQ+L+L K + D  +K P+L++FA QLK G+GL I+ +++ G++        +   ++ LK  M   +VKGFVQ IV    +EGIS +IQS GLG ++ NTV++GWPH W+   D +S +  F++ +    +A + +L+PK +S +P+ S    +G ID+WWI+ DGG+LM+LP LL++H+VW +C++R+FTVA   DNSI MK  L  +LY LRI+A VEVVE+ +SD ISAY +++TL+ME+R +++ QM+L+  + + E Q    R   LR  S+                       +  H+  +K     L          +T    +D+L M+          P++   ++MH AV+LN +I  KS  A LV+LN+PGPPKN    E Y+ +L VL+EGL RVLLVRG G EVITIYS
Sbjct:   92 DDDFYDRNLALFEEEMDTRPKVSSLLSRLANYTNLTQGAREHEEAESIGEKRKASKSPQMGTFMGVYLPCLQNIFGVILFLRLTWVVGTAGILQALCIVFICCCCTMLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGLCFYLGTTFAGSMYILGAIEILLMYIAPSAAIFVSH--QPEGEAAAMLNNMRVYGSIFLLLMSLLVFVGVKYVNKLASVFLACVIVSILSIYTGALVSAFSSPSFPVCMLGNRSLSQHELRDGHCAKTVLVLREPPVQEVTYVNISSSFNSTVSPPPPTLVEKTTSLWTRFCNSSELNAVCDEYFTHNNVTQIQGIPGLASGVITDNVWSSYLSKGEILER-----GSDPTPSPIHPNHHHPYVFADITTSFTLLVGIFFPSVTGIMAGSNRSGDLKDAQRSIPIGTILAILTTSLVYLSSVVLFGACVEGVLLRDKFGDSVKGNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHGKANGEPTWALLLTTFIAELGILIASLDLVAPILSMFFLMCYLFVNLACALQTLLRTPNWRPRFSYYHWTLSFLGMIICLALMFISSWYYAIVAMAIATMIYKYIEYHGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLLKLDEDAHVKSPRLLTFASQLKAGKGLTIVGTVLSGNFLHS--YGDSLAAEQTLKHLMEKERVKGFVQCIVAQKPREGISHMIQSSGLGGMRHNTVVMGWPHAWRQSEDPQSWK-TFINTVRVTTAAHLALLVPKNISLFPTNSEPCTEGHIDVWWIVHDGGMLMLLPFLLRQHKVWRKCKMRIFTVAQMEDNSIQMKKDLGTFLYHLRIEADVEVVEMHDSD-ISAYTYERTLMMEQRSQMLRQMRLSKSDREKEAQLVKDRNSMLRLTSIGSDDDDDTDGVGGSDKLGVASDHRRVHMTWTKDKALELRAQAHIPSGCSTPEGFRDMLSMR----------PDHSNVRRMHTAVKLNEVIVNKSNEARLVLLNMPGPPKNPDGDENYMEFLEVLTEGLERVLLVRGGGSEVITIYS 1161          
BLAST of slc12a-1 vs. Ensembl Cavefish
Match: SLC12A6 (solute carrier family 12 member 6 [Source:NCBI gene;Acc:103029714])

HSP 1 Score: 878.241 bits (2268), Expect = 0.000e+0
Identity = 479/1099 (43.59%), Postives = 661/1099 (60.15%), Query Frame = 2
Query:  308 DDDVKDETMALYQEDYSIMNSISGYLRAMTYQTSVA------------GQK----KNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRS-PERSEMVCFLGERLLTK---------------------SFWTINKTLSCNKTM-------------LEDYYCNGN-LTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVMPGVKGLGGRDVT--------------RDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSIS---CKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEP-----------QARIDHLRKASL-----------------------KDFHVDQSK-----LVDTHQFTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            DDD  D  +AL++E+      +S  L  +   T++             G+K    K+P++   +GVYLP LQ+IFGVI+FLRL W++G +G LQ   +VFICC CT LT+ISMSAIATNG V +GGSYFMISR+LGP+FG A+G+ FYLG   A +MY++G IEILL Y+AP+   F S       +  AM NN R Y S  L L+ ++V +GVK+V   A + LACVI+SI+ +Y G  V +    S  VC LG R L++                         +N + S N T+             L   +CN + L   CD+YF  N V  +  +PG ASGVI  N+W  Y+S+GE++       G D T               D+ T+F +L+ I+FPSVTGIM GSN SGDLKD Q+ IP  TI A LTTS VYLS V +F       +L DK+G S+ G ++V  L WP  WV++IGS  ST GAGLQ L  APRLL AIAKD++IPFL+VF      GEP   LLL+ F AE  +L+ ++DL+AP++ +FFLM Y FVNLACALQ +L  PNWRPRF YYHW LS +G  + + ++F + WYY +V +A+   IYKY+EY GAEKEWGDGIRGL L+ A+Y+LL +EE   HTKNWRPQ+L+L K + D  +K P+L++FA QLK G+GL I+ +++ G++        +   ++ LK  M   +VKGFVQ IV    +EGIS +IQS GLG ++ NTV++GWPH W+   D +S +  F++ +    +A + +L+PK +S +P+ S    +G ID+WWI+ DGG+LM+LP LL++H+VW +C++R+FTVA   DNSI MK  L  +LY LRI+A VEVVE+ +SD ISAY +++TL+ME+R +++ QM+L+  + + E            + R   LR  S+                       +  H+  +K     L          +T    +D+L M+          P++   ++MH AV+LN +I  KS  A LV+LN+PGPPKN    E Y+ +L VL+EGL RVLLVRG G EVITIYS
Sbjct:   92 DDDFYDRNLALFEEEMDTRPKVSSLLSRLANYTNLTQGAREHEEAESIGEKRKASKSPQMGTFMGVYLPCLQNIFGVILFLRLTWVVGTAGILQALCIVFICCCCTMLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGLCFYLGTTFAGSMYILGAIEILLMYIAPSAAIFVSH--QPEGEAAAMLNNMRVYGSIFLLLMSLLVFVGVKYVNKLASVFLACVIVSILSIYTGALVSAFSSPSFPVCMLGNRSLSQHELRDGHCAKTVLVLREPPVQEVTYVNISSSFNSTVSPPPPTLVEKTTSLWTRFCNSSELNAVCDEYFTHNNVTQIQGIPGLASGVITDNVWSSYLSKGEILER-----GSDPTPSPIHPNHHHPYVFADITTSFTLLVGIFFPSVTGIMAGSNRSGDLKDAQRSIPIGTILAILTTSLVYLSSVVLFGACVEGVLLRDKFGDSVKGNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHGKANGEPTWALLLTTFIAELGILIASLDLVAPILSMFFLMCYLFVNLACALQTLLRTPNWRPRFSYYHWTLSFLGMIICLALMFISSWYYAIVAMAIATMIYKYIEYHGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLLKLDEDAHVKSPRLLTFASQLKAGKGLTIVGTVLSGNFLHS--YGDSLAAEQTLKHLMEKERVKGFVQCIVAQKPREGISHMIQSSGLGGMRHNTVVMGWPHAWRQSEDPQSWK-TFINTVRVTTAAHLALLVPKNISLFPTNSEPCTEGHIDVWWIVHDGGMLMLLPFLLRQHKVWRKCKMRIFTVAQMEDNSIQMKKDLGTFLYHLRIEADVEVVEMHDSD-ISAYTYERTLMMEQRSQMLRQMRLSKSDREKERVRWSFDDAQLVKDRNSMLRLTSIGSDDDDDTDGVGGSDKLGVASDHRRVHMTWTKDKALELRAQAHIPSGCSTPEGFRDMLSMR----------PDHSNVRRMHTAVKLNEVIVNKSNEARLVLLNMPGPPKNPDGDENYMEFLEVLTEGLERVLLVRGGGSEVITIYS 1169          
BLAST of slc12a-1 vs. Ensembl Cavefish
Match: slc12a7b (solute carrier family 12 member 7-like [Source:NCBI gene;Acc:103031657])

HSP 1 Score: 860.907 bits (2223), Expect = 0.000e+0
Identity = 472/1098 (42.99%), Postives = 674/1098 (61.38%), Query Frame = 2
Query:  260 KVSSGLTDNVEEGHESDDDVKDETMALYQEDY-------SIMNSISGY------LRAMTYQTSVAGQKK----NPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEM--VCFLGERLL--------TKSFWTINKTLSCNKTMLEDYYCNG-NLTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGE-VMPGVKGLGGRDVTRDM--------MTNFFVLL-AIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEEE-THTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSIS--CKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRK-------------------ASLKDFHVDQSKLV-------------------DTHQFTFS-------------PATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            K SS   +N +    +  D K+  MAL++E+        S+++ ++ Y      +R         G KK    +P++   IGVYLP LQ+I GVI+FLR+ WI+G +G L+ F +V +CC CT LT+ISMSAIATNG V +GGSY+MISR+LGP+FG A+G+ FYLG   A AMY++GTIEILLTY+ P+   F+++  +   +  AM NN R Y +  L L+ ++V +GVK+V   A + LACV++SI+ +Y  G +++     +  VC LG R L         K+    N T++   T L   +C+   L + C++YF  N V  +P +PG  SGVI  N+W  Y   G  V   +  +   + TRD+        +  FF LL  IYFPSVTGIM GSN SGDL+D Q+ IP  TI A  TT+ +YLS V +F       VL DK+G S+ G +++  L WP  WV++IGS  S  GAGLQ L  APRLL AIA+D ++PFL+VF      GEP   LLL+    E  +L+ ++D +AP++ +FFLM Y FVNLACALQ +L  PNWRPRF+YYHW LS +G +L + ++F + WYY LV + +   IYKY+EYRGAEKEWGDGIRG+ L  A+Y+L+ +EE   HTKNWRPQ+L+L   +S+L +K+P+L+SF  QLK G+GL I+ S++EG Y  KD   +A+K ++N+K  M T + KGF   +V S++++GIS LIQS GLG +K N+V++ WP +WK  +D  S ++ F++ +    +A + +L+ K V  +P      +GTID+WWI+ DGG+LM+LP LL++H+VW +C++R+FTVA   DNSI MK  L  +LY LR+ A VEVVE+  SD ISA+ ++KTLVME+R ++++QM+L+  E + E Q+  D  R                    A L+D   ++++L+                   D    T++             P T   ++D+  MK    + + LN  N   ++MH AV+LN ++  KS  A LV+LN+PGPPKN+   E Y+ +L VL EGL RVLLVRG G+EVITIYS
Sbjct:   16 KESSPFINNTDNDRGTLYDGKN--MALFEEEMDSNPMVSSLLSKLANYTNLTQGVREHEEADEEEGAKKQTVKSPQMGTFIGVYLPCLQNILGVILFLRMTWIVGTAGILEAFIIVAMCCSCTMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGTIEILLTYIVPSAAIFKAEDKAYEAE--AMLNNMRVYGTCCLTLMALVVFVGVKYVNKLALVFLACVVLSILAIY-AGVIKTIFEPPVFPVCLLGNRTLKNHGFDKCAKTDIIGNVTVT---TKLWSLFCDSPELNSTCNEYFTLNNVTEIPGIPGLTSGVISENMWSSYGPAGMLVEKAIDAMEASETTRDVNLPYVVNDIATFFTLLVGIYFPSVTGIMAGSNRSGDLRDAQRSIPIGTILAIATTTIIYLSCVVLFGACIDGVVLRDKFGDSVRGNLVIGTLSWPSPWVIVIGSFFSCCGAGLQSLTGAPRLLQAIARDGIVPFLEVFGHGKANGEPTWALLLTAGICETGILIASLDAVAPILSMFFLMCYLFVNLACALQTLLRTPNWRPRFKYYHWALSFLGMSLCLALMFISSWYYALVAMLIAGCIYKYIEYRGAEKEWGDGIRGISLNAARYALIRLEEAPPHTKNWRPQLLVLLNLDSELRVKHPRLLSFTTQLKAGKGLTIVGSVLEGTYLTKD--SEAKKAEQNIKTAMATERTKGFCHVVVSSNLRDGISHLIQSAGLGGMKHNSVLMAWPGSWKQSNDPLSWKN-FIETVRETTAAHLALLVAKNVDSFPHQERLGEGTIDVWWIVHDGGMLMLLPFLLRQHKVWRKCKMRIFTVAQMDDNSIQMKKDLQMFLYHLRLDAEVEVVEMHESD-ISAFTYEKTLVMEQRSQMLKQMQLSRTEREREIQSITDESRSSIRRKNQTGAQCSGSSNQGAPLEDEKDNEAQLIHDKNTASHAALNDKADATPDRVHMTWTKEKLFTERNRNREPNTNMGVRDLFNMK---PEWESLNQSN--VRRMHTAVKLNEVVVNKSQGAQLVLLNMPGPPKNRGGDENYMEFLEVLLEGLNRVLLVRGGGREVITIYS 1096          
BLAST of slc12a-1 vs. Ensembl Cavefish
Match: slc12a7b (solute carrier family 12 member 7-like [Source:NCBI gene;Acc:103031657])

HSP 1 Score: 860.522 bits (2222), Expect = 0.000e+0
Identity = 468/1089 (42.98%), Postives = 669/1089 (61.43%), Query Frame = 2
Query:  260 KVSSGLTDNVEEGHESDDDVKDETMALYQEDY-------SIMNSISGY------LRAMTYQTSVAGQKK----NPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEM--VCFLGERLL--------TKSFWTINKTLSCNKTMLEDYYCNG-NLTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGE-VMPGVKGLGGRDVTRD---------MMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEEE-THTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSIS--CKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRK-------------------ASLKDFHVDQSKLVDTHQFTFSPATLAQMKDV---------LEMKTTTKKSK--------------KLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            K SS   +N +    +  D K+  MAL++E+        S+++ ++ Y      +R         G KK    +P++   IGVYLP LQ+I GVI+FLR+ WI+G +G L+ F +V +CC CT LT+ISMSAIATNG V +GGSY+MISR+LGP+FG A+G+ FYLG   A AMY++GTIEILLTY+ P+   F+++  +   +  AM NN R Y +  L L+ ++V +GVK+V   A + LACV++SI+ +Y  G +++     +  VC LG R L         K+    N T++   T L   +C+   L + C++YF  N V  +P +PG  SGVI  N+W  Y   G  V   +  +   + TRD         + T F +L+ IYFPSVTGIM GSN SGDL+D Q+ IP  TI A  TT+ +YLS V +F       VL DK+G S+ G +++  L WP  WV++IGS  S  GAGLQ L  APRLL AIA+D ++PFL+VF      GEP   LLL+    E  +L+ ++D +AP++ +FFLM Y FVNLACALQ +L  PNWRPRF+YYHW LS +G +L + ++F + WYY LV + +   IYKY+EYRGAEKEWGDGIRG+ L  A+Y+L+ +EE   HTKNWRPQ+L+L   +S+L +K+P+L+SF  QLK G+GL I+ S++EG Y  KD   +A+K ++N+K  M T + KGF   +V S++++GIS LIQS GLG +K N+V++ WP +WK  +D  S ++ F++ +    +A + +L+ K V  +P      +GTID+WWI+ DGG+LM+LP LL++H+VW +C++R+FTVA   DNSI MK  L  +LY LR+ A VEVVE+  SD ISA+ ++KTLVME+R ++++QM+L+  E + E Q+  D  R                    A L+D   ++   +   + T S A L    D           + K  T++++               + P     ++MH AV+LN ++  KS  A LV+LN+PGPPKN+   E Y+ +L VL EGL RVLLVRG G+EVITIYS
Sbjct:   69 KESSPFINNTDNDRGTLYDGKN--MALFEEEMDSNPMVSSLLSKLANYTNLTQGVREHEEADEEEGAKKQTVKSPQMGTFIGVYLPCLQNILGVILFLRMTWIVGTAGILEAFIIVAMCCSCTMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGTIEILLTYIVPSAAIFKAEDKAYEAE--AMLNNMRVYGTCCLTLMALVVFVGVKYVNKLALVFLACVVLSILAIY-AGVIKTIFEPPVFPVCLLGNRTLKNHGFDKCAKTDIIGNVTVT---TKLWSLFCDSPELNSTCNEYFTLNNVTEIPGIPGLTSGVISENMWSSYGPAGMLVEKAIDAMEASETTRDVNLPYVVNDIATFFTLLVGIYFPSVTGIMAGSNRSGDLRDAQRSIPIGTILAIATTTIIYLSCVVLFGACIDGVVLRDKFGDSVRGNLVIGTLSWPSPWVIVIGSFFSCCGAGLQSLTGAPRLLQAIARDGIVPFLEVFGHGKANGEPTWALLLTAGICETGILIASLDAVAPILSMFFLMCYLFVNLACALQTLLRTPNWRPRFKYYHWALSFLGMSLCLALMFISSWYYALVAMLIAGCIYKYIEYRGAEKEWGDGIRGISLNAARYALIRLEEAPPHTKNWRPQLLVLLNLDSELRVKHPRLLSFTTQLKAGKGLTIVGSVLEGTYLTKD--SEAKKAEQNIKTAMATERTKGFCHVVVSSNLRDGISHLIQSAGLGGMKHNSVLMAWPGSWKQSNDPLSWKN-FIETVRETTAAHLALLVAKNVDSFPHQERLGEGTIDVWWIVHDGGMLMLLPFLLRQHKVWRKCKMRIFTVAQMDDNSIQMKKDLQMFLYHLRLDAEVEVVEMHESD-ISAFTYEKTLVMEQRSQMLKQMQLSRTEREREIQSITDESRSSIRRKNQTGAQCSGSSNQGAPLEDEKDNEVAQLIHDKNTASHAALNDKADATPDRVHMTWTKEKLFTERNRNREPNTNMGVRDLFNMKPNQSNVRRMHTAVKLNEVVVNKSQGAQLVLLNMPGPPKNRGGDENYMEFLEVLLEGLNRVLLVRGGGREVITIYS 1145          
BLAST of slc12a-1 vs. Ensembl Cavefish
Match: slc12a7b (solute carrier family 12 member 7-like [Source:NCBI gene;Acc:103031657])

HSP 1 Score: 858.596 bits (2217), Expect = 0.000e+0
Identity = 471/1099 (42.86%), Postives = 667/1099 (60.69%), Query Frame = 2
Query:  260 KVSSGLTDNVEEGHESDDDVKDETMALYQEDY-------SIMNSISGY------LRAMTYQTSVAGQKK----NPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEM--VCFLGERLL--------TKSFWTINKTLSCNKTMLEDYYCNG-NLTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGE-VMPGVKGLGGRDVTRD---------MMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEEE-THTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSIS--CKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRKA----------------------SLKDFHVDQ------------------------------SKLVDTHQFTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            K SS   +N +    +  D K+  MAL++E+        S+++ ++ Y      +R         G KK    +P++   IGVYLP LQ+I GVI+FLR+ WI+G +G L+ F +V +CC CT LT+ISMSAIATNG V +GGSY+MISR+LGP+FG A+G+ FYLG   A AMY++GTIEILLTY+ P+   F+++  +   +  AM NN R Y +  L L+ ++V +GVK+V   A + LACV++SI+ +Y  G +++     +  VC LG R L         K+    N T++   T L   +C+   L + C++YF  N V  +P +PG  SGVI  N+W  Y   G  V   +  +   + TRD         + T F +L+ IYFPSVTGIM GSN SGDL+D Q+ IP  TI A  TT+ +YLS V +F       VL DK+G S+ G +++  L WP  WV++IGS  S  GAGLQ L  APRLL AIA+D ++PFL+VF      GEP   LLL+    E  +L+ ++D +AP++ +FFLM Y FVNLACALQ +L  PNWRPRF+YYHW LS +G +L + ++F + WYY LV + +   IYKY+EYRGAEKEWGDGIRG+ L  A+Y+L+ +EE   HTKNWRPQ+L+L   +S+L +K+P+L+SF  QLK G+GL I+ S++EG Y  KD   +A+K ++N+K  M T + KGF   +V S++++GIS LIQS GLG +K N+V++ WP +WK  +D  S ++ F++ +    +A + +L+ K V  +P      +GTID+WWI+ DGG+LM+LP LL++H+VW +C++R+FTVA   DNSI MK  L  +LY LR+ A VEVVE+  SD ISA+ ++KTLVME+R ++++QM+L+  E + E Q+  D  R +                        KD  V Q                               KL         P T   ++D+  MK    + + LN  N   ++MH AV+LN ++  KS  A LV+LN+PGPPKN+   E Y+ +L VL EGL RVLLVRG G+EVITIYS
Sbjct:   69 KESSPFINNTDNDRGTLYDGKN--MALFEEEMDSNPMVSSLLSKLANYTNLTQGVREHEEADEEEGAKKQTVKSPQMGTFIGVYLPCLQNILGVILFLRMTWIVGTAGILEAFIIVAMCCSCTMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGTIEILLTYIVPSAAIFKAEDKAYEAE--AMLNNMRVYGTCCLTLMALVVFVGVKYVNKLALVFLACVVLSILAIY-AGVIKTIFEPPVFPVCLLGNRTLKNHGFDKCAKTDIIGNVTVT---TKLWSLFCDSPELNSTCNEYFTLNNVTEIPGIPGLTSGVISENMWSSYGPAGMLVEKAIDAMEASETTRDVNLPYVVNDIATFFTLLVGIYFPSVTGIMAGSNRSGDLRDAQRSIPIGTILAIATTTIIYLSCVVLFGACIDGVVLRDKFGDSVRGNLVIGTLSWPSPWVIVIGSFFSCCGAGLQSLTGAPRLLQAIARDGIVPFLEVFGHGKANGEPTWALLLTAGICETGILIASLDAVAPILSMFFLMCYLFVNLACALQTLLRTPNWRPRFKYYHWALSFLGMSLCLALMFISSWYYALVAMLIAGCIYKYIEYRGAEKEWGDGIRGISLNAARYALIRLEEAPPHTKNWRPQLLVLLNLDSELRVKHPRLLSFTTQLKAGKGLTIVGSVLEGTYLTKD--SEAKKAEQNIKTAMATERTKGFCHVVVSSNLRDGISHLIQSAGLGGMKHNSVLMAWPGSWKQSNDPLSWKN-FIETVRETTAAHLALLVAKNVDSFPHQERLGEGTIDVWWIVHDGGMLMLLPFLLRQHKVWRKCKMRIFTVAQMDDNSIQMKKDLQMFLYHLRLDAEVEVVEMHESD-ISAFTYEKTLVMEQRSQMLKQMQLSRTEREREIQSITDESRSSIRRKNQTGAQCSGSSNQGAPLEDEKDNEVAQLIHDKNTASHAALNDKADATPDRVHMTWTKEKLFTERNRNREPNTNMGVRDLFNMK---PEWESLNQSN--VRRMHTAVKLNEVVVNKSQGAQLVLLNMPGPPKNRGGDENYMEFLEVLLEGLNRVLLVRGGGREVITIYS 1150          
BLAST of slc12a-1 vs. Ensembl Sea Lamprey
Match: slc12a4 (solute carrier family 12 member 4 [Source:ZFIN;Acc:ZDB-GENE-090218-27])

HSP 1 Score: 709.909 bits (1831), Expect = 0.000e+0
Identity = 391/842 (46.44%), Postives = 550/842 (65.32%), Query Frame = 2
Query:  431 PKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGF--VRSPERSEMVCFLGERLLT-KSFWTINK-TLSCNKTM----LEDYYCNGN-LTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVM--PGVKGLGGRD--------VTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPF-LKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSIS---CKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLE 2884
            P++   +GVYLP LQ+IFGVI+FLRL W++G +G L+ F +VF+CC CT LT+ISMSAIATNG V +GGSYFMISR+LGP+FG A+G+ FYLG   A +MY++G IEILLTY+ P+   F+++ G S  D  AM NN R Y +  L  + V+V +GVK+V  FA + LACVI+SI+ +Y G      SP     +C LG R L+ K F    K TL  N T+    L   +C+   L   CD+YF  N V  +P +PG +SG I  N+W  Y  +G++    GV+ LGG +        V  D+ T+F  L+ I+FPSVTGIM GSN SGDLKD QK IP  TI A  TTS VYL+ V +F       VL DK+       +++ +  W   ++ ++ +    F  G   L S PR+  +I    + PF ++VF      GEP   LLL+   AE  +L+ ++D++AP++ +FFLM Y FVNLACA+Q +L  PNWRPRF+YYHW LS +G ++ + ++F + WYY +V + +   IYKY+EYRGAEKEWGDGIRGL L+ A+Y+LL +EE   HTKNWRPQ+L+L K    + ++ P+L+SFA QLK G+GL I+ S++ GD+       +A +  +++K  + T KVKGF Q +V   V++GIS LIQS GLG +KPNTV++GWP+ W+   D  S +  F+D +    +A   +L+ K VS +P+ S    +GTID+WWI+ DGG+LM+LP LL++H+VW +C++R+FTVA   DNSI MK  L  +LY LRI A VEVVE+ +SD ISAY +++TL+ME+R ++++QM+L+  E + E
Sbjct:    1 PRMGTFMGVYLPCLQNIFGVILFLRLTWVVGTAGVLEAFCIVFVCCCCTMLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGLCFYLGTTFAASMYILGAIEILLTYIVPSAAIFRAEDGGS--DAAAMLNNMRMYGTAFLAFMAVVVFVGVKYVNKFAMLFLACVILSILAIYAGAVKTAWSPPHFP-ICMLGNRTLSGKDFDVCAKTTLQENDTLVATKLWSLFCDSTFLNASCDEYFDLNNVTEVPGIPGMSSGAILENVWSSYSGKGDLAEKAGVEALGGGEYPSRSLPYVFADIATSFTALVGIFFPSVTGIMAGSNRSGDLKDAQKSIPIGTIMAIATTSTVYLTSVILFGACVEGVVLRDKHSNPNRNLLLINDFTWVSNFLAVVFTHFDAFQFGTLEL-SEPRVSCSIPNVILFPFPIQVFGHGKANGEPTWALLLTAGIAELGILIASLDMVAPILSMFFLMCYMFVNLACAVQTLLRTPNWRPRFKYYHWALSFLGMSICLALMFISSWYYAIVAMVIAGMIYKYIEYRGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQVLVLLKLGEGMEVRAPRLLSFASQLKAGKGLTIVGSVLHGDFLSSCAEAQAAEPHQSIKRLVETEKVKGFYQVVVSPRVRDGISHLIQSCGLGGMKPNTVVMGWPYGWRQSEDPRSWK-TFIDTVRATTAAHRALLVAKNVSLFPANSERFAEGTIDVWWIVHDGGMLMLLPFLLRQHKVWRKCKMRIFTVAQLEDNSIQMKKDLAMFLYHLRIDAEVEVVEMHDSD-ISAYTYERTLMMEQRCQMLKQMRLSKWERERE 836          
BLAST of slc12a-1 vs. Ensembl Sea Lamprey
Match: slc12a4 (solute carrier family 12 member 4 [Source:ZFIN;Acc:ZDB-GENE-090218-27])

HSP 1 Score: 699.893 bits (1805), Expect = 0.000e+0
Identity = 390/842 (46.32%), Postives = 546/842 (64.85%), Query Frame = 2
Query:  431 PKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGF--VRSPERSEMVCFLGERLLT-KSFWTINK-TLSCNKTM----LEDYYCNGN-LTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVM--PGVKGLGGRD--------VTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPF-LKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSIS---CKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLE 2884
            P++   +GVYLP LQ+IFGVI+FLRL W++G +G L+ F +VF+CC CT LT+ISMSAIATNG V +GGSYFMISR+LGP+FG A+G+ FYLG   A +MY++G IEILLTY+ P+   F+++ G S  D  AM NN R Y +  L  + V+V +GVK+V  FA + LACVI+SI+ +Y G      SP     +C LG R L+ K F    K TL  N T+    L   +C+   L   CD+YF  N V  +P +PG +SG I  N+W  Y  +G++    GV+ LGG +        V  D+ T+F  L+ I+FPSVTGIM GSN SGDLKD QK IP  TI A  TTS + L+ V +F       VL DK+         + +  W   ++ ++ +    F  G   L S PR+  +I    + PF ++VF      GEP   LLL+   AE  +L+ ++D++AP++ +FFLM Y FVNLACA+Q +L  PNWRPRF+YYHW LS +G ++ + ++F + WYY +V + +   IYKY+EYRGAEKEWGDGIRGL L+ A+Y+LL +EE   HTKNWRPQ+L+L K    + ++ P+L+SFA QLK G+GL I+ S++ GD+       +A    E++K  + T KVKGF Q +V   V++GIS LIQS GLG +KPNTV++GWP+ W+   D  S +  F+D +    +A   +L+ K VS +P+ S    +GTID+WWI+ DGG+LM+LP LL++H+VW +C++R+FTVA   DNSI MK  L  +LY LRI A VEVVE+ +SD ISAY +++TL+ME+R ++++QM+L+  E + E
Sbjct:    2 PRMGTFMGVYLPCLQNIFGVILFLRLTWVVGTAGVLEAFCIVFVCCCCTMLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGLCFYLGTTFAASMYILGAIEILLTYIVPSAAIFRAEDGGS--DAAAMLNNMRMYGTAFLAFMAVVVFVGVKYVNKFAMLFLACVILSILAIYAGAVKTAWSPPHFP-ICMLGNRTLSGKDFDVCAKTTLQENDTLVATKLWSLFCDSTFLNASCDEYFDLNNVTEVPGIPGMSSGAILENVWSSYSGKGDLAEKAGVEALGGGEYPSRSLPYVFADIATSFTALVGIFFPSVTGIMAGSNRSGDLKDAQKSIPIGTIMAIATTSRINLTSVILFGACVEGVVLRDKFSCRFCLHSKINDFTWVSNFLAVVFTHFDAFQFGTLEL-SEPRVSCSIPNVILFPFPIQVFGHGKANGEPTWALLLTAGIAELGILIASLDMVAPILSMFFLMCYMFVNLACAVQTLLRTPNWRPRFKYYHWALSFLGMSICLALMFISSWYYAIVAMVIAGMIYKYIEYRGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQVLVLLKLGEGMEVRAPRLLSFASQLKAGKGLTIVGSVLHGDFLSSCAEAQA---AESIKRLVETEKVKGFYQVVVSPRVRDGISHLIQSCGLGGMKPNTVVMGWPYGWRQSEDPRSWK-TFIDTVRATTAAHRALLVAKNVSLFPANSERFAEGTIDVWWIVHDGGMLMLLPFLLRQHKVWRKCKMRIFTVAQLEDNSIQMKKDLAMFLYHLRIDAEVEVVEMHDSD-ISAYTYERTLMMEQRCQMLKQMRLSKWERERE 834          
BLAST of slc12a-1 vs. Ensembl Sea Lamprey
Match: slc12a9 (solute carrier family 12 member 9 [Source:NCBI gene;Acc:793341])

HSP 1 Score: 280.411 bits (716), Expect = 4.589e-80
Identity = 242/844 (28.67%), Postives = 377/844 (44.67%), Query Frame = 2
Query:  434 KLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEMVCFLGERLLTKSFWTINKTLSCNKTMLEDYYCNGNLTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVMPGVKGLGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKY----GVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIP-FLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGA-KYSLLNIEEETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGW------------------PHTWKGISDE--------------ESPEHEFLDAIHRVVSAEICMLIPKGVSEY----------------PSISCKGTIDIW---WIMQDGG--------LLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVE 2770
            KLN   GV +PTL  +F V+++LR+ +++G +G L+   M  +  +   LT +S+ AI+TNG V+ GG YFMISR LGP+FG +IG++F+L N  ++A++L+G  E ++         F+ +P   H    A +     YAS LL +  V+V +G       A I   CVI+ ++ V++                       SF+ +      N+ ++  +   GN+T   +               G + G +  NL   Y               +D T  +   F  + AI F   TGIM GSNMSGDLKDP   IPR TIAA + T  VY+    + + +  R++LL  Y     +++ G  +             IG   ++  A + CL  A R+LHA+A DD+    LKV    +R G P+  +L+S+F  +  L  G ++ IA +V +FFL+ YA V+LAC      +APN+RP F+++ W   L+G    + ++F     Y   ++A+ L +  ++ YR     WG   + L      KY LL    + H K WRPQIL++       C     LI F   +K G GL IL  +  GD  D    D  +         +    VK FV   +   V++G+  L++  GLG +KPNT+ +G+                  PH      D+              ESP+   +     VVS  I M     +S Y                PS+S    ID+W    +  D           L+ +  +L     W   ++R+F +  +S  S   ++ L + L  LRIKA++  V 
Sbjct:   28 KLNTFFGVVVPTLLSMFSVVLYLRIGFVVGQAGLLESLLMFVVAYVIIGLTVLSVCAISTNGAVQGGGVYFMISRALGPEFGGSIGVMFFLANVCSSAVFLLGLTEAIMD-------SFRKRPDFPHGLPDA-YIWVVLYASCLLLICLVVVLVGADIYSKAAFIIFLCVILVLLTVFI-----------------------SFFAVR-----NRHIVIKH---GNITMNLN-------------YSGPSLGTLHDNLKEHYT--------------QDYTTGVTMTFASVFAIMFNGCTGIMAGSNMSGDLKDPSYAIPRGTIAAVVFTFCVYVLLCFMVSCSCPRDLLLYNYVFMRDINVWGPFVT------------IGIYAASLSAAMSCLIGASRVLHAVALDDIFGVLLKVVKRTSRSGNPWVAVLVSWFLVQLVLFAGQLNTIAGIVTVFFLIAYATVDLACLAMEWASAPNFRPTFQFFSWHTCLLGMVGCLIMMFIISPIYASASIAVMLLLLVFIHYRSPSSSWGYISQALIFHQVRKYLLLLDIRKDHVKFWRPQILLMVANPRSSC----HLIHFVNDIKKG-GLYILGHVEVGDL-DSIPYDPLESQVNYWLSLVDKLNVKAFVDITLSPTVRQGVQNLLRIAGLGGMKPNTLFLGFYDDCVPDDYFLSEPAFAAPHGPSCERDDPDHFGAHFPPVHALESPKALSVREYVAVVSDAIKMKKNVCLSRYFHELDMALVRGKRRGAPSVS----IDVWPLNLLRPDSAYYVDVCSLFLLQMACILNMVSSWRHAKLRIF-LCVESSLSGDKEEKLRELLSQLRIKASIHTVH 782          
BLAST of slc12a-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000732.1 (pep scaffold:Pmarinus_7.0:GL479336:3629:33813:1 gene:ENSPMAG00000000665.1 transcript:ENSPMAT00000000732.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 192.971 bits (489), Expect = 2.331e-52
Identity = 149/627 (23.76%), Postives = 272/627 (43.38%), Query Frame = 2
Query: 1565 GSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFS-PITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEEETHTKNWRPQILILCKTNSDLCI-------KYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPE--------------------HEFLDAIHRV---------------VSAEICMLIPK---------GVSEYPSISCKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVF---TVATQSDNSILMKDSLVKWLYDLR-IKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRKASLKDFHVDQSKLVDTHQFTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            G   +T  + L  L SAP++  A+ KD++ P +++F+    +  EP R  +L++  A   +L+  +++IAP++  FFL  YA +N +C   ++  +P WRP F+YY+ ++SL GAAL   ++F   W+  LVT  +  ++Y YV Y+  +  WG   +      A    +N+ +             +C      C+         P L+ F        GL++ + +         V   A   K++  + ++  + K F   +   D++ G    +Q+ GLG +KPNT+++G+   W+    ++  E                    HE LD  H V               +++  C  + +           +++ S   KGTID+WW+  DGGL +++P LL   + W  C++RVF    +     +  +M   L K+  D   I+   ++   P+ D++ A+           E++IE  +L  +++D E   ++       + D                    L + +D                      K +  + +N L+++ S  A+L++++LP   K   S   Y+ +L VLS+ LP  LLVRG  + V+T YS
Sbjct:   17 GIFAATLSSALASLVSAPKVFQALCKDNIYPKMQMFAVGYGKNNEPIRGYILTFIIAIAFILIAELNVIAPIISNFFLASYALINFSCFHASLAKSPGWRPAFKYYNMWVSLFGAALCCGVMFVINWWAALVTYVIIFSLYIYVTYQKPDVNWGSSTQRALHGRAVNLCVNVTKLVKD---------VCACVGRQCLVLTGPPESRPALVDFVHAFTKNVGLMVCSHVC--------VELTANASKQH--QYLLRQRRKAFYSAVCADDLRGGTLHFLQAAGLGRMKPNTLVIGFKKNWRRAESKDVDEYINIIHDAFDFQYGVLVFRLHEGLDVSHIVQIQVLPKFNEDASHKINSSCCRAVFQTNFDQKLLDASAQFNSRQGKGTIDVWWLFDDGGLTLLVPYLLTTKKTWRDCKIRVFIGGKINRIDHDKRVMATLLSKFRIDFSDIEVLGDMNTKPDKDSVKAF-----------EEMIEPYRLHEEDLDAEEAEKLRQENPCKISD------------------DELERFRD----------------------KTYRQIRMNELLQQHSRRANLIVMSLPVARKGAVSSTLYMAWLEVLSKNLPPTLLVRGNHQSVLTFYS 573          
BLAST of slc12a-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003053.1 (pep scaffold:Pmarinus_7.0:GL478333:5880:33924:-1 gene:ENSPMAG00000002656.1 transcript:ENSPMAT00000003053.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 151.369 bits (381), Expect = 2.017e-37
Identity = 121/470 (25.74%), Postives = 202/470 (42.98%), Query Frame = 2
Query: 1289 TNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRRE---VLLDKYG-VSMGGGMIVAELCWP-----------------------------HRWVLLI--GSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSP-ITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRY---------------YHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEEET-HTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLK----ECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESP--EHEFLDAIHRVVSAEICMLI 2524
            T FF L  ++FP+VTGI+ G+N+ GDLKDP   IP+ T+ A LTT+  YL           R+   +L D +  V  G   +  EL W                                W  LI  G   +   + L  L SAP+    +A+D++ P + +F     R  EP    LL+Y  + C +++  +++IAP++  FF++ Y  +N +C   + +  P      +                +   LS+    L   +I   Y         L  +++       A+  WG  ++ +    A Y+ L ++ E  H KN+RP  L+L    +      P L+ F G      GL++  +++ G         K +KVKE L+    E +   KV  F    V +++++G   L+QS G+G L PN +++G+ + W+    EE P   H ++  IH V    + + I
Sbjct:  301 TEFFRLFGVFFPAVTGILAGANICGDLKDPASAIPKGTLLAILTTALSYLIINTTIGAVMLRDASGLLSDSFAWVCNGSSKLACELGWNFTACSLFRPDTTSPCTFGFVNNYQVMAMVSAWAPLIYAGIFGAALSSALANLISAPKCFQGVARDNIYPGISIFGKGFGRNQEPLFGYLLAYLISICFIIIAELNIIAPIISCFFIISYTILNFSCFHASFIKTPGETELMQMPIDVEGMQLAAQRLPHSMSLSMSSVELQCVVITGEYQ-------QLLWSLF-------ADVNWGSSMQAMSFNTALYTNLTLDRELYHVKNYRPNCLVLTGPPN----LRPALVDFVGTFTKDIGLMVCGNILVGP--------KGEKVKELLESKHNEWLHRRKVNAFYTGFVATNMQDGAFGLLQSTGIGKLCPNILIMGFKNMWQ----EEEPINMHHYIQIIHDVFDLNMSLGI 740          

HSP 2 Score: 87.0409 bits (214), Expect = 1.679e-17
Identity = 42/102 (41.18%), Postives = 65/102 (63.73%), Query Frame = 2
Query:  452 GVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEIL 757
            GV +  + +I+GV+M+LRL WI   +G    + +V +  + T ++ +S+SAI+ NGKV  GG+YFM+SR LG + G+  GIL+    A+  AM+ VG  E L
Sbjct:  106 GVMMRVIVNIWGVLMYLRLPWITAQAGIGLTWVIVLVAVIITSISGLSISAISNNGKVARGGTYFMVSRTLGYELGAPFGILYSFAAAVGIAMHTVGFAETL 207          

HSP 3 Score: 54.299 bits (129), Expect = 1.577e-7
Identity = 59/237 (24.89%), Postives = 107/237 (45.15%), Query Frame = 2
Query: 2561 KGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRKASLKDFHVDQSKLVDTHQFTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITI 3271
            K TIDI+W+  DGGL ++LP LL + + W  C++RVF +  + D     K ++ + +   R+    +V+ L + +        +T  +++ E +I   +L       + +A ++ LR+        D    V  H+             +L ++  T +  KLN                 L+ + S +A L++++LP   K +      + +L VLS  LP VL++RG    V+TI
Sbjct:  845 KRTIDIYWLFDDGGLTLLLPYLLSKKKRWRHCKIRVF-MGGKLDRLEEDKQNMTRLITRFRLDVD-DVIILTDINK-----KPRTEKIKQFEDMISPFRLND---GFKEEAEVEELRR--------DCPWKVSDHE-------------LLSLRDKTNRQLKLNE----------------LMIQNSNDAALIVVSLPMIKKGRCPSALGMAWLEVLSRDLPPVLIMRGNHVNVLTI 1034          
BLAST of slc12a-1 vs. Ensembl Yeast
Match: VHC1 (Vacuolar membrane cation-chloride cotransporter (CCC); likely mediates K+ and Cl- cotransport into the vacuole; has a role in potassium homeostasis and salt tolerance; localizes to sites of contact between the vacuole and mitochondria (vCLAMPs); similar to mammalian electroneutral Na(+)-(K+)-C1- cotransporter family [Source:SGD;Acc:S000000439])

HSP 1 Score: 232.646 bits (592), Expect = 3.805e-63
Identity = 191/693 (27.56%), Postives = 314/693 (45.31%), Query Frame = 2
Query:  398 YQTSVAGQK-------KNP---KLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDD--HTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEMVCFLGERLLTKSFWTINKTLSCNKTMLEDYYCNGNLTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVMPGVKGLGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEEETHTKNWRPQILILCKTNSDLCIKYPK----LISFAGQLKGGRGLVILASL-VEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGW 2425
            YQ +   QK        NP   KL    GV++PT  ++  ++MFLR  +I+G  G +    ++ +      LT++S+SAI+TNG V+ GG+Y+MISR+LGP+FG +IG++F+LG      M  VG IE LL  +  +    Q +P ++  +      ++ F TYA+ +LFL F +  +G + V     I    +  SI  + L   +RSP     + + G        W                       TF D+         LP +   A+G +                    L G++   D       L  ++FP+  GI  G+ MS +L+ P K IP+ T+   L T   Y   V     +  R  L D+        + + +     +WV+ +G + ++  + +  +  A  +L AIAKD++IP L++F+       P   L+ ++   +  L   +V+ IA  + + FLM +  +NLAC L  I +APN+RP F+Y++ + + +GA LS+  +         V     + ++ ++ Y    K WGD  + L     +  LL + ++ + K WRPQIL        L +  P+    LI F   LK G GL IL  + V  D+  +    K Q  ++   +      +K FVQ      +  GI  +    GLG +KPN  +VG+
Sbjct:   40 YQATPECQKVSSKYDPDNPNKDKLGTYDGVFVPTALNVLSILMFLRFGFILGQLGIICTIGLLLLSYTINLLTTLSISAISTNGTVRGGGAYYMISRSLGPEFGGSIGLVFFLGQVFNAGMNAVGIIEPLLYNLGYSA---QGEPPAALGELLPRGHWHEF-TYATVILFLCFSVAFVGSQTVSRAGNILFLVLAASIFSIPLSALIRSPFTEGGISYTGPS------WQ----------------------TFHDNL--------LPHLTKGAAGSL--------------------LKGKETFND-------LFGVFFPATAGIFAGAGMSSELRKPSKSIPKGTLWGLLFTFICYAVVVFSMGCSIPRRSLYDE--------VQIIQTISSVQWVIFMGEMATSLFSIIVGMLGAAYVLEAIAKDNIIPGLEIFA-----HSPLYSLIFTWILTQLCLF-SDVNKIATFITMTFLMTFVVMNLACFLLGISSAPNFRPSFKYFNRYTTAIGALLSVVAMLIVDGISASVLFLAMILLFLFIHYFSPPKSWGDVSQSLIYHQVRKYLLRLRQD-NIKYWRPQIL--------LFVDNPRTSWNLIRFCNHLKKG-GLYILGHVAVTADFPKQLNELKTQ--QKAWMKIRDMAAIKAFVQVGTGPSLIWGIRNVFIGSGLGGMKPNITVVGF 639          
BLAST of slc12a-1 vs. Ensembl Nematostella
Match: EDO35443 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLI2])

HSP 1 Score: 771.155 bits (1990), Expect = 0.000e+0
Identity = 425/991 (42.89%), Postives = 607/991 (61.25%), Query Frame = 2
Query:  437 LNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAP-------TLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEMVCFLGERLLTKSFWTINKTLSCNKTMLEDYYCNGNLTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVMPGVK-GLGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFL--------KVFSPITRFGEPFRCLLLSYFFAECALLLG--NVDLIAPLVDI---FFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPS--ISCKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARI----------------DHLRKASLKDFHVD-QSKLVDTHQFTFSPATLAQMKDVLEMKTTTKKSKKLN---PENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            +  I+GVYLPT+Q+IFGVI+F+R+ WI+G +G  Q FF+VFICC CT LT+ISMSA+ATNG V +GGSYFMISR LGP+FG A+G+LFYLG   A++MY++G IEIL+            +LP   S+P +S   +               FLVF      VKF +                               VC LG+ +L KS +   +T S N +ML   Y +  +      ++ +  ++Y+  +PG  SGV   N    Y+ + E+  GV  G    ++  D  T+FF+LLAI+FPSVTGIM GSN SGDLKD Q  IP+ TIAA  TTSFVYL+ V +F  T + E+L DK+G S+GG ++VA + WP +WV+LIGSL ST GAG+Q L  AP LL AIAKD++IPFL        ++F+  +        LL + F     ++LG   +D   P   +   FFLM Y FVNLACA+Q++L  PNWRPRF+YYHWF S +G  L + ++F + WYY LV + +  A+YKY+E++GA+KEWGDGIRGL L+ A++SLL +EE   HTKNWRPQILILCK +  L  +  +L+S A QLK G+GL I+ S++EG+Y  +++       KENLK CM   KVKGF++ +   +VK+GIS LIQ  GLG L PNTV++ +P  W+    E      F++    V   E  +L+P+ +  +P      +G++D+WWI+ DGG+++++  LL++H+VW+RC++R+FTVA   DNSI MK  L  ++Y LRI+A V+V+E+ ++D IS Y +++TLVME+R ++++QM L+ KE   E QA +                +  R +S+ D      SK+V       +P T+ +  D  E  +  K S   +   P+ +  ++M+ AV+LN ++KEKS  A LV++NLP PP +    + Y+++L VL+EGL RVL+VRG G+EVITIYS
Sbjct:    1 MGTIMGVYLPTIQNIFGVILFIRMSWIVGIAGVTQAFFIVFICCCCTMLTAISMSAVATNGVVPAGGSYFMISRALGPEFGGAVGLLFYLGTTFASSMYILGAIEILVILFEELELFSFFSLPYLISRPVASSFSY---------------FLVFT-----VKFSE-------------------------------VCILGDAILAKSSY---ETCSYNDSMLRTAYGSDPV------FWNSTRLRYVKGVPGITSGVFTENAKSHYLKKNEIKMGVAAGSNEGEIRSDTTTSFFILLAIFFPSVTGIMAGSNRSGDLKDAQNSIPKGTIAAIATTSFVYLTSVLLFGATIQGELLRDKFGRSIGGVLVVANIAWPTKWVILIGSLLSTIGAGMQSLTGAPCLLQAIAKDNIIPFLDLSTGTLSQLFTQKSAALAKINLLLKTCF----VMVLGYLPLDFCVPGFSLCYGFFLMCYGFVNLACAVQSLLRTPNWRPRFKYYHWFTSFLGVCLCLALMFISSWYYALVAMIIAAAVYKYIEFQGAKKEWGDGIRGLALSAARFSLLRLEEGPPHTKNWRPQILILCKLDESLQPQSRRLLSLASQLKHGKGLSIVGSVLEGEY--QNLVTDITSAKENLKVCMKEEKVKGFMKIVTSENVKQGISFLIQGSGLGGLDPNTVLLAFPENWR----ERELWMSFVETTQTVSLGEQALLVPRHIDAFPDNHERLQGSVDVWWIVHDGGMMILILFLLRQHKVWKRCKLRIFTVAQLEDNSIQMKKDLETFMYHLRIEAEVQVIEMVDND-ISEYTYERTLVMEQRNQMLKQMHLSRKESKREIQAVVVNSYRSRSHSSASQAAEGSRTSSMLDASSSGGSKVVRRPSEGEAPETIIEEPDA-EKDSEGKASPTSSLTAPQEQNVRRMNTAVKLNDIVKEKSKEAQLVVINLPAPPTSMDEWQNYMDFLDVLTEGLDRVLMVRGGGREVITIYS 919          
BLAST of slc12a-1 vs. Ensembl Nematostella
Match: EDO49361 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG55])

HSP 1 Score: 336.65 bits (862), Expect = 1.093e-99
Identity = 246/864 (28.47%), Postives = 417/864 (48.26%), Query Frame = 2
Query:  398 YQTSVAGQKKNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVI-VAL-GVKFVQLFAPITLACVIISIVCVYLGGFVRSPER--SEMVCFLGERLLTKSFWTINKTLSCNKTMLEDYYCNGNLTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVMPGVKGLGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAEL-----CWPHR-----------------W--VLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFG-EPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWG-DGIRGLKLAGAKYSLLNIEEETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDY---ADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWK--GISDEE--------SPEHEFLDAIHRV-----------VSAEIC----MLIPKGVSE---YPSISC------KGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKD-SLVKWLYDLRIKATVEVVELPNSD 2785
            + T     +  PK   I GV+   L +I+GV+++LRL W++G +G      ++ +  + T +T++SMSAI TNG+VK GG+Y++ISR+LGP+FG +IGI+F + +A+A AMY+VG  E        T+     + G+   D     N+ R    GL+ +VF++ VAL G+K+V     I LA +IISI+ V +G F+  P+   S+   FLG                                                    Y  GV ++N  P +  EG                     FF + AI+FP+ TGI+ G N+SGDLK+P   +P+ T+ A L +S VY+    +   T  R+       V++  G   + +     C   +                 W  ++  G   ST  + +  +  AP+   A+ KD + P +  F      G EP R  +L++  A     +G+++ IAP++  FFL++YA +N A  + ++  +P WRP FR+Y+ ++SL+GA L + I+F   W+  LVT+ + + +YK+V+YR     WG  G     ++  +++ L    E H KN+RPQ L+L    ++     P L+  A QL    GL++  ++    +   +D + R+ A+ +KE+        K+K F  T     ++ G+  ++   GLG +KPNT+++G+ + W+   ++D E        + + +F  AI R+           ++  IC       P+ V+E    P          +GTID+WW+  DGGL ++LP LL  HR+W  C++R+F +  +S ++I      +   +   RI+ +  VV++P ++
Sbjct:   59 FLTPTTNLRDAPKFGWIKGVFFGCLLNIWGVMLYLRLSWVVGQAGIGLATVIIMLSAVVTTVTTLSMSAICTNGEVKGGGAYYLISRSLGPEFGGSIGIIFSIASAVAVAMYVVGFAE--------TVRDLLKENGALIVDEV---NDVRII--GLITIVFILAVALVGLKWVVRTQVILLAVLIISILDVIIGTFI-GPQNASSKAQGFLG----------------------------------------------------YQDGVFQTNFMPDFRGEG---------------------FFSVFAIFFPAATGILAGVNISGDLKNPHTAVPKGTLLAILVSSLVYIVLAWLIGATYARDATGLVMSVAVVNGSSQSNVTSIPTCDTMKCLFGLYFDNQAMQKASGWGPIVTAGIFASTLSSAIASIVGAPKTFQAVCKDKLFPKIDYFGVGYGPGNEPKRGYVLAFLIACAFTAIGDLNAIAPIISNFFLIVYALINYATFVASLGRSPGWRPSFRFYNMWVSLIGALLCVAIMFLINWWAALVTIMIVVGLYKFVDYRKPNVNWGSSGQANTYMSALRFTTLLDTHEEHVKNFRPQCLVLSGRPAE----RPDLMYIASQLTKNSGLMMYGNVCRQKFDKISDDEEREDAKWLKEH--------KIKAFRATTTAHSLRTGVQAMLHLTGLGKMKPNTLVLGFKNDWQIAPLADLEGYFGVINDAFQMDFGVAILRIGKETIEFDEVSLTDSICNEDEFKRPEPVAEPLQKPEQELAFEGKQRGTIDVWWLYDDGGLTILLPYLLTLHRLWRSCDLRLFYLDIRSKHAIKADQLKMANLMKKFRIQVS-SVVQVPGAN 822          

HSP 2 Score: 59.6918 bits (143), Expect = 6.766e-9
Identity = 38/129 (29.46%), Postives = 69/129 (53.49%), Query Frame = 2
Query: 2894 RIDHLRKASL-KDFHVDQSKLVDTHQFTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            + D L+ A+L K F +  S +V       +P+      + L+        ++L+    + KK+   + +  L++++S NA LV+++LP P     +   Y+++L +LS+ LP VLLVRG  + V+T YS
Sbjct:  795 KADQLKMANLMKKFRIQVSSVVQVPGANTAPS-----GESLDAFRALPVGRELDDGPIDDKKVLRTIRIGELVRKRSNNAKLVVISLPVPVAEMTTPLMYMSWLEMLSKDLPPVLLVRGNQRSVLTFYS 918          
BLAST of slc12a-1 vs. Ensembl Nematostella
Match: EDO41917 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S304])

HSP 1 Score: 291.197 bits (744), Expect = 2.170e-86
Identity = 204/656 (31.10%), Postives = 315/656 (48.02%), Query Frame = 2
Query:  434 KLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAP--TLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEMVCFLGERLLTKSFWTINKTLSCNKTMLEDYYCNGNLTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVMPGVKGLGGRDVTRDMMT--NFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIP-FLKVFSP-ITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIE-EETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKE--NLKECMVTTKVKGFVQTIVCSDVKEGISTLI 2374
            KL+   GV +P    +F VI+FLRL +++G +G L G  +  +  L   +T +S+SAIATNG VK GG+Y+MISR LGP+FG AIGI+F+  N  A+A+Y++G +E LL    P  +L   +S     H  +   F     Y S +L L   +  +G       + +    V++S+    +  FV  P                        +  N T+L               Y     +++  +   ++    KSNLWP +               +D T+D  +   +  + AI F  VTGIM G+NMSGDLK P K IP  T+ A L T  VY+  V     T  RE+L++ Y           ++    R ++ IG   ST  A L CL  A R+LHAIAKD ++   LK F+    R  EP   +LLS+FF E  L +GN++ +APLV +FFL+ Y   N+AC +  + +APN+RP F+Y+ W  + +G      I+FA    Y  +++A+   ++  +  R     WGD  + L     +  LL ++  + H K WRPQ+L+L          Y  LI F   +K   GL IL  +  G++    +  +        N  +C    ++K FV+  + S +++G+  L+
Sbjct:    1 KLSMFFGVIVPVTLSMFSVILFLRLGFVVGQAGLLLGVGLFIVAYLAVSITVLSISAIATNGVVKGGGAYYMISRTLGPEFGGAIGIIFFFANVFASALYVLGFVEALLNNFGPRGSLAHIES----FHQGYWYQF----LYGSAILMLCLAVCMIGAGMFAKTSFVIFLAVMVSVSAALVSLFVDCPS--------------------THLIKYNYTLL---------------YLLQKSIRF--SYTSWSFKTAKSNLWPKFT--------------KDYTKDEHSEQTWLQVFAILFNGVTGIMAGANMSGDLKSPGKAIPYGTLTACLGTFVVYVILVICTGFTCSRELLVENYNY--------LQVIDNVRVLITIGVFASTLSAALSCLIGASRILHAIAKDQLLGVILKPFAAGFGRNNEPLNAVLLSWFFVEIILFIGNLNTVAPLVSMFFLLCYGVTNMACFVLKVASAPNFRPTFKYFSWQTAFLGTVFCFVIMFAINPLYATISIAVMFILFIIISLRAPPTPWGDVSQALIYHQVRKYLLRLDVRKEHVKFWRPQVLLLVSNPRS---SY-NLIDFVNDIK-KSGLYILGHVQVGEFNSDSICQQKNDTGTWLNFVDC---AEIKSFVELTIASSIRQGVQHLL 581          
BLAST of slc12a-1 vs. Ensembl Nematostella
Match: EDO41391 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G9])

HSP 1 Score: 253.832 bits (647), Expect = 3.722e-70
Identity = 212/782 (27.11%), Postives = 358/782 (45.78%), Query Frame = 2
Query:  176 DENREHSVSFRDRHSIINDQKIGKLEVRKVSSGLTDNVEE--------GHESDDDVKDETMALYQEDYSIMNSISGYLRAMTYQTSVAGQKKNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEMVCFLGERLLTKSFWTINKTLSCNKTMLEDYYCNGNLTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVMPGVKGLGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVL--LDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFG-EPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDG------IRGLKLAGAKYSLLNIEEETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEH 2470
            +E    +V +R+ H+    QK  +  ++++  G  D+ ++         H S+ DVK    A+                           K  PK   + GV L  L +I+GV++FLRL W++G SG +    ++ +  L T +T++SMSA+ TNG+VK GG+Y++ISR+LGP+FG +IG++F L NA+A A+Y+VG  E        T+     + GS   D     N+ R      +  +  +  +G+++V     + L  ++ISIV   +G F+  P+    V      L  K+F T          +L DY          + +F    V + PA  G  +GV   N+        + +P  KG           T + +LL+         + G+ +  D     + +   T    + T        C++      + +  +  +G  +  G+  A L           +L S  GA        P+   A+ KD++ P++  F      G EP R  +L++  A   + +GN+++IAP++  FFLM YA +N A    ++  +P WRP FRYY+ ++SLVGA L + I+F   W+  LVT+A+  +++KYV+ +  E  WG        I+ L+ A   Y L N E+  H KN+RPQ L+L    S      P L     Q+    GL++   +  G         + +  K+ L+E     K++ F      + +++G+ +L+Q+ GLG LKPNT+++G+   W      E  E+
Sbjct:    7 NEAIPMTVFYRNEHTQ-TGQKQYRPTIQELQKGFEDDTDQQVTLENGKSHRSNTDVKVHGDAV---------------------------KMAPKFGWLKGVMLRCLLNIWGVMLFLRLTWVVGQSGIIWSTVIIILSALVTTVTTLSMSAVCTNGEVKGGGAYYLISRSLGPEFGGSIGLIFSLANAVAVALYVVGFAE--------TVRDILRENGSLIIDEV---NDIRVIGVISVLALLAVTLIGLEWVVRTQMVLLGILLISIVDAIVGSFI-GPQDKLSVAQGIVGLNAKTFTT---------NLLPDYRPG-------EHFFSVFAV-FFPAATGILAGV---NISGDLKDAQKAIP--KG-----------TLWAILLSTLVYIALAWLAGACILRDASGFVETVVNATANVTMATPPSCPGSGCLYGLINDYQAMEKMSAWGPLVTCGIFAATLS---------SALASLVGA--------PKTFQALCKDNIFPYIGYFGIGVGPGEEPRRGYILTFIIAVGFVAVGNLNVIAPVISNFFLMSYALINYAVFAASLGRSPGWRPSFRYYNMWVSLVGALLCVAIMFLINWWAALVTIAIIASLHKYVDIKKPEVNWGSSAQAFTYIQALRFA---YRLNNTED--HVKNFRPQCLVLTGAPSS----RPNLTYIVSQITKNVGLMVCGQVNVGSLC------QVKSEKDWLRE----RKIRAFHTVCSAASLRDGVQSLLQTAGLGKLKPNTLVIGFKRNWMRAPHSEVEEY 679          

HSP 2 Score: 64.6994 bits (156), Expect = 2.089e-10
Identity = 39/129 (30.23%), Postives = 71/129 (55.04%), Query Frame = 2
Query: 2561 KGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQS--DNSILMKDSLVKWLYDLRIKATVEVV----ELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRKASLKD 2929
            KGT+D+WW+  DGGL +++P LL  H +W+ C +R+FT  + +  +N I M + L K+  D    +++EVV    + P++ ++  +       +  +E+L E ++L  +   +  Q RI  L +   KD
Sbjct:  808 KGTVDVWWLFDDGGLTILIPYLLTLHSLWKGCRLRIFTPGSSNIKNNEIRMANLLKKFRIDF---SSIEVVHGIDKAPSNKSVQDFRR-----LPIKEELDEGVQLDKR---ILRQIRIGELLRQHSKD 925          

HSP 3 Score: 52.7582 bits (125), Expect = 9.397e-7
Identity = 36/126 (28.57%), Postives = 65/126 (51.59%), Query Frame = 2
Query: 2900 DHLRKASL-KDFHVDQSKLVDTHQFTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIY 3274
            + +R A+L K F +D S +   H    +P+     K V + +    K ++L+   +  K++   + +  L+++ S +A L+++ LP P     S   Y+++L VLS  LP V L+RG    V+T Y
Sbjct:  854 NEIRMANLLKKFRIDFSSIEVVHGIDKAPSN----KSVQDFRRLPIK-EELDEGVQLDKRILRQIRIGELLRQHSKDARLIVMTLPVPKPTLMSPLMYMSWLEVLSADLPPVFLIRGNQTSVLTFY 974          
BLAST of slc12a-1 vs. Ensembl Nematostella
Match: EDO46430 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ45])

HSP 1 Score: 95.5153 bits (236), Expect = 4.775e-20
Identity = 58/183 (31.69%), Postives = 96/183 (52.46%), Query Frame = 2
Query: 1292 NFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQ--LTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRF----GEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLA 1822
            NFF +  ++FPS TG+++G NMSGDLKDP  +IP  T+AA        +Y+ F  +      RE LL  Y ++    ++          + L G   S+  + L     APR+L  I++D+V+P +K   P+ +      EP+   +     A   +L+GN++ +AP+V + FL+ YA ++ A
Sbjct:  209 NFFTVFGVFFPSATGVLSGINMSGDLKDPSSNIPAGTLAALGFRWVGLLYILFAVLLGAVCTREALLTDYMIASKVSLVGV--------LFLFGLYVSSLSSCLGAQYGAPRVLQVISQDNVVPIIK---PLGKERGANKEPYVASIFVAVIAMLFILIGNLNALAPIVTMPFLVTYASIDYA 380          

HSP 2 Score: 67.781 bits (164), Expect = 1.680e-11
Identity = 35/102 (34.31%), Postives = 56/102 (54.90%), Query Frame = 2
Query:  452 GVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEIL 757
            GV+   + +IFGVI+FLR  W++GN+G      ++ I  L      +S   +     V SGG YF++S  LG + G AI +L+  G A++ +++  G  E L
Sbjct:   21 GVFTSCMLNIFGVIIFLRTGWVVGNAGVGLSLLIIVITLLVALAPVLSSIGVCERCHVGSGGVYFLLSHVLGQRAGGAISLLYAFGQAVSVSLFCAGLGESL 122          
BLAST of slc12a-1 vs. Ensembl Medaka
Match: slc12a4 (solute carrier family 12 member 4 [Source:NCBI gene;Acc:101172318])

HSP 1 Score: 867.07 bits (2239), Expect = 0.000e+0
Identity = 467/1033 (45.21%), Postives = 659/1033 (63.79%), Query Frame = 2
Query:  311 DDVKDETMALYQEDYSIMNSISGYL-RAMTYQTSVAGQK----------------KNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEM-VCFLGERLLT-KSFWTINKT-LSCNKTMLE---DYYC-NGNLT-TFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVM--PGVKGLGGRD--------VTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSISCK---GTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRKASLKDFHVDQSKLVDTH----QFTFSPATL-AQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            +D  D  +AL++E+  I   +S  L R + Y +   G K                K+P +  ++GVYLP LQ+IFGVI+FLRL WI+G +G +Q   +V +CC CT LT+ISMSAIATNG V +GG+YFMISR+LGP+FG A+G+ FYLG   A+AMY++G IEI L Y+ P    F +      D  +A+ NN R Y S  L L+ V+V +GVK+V   A + LACVIISIV +Y G         +  +C LG R L    F    KT +S N T L    + +C  GN++ T CDDYF  N V  +  +PG ASG+I  N+W  Y+ +GE++   G++ +            V+ D+ T+F +L+ I+FPS TGIM GSN SGDL+D QK IP  TI A  TT+ VYLS V +F       VL DK+G ++   ++V  L WP  WV++IGS  ST GAGLQ L  APRLL AIAKD++IPFL+V       GEP   LLL+   AE  +L+ ++D++AP++ +FFLM Y FVNLACA+Q +L  PNWRPRF+YYHW LS +G ++ + ++F + WYY +V + +   IYKY+EY+GAEKEWGDGIRGL L+ A+Y+LL +E    HTKNWRPQ+L+L K + DL +KYP++++FA QLK G+GL I+ S+++G++ D     + Q  ++ +K  M   +VKGF Q +V + V+EGI  LIQS GLG +K NTV++GWP+ W+  S++      F++ +    +A + +++PK VS YPS   +   G ID+WWI+ DGG+LM+LP LLK+H+VW +C++R+FTVA   DNSI MK  L  +LY LRI+A VEVVE+ +SD ISAY +++TL+ME+R +++ QM+L++ E   E Q   D      +   + D+ + VD      Q T++     A+ K+        ++   L P+    ++MH AV+LN +I  KS +A LV+LN+PGPP+N    E Y+ +L VL+EGL RVLLVRG G+EVITIYS
Sbjct:   94 NDYYDRNLALFEEELDIRPKVSSLLSRLVNYTSITQGAKEHEEEESADASRQKTPKSPNMGTLMGVYLPCLQNIFGVILFLRLTWIVGMAGIIQSLLIVIMCCSCTMLTAISMSAIATNGVVPAGGAYFMISRSLGPEFGGAVGLCFYLGTTFASAMYILGAIEIFLKYLVPQAAIFHATDPLRSD--SALLNNMRVYGSLCLSLMAVVVFVGVKYVNKLASLFLACVIISIVSIYAGAIKSVTHPPDFPICMLGNRTLKLDGFDVCAKTVMSGNITELSQLWNRFCLPGNMSSTHCDDYFLHNNVTEIQGIPGLASGIISDNMWGNYLQKGEILEKAGLQSVDAHSSIENFVNYVSVDITTSFTLLVGIFFPSATGIMAGSNRSGDLRDAQKSIPVGTILAITTTTIVYLSSVVLFGSCIEGVVLRDKFGDAVKKNLVVGTLSWPSPWVIVIGSFFSTIGAGLQSLTGAPRLLQAIAKDNIIPFLRVVGHGKSNGEPTWALLLTGLIAELGILIASLDMVAPILSMFFLMCYLFVNLACAVQTLLRTPNWRPRFKYYHWALSFLGMSMCLALMFISSWYYAIVAMGIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARYALLRLEAGPPHTKNWRPQLLVLLKLDEDLHVKYPRMLTFASQLKAGKGLTIVGSVIQGNFLDS--FGEMQAAEQAIKNMMEIERVKGFCQVVVAAKVREGIVHLIQSCGLGGMKHNTVVMGWPYGWRQ-SEDPRVWKTFINTVRCTTAAHLALMVPKNVSFYPSNHERFTDGNIDVWWIVHDGGMLMLLPFLLKQHKVWRKCKMRIFTVAQMDDNSIQMKKDLATFLYQLRIEAEVEVVEMHDSD-ISAYTYERTLMMEQRSQMLRQMRLSSAEKQREAQLVKDRHSLVRMGSLYSDEEEEVDVPLDKVQMTWTREKCEAERKNRSNAPENFRELMSLKPDQSNVRRMHTAVKLNEVIVNKSHDARLVLLNMPGPPRNADGNENYMEFLEVLTEGLERVLLVRGGGREVITIYS 1120          
BLAST of slc12a-1 vs. Ensembl Medaka
Match: slc12a4 (solute carrier family 12 member 4 [Source:NCBI gene;Acc:101172318])

HSP 1 Score: 865.144 bits (2234), Expect = 0.000e+0
Identity = 467/1033 (45.21%), Postives = 659/1033 (63.79%), Query Frame = 2
Query:  311 DDVKDETMALYQEDYSIMNSISGYL-RAMTYQTSVAGQK----------------KNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEM-VCFLGERLLT-KSFWTINKT-LSCNKTMLE---DYYC-NGNLT-TFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVM--PGVKGLGGRD--------VTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSISCK---GTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRKASLKDFHVDQSKLVDTH----QFTFSPATL-AQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            +D  D  +AL++E+  I   +S  L R + Y +   G K                K+P +  ++GVYLP LQ+IFGVI+FLRL WI+G +G +Q   +V +CC CT LT+ISMSAIATNG V +GG+YFMISR+LGP+FG A+G+ FYLG   A+AMY++G IEI L Y+ P    F +      D  +A+ NN R Y S  L L+ V+V +GVK+V   A + LACVIISIV +Y G         +  +C LG R L    F    KT +S N T L    + +C  GN++ T CDDYF  N V  +  +PG ASG+I  N+W  Y+ +GE++   G++ +            V+ D+ T+F +L+ I+FPS TGIM GSN SGDL+D QK IP  TI A  TT+ VYLS V +F       VL DK+G ++   ++V  L WP  WV++IGS  ST GAGLQ L  APRLL AIAKD++IPFL+V       GEP   LLL+   AE  +L+ ++D++AP++ +FFLM Y FVNLACA+Q +L  PNWRPRF+YYHW LS +G ++ + ++F + WYY +V + +   IYKY+EY+GAEKEWGDGIRGL L+ A+Y+LL +E    HTKNWRPQ+L+L K + DL +KYP++++FA QLK G+GL I+ S+++G++ D     + Q  ++ +K  M   +VKGF Q +V + V+EGI  LIQS GLG +K NTV++GWP+ W+  S++      F++ +    +A + +++PK VS YPS   +   G ID+WWI+ DGG+LM+LP LLK+H+VW +C++R+FTVA   DNSI MK  L  +LY LRI+A VEVVE+ +SD ISAY +++TL+ME+R +++ QM+L++ E   E Q   D      +   + D+ + VD      Q T++     A+ K+        ++   L P+    ++MH AV+LN +I  KS +A LV+LN+PGPP+N    E Y+ +L VL+EGL RVLLVRG G+EVITIYS
Sbjct:   64 NDYYDRNLALFEEELDIRPKVSSLLSRLVNYTSITQGAKEHEEEESADASRQKTPKSPNMGTLMGVYLPCLQNIFGVILFLRLTWIVGMAGIIQSLLIVIMCCSCTMLTAISMSAIATNGVVPAGGAYFMISRSLGPEFGGAVGLCFYLGTTFASAMYILGAIEIFLKYLVPQAAIFHATDPLRSD--SALLNNMRVYGSLCLSLMAVVVFVGVKYVNKLASLFLACVIISIVSIYAGAIKSVTHPPDFPICMLGNRTLKLDGFDVCAKTVMSGNITELSQLWNRFCLPGNMSSTHCDDYFLHNNVTEIQGIPGLASGIISDNMWGNYLQKGEILEKAGLQSVDAHSSIENFVNYVSVDITTSFTLLVGIFFPSATGIMAGSNRSGDLRDAQKSIPVGTILAITTTTIVYLSSVVLFGSCIEGVVLRDKFGDAVKKNLVVGTLSWPSPWVIVIGSFFSTIGAGLQSLTGAPRLLQAIAKDNIIPFLRVVGHGKSNGEPTWALLLTGLIAELGILIASLDMVAPILSMFFLMCYLFVNLACAVQTLLRTPNWRPRFKYYHWALSFLGMSMCLALMFISSWYYAIVAMGIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARYALLRLEAGPPHTKNWRPQLLVLLKLDEDLHVKYPRMLTFASQLKAGKGLTIVGSVIQGNFLDS--FGEMQAAEQAIKNMMEIERVKGFCQVVVAAKVREGIVHLIQSCGLGGMKHNTVVMGWPYGWRQ-SEDPRVWKTFINTVRCTTAAHLALMVPKNVSFYPSNHERFTDGNIDVWWIVHDGGMLMLLPFLLKQHKVWRKCKMRIFTVAQMDDNSIQMKKDLATFLYQLRIEAEVEVVEMHDSD-ISAYTYERTLMMEQRSQMLRQMRLSSAEKQREAQLVKDRHSLVRMGSLYSDEEEEVDVPLDKVQMTWTREKCEAERKNRSNAPENFRELMSLKPDQSNVRRMHTAVKLNEVIVNKSHDARLVLLNMPGPPRNADGNENYMEFLEVLTEGLERVLLVRGGGREVITIYS 1090          
BLAST of slc12a-1 vs. Ensembl Medaka
Match: ENSORLT00000011204.2 (solute carrier family 12 member 6 [Source:NCBI gene;Acc:101160765])

HSP 1 Score: 862.833 bits (2228), Expect = 0.000e+0
Identity = 470/1079 (43.56%), Postives = 651/1079 (60.33%), Query Frame = 2
Query:  308 DDDVKDETMALYQEDYSIMNSISGYL-RAMTYQTSVAGQK---------------KNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEM-VCFLGERLLTKSFW---------------------------------------TINKTLSCNKTMLEDYYCNG-NLTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEV-----MPGVKGLGGRDVTR-----DMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSIS---CKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQ---ARIDHLRKASLKDFHVDQSKLVD--------TH----QFTFSPATLAQMKDVLEMKTTTKKSKKL---NPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            DDD  D  +AL++E+      +S  L R   Y     G K               K+P++   +GVYLP LQ+IFGVI+FLRL W++G +G LQ   +VF+CC CT LT+ISMSAIATNG V +GGSYFMISR+LGP+FG A+G+ FYLG   A +MY++G IEILL Y+ P    F       H D  AM NN R Y S  L L+ ++V +GVK+V   A + LACVIISI+ +Y+G  V + +     VC LG R +   +                                        T         T L  ++C   +L   CD+YF  N    +  +PG ASG+I  NLW  Y+++G V     +  V+      +       D+ T+F +L+ I+FPSVTGIM GSN SGDLKD Q+ IP  TI A LTTS VYLS V +F       VL DK+G S+GG ++V  L WP  WV++IGS  ST GAGLQ L  APRLL AIAKD++IPFL+VF      GEP   LLL+   AE  +L+ ++D++AP++ +FFLM Y FVNLACALQ +L  PNWRPRF YYHW LS +G  + + ++F + WYY +V + +   IYKY+EY GAEKEWGDGIRGL L+ A+Y+LL +EE   HTKNWRPQ+L+L K + D  +K P+L++FA QLK G+GL I+ ++V G++       ++   ++ L+  M   +VKGF Q IV    +EGIS +IQS GLG +KPNTV++GWP  W+   D +S +  F++ +    +A + +L+PK +S +P+ S    +G ID+WWI+ DGG+LM+LP LL++H+VW +C +R+FTVA   DNSI MK  L  +LY LRI+A VEVVE+ +SD ISAY +++TL+ME+R +++ QM+L+  + + E Q    R   LR  S+     D + + +         H    Q T++    AQ +      +T +  + +    P++   ++MH AV+LN +I  KS +A LV+LN+PGPP+N    E Y+ +L VL+EGL RVLLVRG G EVITIYS
Sbjct:   92 DDDFYDRNLALFEEEMDTRPKVSSLLSRLANYTNLTQGAKEHEEAESIGEKKKPSKSPQMGTFMGVYLPCLQNIFGVILFLRLTWVVGTAGVLQALCIVFVCCCCTMLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGLCFYLGTTFAGSMYILGAIEILLLYIVPKAAVF-------HGDGGAMLNNMRLYGSICLLLMSLLVFVGVKYVNKLASVFLACVIISIISIYVGALVSAFKEPHFPVCMLGNRTINGHYVADHHCEKIISELHREEVERPEGNFSLGFENSTVEPASPPTREPAAENQTTDLWGHFCQSRDLNATCDEYFTNNQFSQIQGIPGLASGIITENLWSSYLTKGAVVEKSSLSSVQASHPASIQLPYVFVDITTSFTLLVGIFFPSVTGIMAGSNRSGDLKDAQRSIPIGTIFAILTTSIVYLSSVVLFGACIDGVVLRDKFGDSVGGELVVGTLAWPTPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHSKPNGEPTWALLLTALIAELGILIASLDMVAPILTMFFLMCYLFVNLACALQTLLRTPNWRPRFSYYHWTLSFLGMTICLALMFISSWYYAIVAMVIAGMIYKYIEYHGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLLKLDEDAHVKSPQLLTFASQLKAGKGLTIVGTVVSGNFLQS--FGESLAAEQTLRHLMEKERVKGFCQCIVAQKPREGISHMIQSSGLGGMKPNTVVMGWPQAWRQSEDPQSWK-TFINTVRVTTAAHLALLVPKNISLFPTNSEPCTEGYIDVWWIVHDGGMLMLLPFLLRQHKVWRKCGMRIFTVAQMEDNSIQMKKDLATFLYHLRIEAEVEVVEMHDSD-ISAYTYERTLMMEQRSQMLRQMRLSKSDREREAQLVKDRNSMLRLTSIGSDDDDDTDVAERLGSGGSSEHNRRVQMTWTKDKAAQYRATHSGCSTPEGFRDMLSIRPDHSNVRRMHTAVKLNEVIVNKSHDARLVLLNMPGPPRNTEGDENYMEFLEVLTEGLERVLLVRGGGSEVITIYS 1159          
BLAST of slc12a-1 vs. Ensembl Medaka
Match: ENSORLT00000028149.1 (solute carrier family 12 member 6 [Source:NCBI gene;Acc:101160765])

HSP 1 Score: 857.825 bits (2215), Expect = 0.000e+0
Identity = 469/1087 (43.15%), Postives = 651/1087 (59.89%), Query Frame = 2
Query:  308 DDDVKDETMALYQEDYSIMNSISGYL-RAMTYQTSVAGQK---------------KNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEM-VCFLGERLLTKSFW---------------------------------------TINKTLSCNKTMLEDYYCNG-NLTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEV-----MPGVKGLGGRDVTR-----DMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSIS---CKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEP-----------QARIDHLRKASLKDFHVDQSKLVD--------TH----QFTFSPATLAQMKDVLEMKTTTKKSKKL---NPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            DDD  D  +AL++E+      +S  L R   Y     G K               K+P++   +GVYLP LQ+IFGVI+FLRL W++G +G LQ   +VF+CC CT LT+ISMSAIATNG V +GGSYFMISR+LGP+FG A+G+ FYLG   A +MY++G IEILL Y+ P    F       H D  AM NN R Y S  L L+ ++V +GVK+V   A + LACVIISI+ +Y+G  V + +     VC LG R +   +                                        T         T L  ++C   +L   CD+YF  N    +  +PG ASG+I  NLW  Y+++G V     +  V+      +       D+ T+F +L+ I+FPSVTGIM GSN SGDLKD Q+ IP  TI A LTTS VYLS V +F       VL DK+G S+GG ++V  L WP  WV++IGS  ST GAGLQ L  APRLL AIAKD++IPFL+VF      GEP   LLL+   AE  +L+ ++D++AP++ +FFLM Y FVNLACALQ +L  PNWRPRF YYHW LS +G  + + ++F + WYY +V + +   IYKY+EY GAEKEWGDGIRGL L+ A+Y+LL +EE   HTKNWRPQ+L+L K + D  +K P+L++FA QLK G+GL I+ ++V G++       ++   ++ L+  M   +VKGF Q IV    +EGIS +IQS GLG +KPNTV++GWP  W+   D +S +  F++ +    +A + +L+PK +S +P+ S    +G ID+WWI+ DGG+LM+LP LL++H+VW +C +R+FTVA   DNSI MK  L  +LY LRI+A VEVVE+ +SD ISAY +++TL+ME+R +++ QM+L+  + + E            + R   LR  S+     D + + +         H    Q T++    AQ +      +T +  + +    P++   ++MH AV+LN +I  KS +A LV+LN+PGPP+N    E Y+ +L VL+EGL RVLLVRG G EVITIYS
Sbjct:   92 DDDFYDRNLALFEEEMDTRPKVSSLLSRLANYTNLTQGAKEHEEAESIGEKKKPSKSPQMGTFMGVYLPCLQNIFGVILFLRLTWVVGTAGVLQALCIVFVCCCCTMLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGLCFYLGTTFAGSMYILGAIEILLLYIVPKAAVF-------HGDGGAMLNNMRLYGSICLLLMSLLVFVGVKYVNKLASVFLACVIISIISIYVGALVSAFKEPHFPVCMLGNRTINGHYVADHHCEKIISELHREEVERPEGNFSLGFENSTVEPASPPTREPAAENQTTDLWGHFCQSRDLNATCDEYFTNNQFSQIQGIPGLASGIITENLWSSYLTKGAVVEKSSLSSVQASHPASIQLPYVFVDITTSFTLLVGIFFPSVTGIMAGSNRSGDLKDAQRSIPIGTIFAILTTSIVYLSSVVLFGACIDGVVLRDKFGDSVGGELVVGTLAWPTPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHSKPNGEPTWALLLTALIAELGILIASLDMVAPILTMFFLMCYLFVNLACALQTLLRTPNWRPRFSYYHWTLSFLGMTICLALMFISSWYYAIVAMVIAGMIYKYIEYHGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLLKLDEDAHVKSPQLLTFASQLKAGKGLTIVGTVVSGNFLQS--FGESLAAEQTLRHLMEKERVKGFCQCIVAQKPREGISHMIQSSGLGGMKPNTVVMGWPQAWRQSEDPQSWK-TFINTVRVTTAAHLALLVPKNISLFPTNSEPCTEGYIDVWWIVHDGGMLMLLPFLLRQHKVWRKCGMRIFTVAQMEDNSIQMKKDLATFLYHLRIEAEVEVVEMHDSD-ISAYTYERTLMMEQRSQMLRQMRLSKSDRERERVRWSFDDAQLVKDRNSMLRLTSIGSDDDDDTDVAERLGSGGSSEHNRRVQMTWTKDKAAQYRATHSGCSTPEGFRDMLSIRPDHSNVRRMHTAVKLNEVIVNKSHDARLVLLNMPGPPRNTEGDENYMEFLEVLTEGLERVLLVRGGGSEVITIYS 1167          
BLAST of slc12a-1 vs. Ensembl Medaka
Match: slc12a4 (solute carrier family 12 member 4 [Source:NCBI gene;Acc:101172318])

HSP 1 Score: 851.277 bits (2198), Expect = 0.000e+0
Identity = 454/981 (46.28%), Postives = 637/981 (64.93%), Query Frame = 2
Query:  425 KNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEM-VCFLGERLLT-KSFWTINKT-LSCNKTMLE---DYYC-NGNLT-TFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVM--PGVKGLGGRD--------VTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEE-ETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPE---HEFLDAIHRVVSAEICMLIPKGVSEYPSISCK---GTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRKASLKDFHVDQSKLVDTH----QFTFSPATL-AQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            K+P +  ++GVYLP LQ+IFGVI+FLRL WI+G +G +Q   +V +CC CT LT+ISMSAIATNG V +GG+YFMISR+LGP+FG A+G+ FYLG   A+AMY++G IEI L Y+ P    F +      D  +A+ NN R Y S  L L+ V+V +GVK+V   A + LACVIISIV +Y G         +  +C LG R L    F    KT +S N T L    + +C  GN++ T CDDYF  N V  +  +PG ASG+I  N+W  Y+ +GE++   G++ +            V+ D+ T+F +L+ I+FPS TGIM GSN SGDL+D QK IP  TI A  TT+ VYLS V +F       VL DK+G ++   ++V  L WP  WV++IGS  ST GAGLQ L  APRLL AIAKD++IPFL+V       GEP   LLL+   AE  +L+ ++D++AP++ +FFLM Y FVNLACA+Q +L  PNWRPRF+YYHW LS +G ++ + ++F + WYY +V + +   IYKY+EY+GAEKEWGDGIRGL L+ A+Y+LL +E    HTKNWRPQ+L+L K + DL +KYP++++FA QLK G+GL I+ S+++G++ D     + Q  ++ +K  M   +VKGF Q +V + V+EGI  LIQS GLG +K NTV++GWP+ W+   D    +   +++        +A + +++PK VS YPS   +   G ID+WWI+ DGG+LM+LP LLK+H+VW +C++R+FTVA   DNSI MK  L  +LY LRI+A VEVVE+ +SD ISAY +++TL+ME+R +++ QM+L++ E   E Q   D      +   + D+ + VD      Q T++     A+ K+        ++   L P+    ++MH AV+LN +I  KS +A LV+LN+PGPP+N    E Y+ +L VL+EGL RVLLVRG G+EVITIYS
Sbjct:   42 KSPNMGTLMGVYLPCLQNIFGVILFLRLTWIVGMAGIIQSLLIVIMCCSCTMLTAISMSAIATNGVVPAGGAYFMISRSLGPEFGGAVGLCFYLGTTFASAMYILGAIEIFLKYLVPQAAIFHATDPLRSD--SALLNNMRVYGSLCLSLMAVVVFVGVKYVNKLASLFLACVIISIVSIYAGAIKSVTHPPDFPICMLGNRTLKLDGFDVCAKTVMSGNITELSQLWNRFCLPGNMSSTHCDDYFLHNNVTEIQGIPGLASGIISDNMWGNYLQKGEILEKAGLQSVDAHSSIENFVNYVSVDITTSFTLLVGIFFPSATGIMAGSNRSGDLRDAQKSIPVGTILAITTTTIVYLSSVVLFGSCIEGVVLRDKFGDAVKKNLVVGTLSWPSPWVIVIGSFFSTIGAGLQSLTGAPRLLQAIAKDNIIPFLRVVGHGKSNGEPTWALLLTGLIAELGILIASLDMVAPILSMFFLMCYLFVNLACAVQTLLRTPNWRPRFKYYHWALSFLGMSMCLALMFISSWYYAIVAMGIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARYALLRLEAGPPHTKNWRPQLLVLLKLDEDLHVKYPRMLTFASQLKAGKGLTIVGSVIQGNFLDS--FGEMQAAEQAIKNMMEIERVKGFCQVVVAAKVREGIVHLIQSCGLGGMKHNTVVMGWPYGWRQSEDPRVWKTFINKYTLHFRCTTAAHLALMVPKNVSFYPSNHERFTDGNIDVWWIVHDGGMLMLLPFLLKQHKVWRKCKMRIFTVAQMDDNSIQMKKDLATFLYQLRIEAEVEVVEMHDSD-ISAYTYERTLMMEQRSQMLRQMRLSSAEKQREAQLVKDRHSLVRMGSLYSDEEEEVDVPLDKVQMTWTREKCEAERKNRSNAPENFRELMSLKPDQSNVRRMHTAVKLNEVIVNKSHDARLVLLNMPGPPRNADGNENYMEFLEVLTEGLERVLLVRGGGREVITIYS 1017          
BLAST of slc12a-1 vs. Planmine SMEST
Match: SMESG000043220.1 (SMESG000043220.1)

HSP 1 Score: 1015.37 bits (2624), Expect = 0.000e+0
Identity = 493/494 (99.80%), Postives = 493/494 (99.80%), Query Frame = 2
Query: 1796 MLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEEETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSISCKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRKASLKDFHVDQSKLVDTHQFTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            MLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEEETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECM TTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSISCKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRKASLKDFHVDQSKLVDTHQFTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS
Sbjct:    1 MLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIEEETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMATTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDAIHRVVSAEICMLIPKGVSEYPSISCKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRKASLKDFHVDQSKLVDTHQFTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 494          
BLAST of slc12a-1 vs. Planmine SMEST
Match: SMESG000043221.1 (SMESG000043221.1)

HSP 1 Score: 938.717 bits (2425), Expect = 0.000e+0
Identity = 456/457 (99.78%), Postives = 456/457 (99.78%), Query Frame = 2
Query:  143 QNGDQNALLLNDENREHSVSFRDRHSIINDQKIGKLEVRKVSSGLTDNVEEGHESDDDVKDETMALYQEDYSIMNSISGYLRAMTYQTSVAGQKKNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEMVCFLGERLLTKSFWTINKTLSCNKTMLEDYYCNGNLTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVMPGVKGLGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGG 1513
            QNGDQNALLLNDENREHSVSFRDRHSIINDQKIGKLEVRKVSSGLTDNVEEGHESDDDVKDETMALYQEDYSIMNSISGYLRAMTYQTSVAGQKKNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEMVCFLGERLLTKSFWTINKTLSCNKTMLEDYYCNGNLTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVMPGVKGLGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFV IFAGTTRREVLLDKYGVSMGG
Sbjct:   20 QNGDQNALLLNDENREHSVSFRDRHSIINDQKIGKLEVRKVSSGLTDNVEEGHESDDDVKDETMALYQEDYSIMNSISGYLRAMTYQTSVAGQKKNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEMVCFLGERLLTKSFWTINKTLSCNKTMLEDYYCNGNLTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVMPGVKGLGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVFIFAGTTRREVLLDKYGVSMGG 476          
BLAST of slc12a-1 vs. Planmine SMEST
Match: SMESG000019076.1 (SMESG000019076.1)

HSP 1 Score: 776.933 bits (2005), Expect = 0.000e+0
Identity = 443/1055 (41.99%), Postives = 625/1055 (59.24%), Query Frame = 2
Query:  167 LLNDENREHSVSFRDRHSIINDQKIGKLE-VRKVSSGLTDNVEEGHESDDDVKDETMALYQEDY-------SIMNSISGY---LRAMTYQTSVAGQKKNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEMVCFLGERLLTKSF---WTINKTLSCNKTM---LEDYYCNGNLTTFCDD---YFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVMPGVKGL------GGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNI-EEETHTKNWRPQILILCKTNSDLCIK--YPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPE-HEFLDAIHRVVSAEICMLIPKGVSEYP---------------SISCKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARID--HLRKASLKDFHVDQSKLVDTH-QFTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPG--PPKNKHSL 3181
            ++N EN  +SV+       + + K+   E + K ++ LTD   E  + ++   D    LY+E++       +I N ++ Y   +   + +T    +K + KL  I+GVY P LQ+IFGV+ FLRL WIIG SG   GF +VF+CC  T LT +SMSAIATNGKV +GGSYFMISR+LGP+FG  +GILFY G  +A AMY++G IE++L Y+ P    F    G    D   MFNN R Y   LL ++   V +G+KFV  F+ I+LACV+ SI+CVY+G FV +P RS  VC LG+RLL +S       N T  C K +   L   YC        D+   YFK N V   PA+PG+   ++K   +  Y +    + G  G       G      D+  +F +L+ I+FPSVTGIM GSN SGDL +PQ  IP  +IAA  TTSFVYLS V  F+ T    VL DK+G S+G G+IVA+L WP+ WV+LIGS  ST GAGLQ L  APRLL AIA+D+VIPFL+VF   T+ GEP R   L++F +   +L+ ++D IAPL+ +FFLM Y FVNLA AL   L  P+WRPRF+YYHW  SL+G  L I ++F + WYY LV +AL   IYKY+EYRGA KEWGD  RG +++ AK ++L + ++  HTKNWRPQILIL   + + C K  +PKLI F  QLK GRGL I+ +++EG+  DK  +  +   KE L   +   ++KG  + +V S+V E I  L Q+ GLG L+ N VMV +P  W   +D+   +  +F+  +    ++++ +L+PKG+ ++P                +   GT+D+W I+ DGGLL++L  LL R R W +CE+RVF VA++ DN+I +K  +++++YDLRI A VEVVEL  +D ISAY  Q+T+ +  R+K++E M L   +   E QA +D  H+    L       + + DT     FSP     + DV E + T K  + +  E+    +   ++  +I  K KS N +  ++  P   P +N+ S+
Sbjct:   14 VINSENDLNSVAAEKAAHYVVESKVENSENITKEATPLTDEEIEMSDDEEPAGDSKFDLYEEEFHTRPPMANIFNKLAQYTGGIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLF----GPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLD-ETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDK--KSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWA--NDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGLLLLLAHLLIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQAD-ISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGEL----TMMTNINDTSPDLPFSPLPTINV-DVHENQPTEKTEETVLDEDNHPDENKESMNSHI-SKLKSSNTEQTLILTPDSTPLQNQRSV 1052          

HSP 2 Score: 87.0409 bits (214), Expect = 5.254e-17
Identity = 43/105 (40.95%), Postives = 65/105 (61.90%), Query Frame = 2
Query: 2963 HQFTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            ++FTFSP  +  +K                 + +  ++MH+AV LN +I+ +S NA L+++NLPGP KN+ S   Y+ Y+  L++GL RVL VRGTGKEVIT ++
Sbjct: 1074 NEFTFSPGAMHGLK-----------------QTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 1161          
BLAST of slc12a-1 vs. Planmine SMEST
Match: SMESG000019076.1 (SMESG000019076.1)

HSP 1 Score: 770.77 bits (1989), Expect = 0.000e+0
Identity = 436/1025 (42.54%), Postives = 611/1025 (59.61%), Query Frame = 2
Query:  254 VRKVSSGLTDNVEEGHESDDDVKDETMALYQEDY-------SIMNSISGY---LRAMTYQTSVAGQKKNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVRSPERSEMVCFLGERLLTKSF---WTINKTLSCNKTM---LEDYYCNGNLTTFCDD---YFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVMPGVKGL------GGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNI-EEETHTKNWRPQILILCKTNSDLCIK--YPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPE-HEFLDAIHRVVSAEICMLIPKGVSEYP---------------SISCKGTIDIWWIMQDGGLLMMLPVLLKRHRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSDAISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARID--HLRKASLKDFHVDQSKLVDTH-QFTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPG--PPKNKHSL 3181
            + K ++ LTD   E  + ++   D    LY+E++       +I N ++ Y   +   + +T    +K + KL  I+GVY P LQ+IFGV+ FLRL WIIG SG   GF +VF+CC  T LT +SMSAIATNGKV +GGSYFMISR+LGP+FG  +GILFY G  +A AMY++G IE++L Y+ P    F    G    D   MFNN R Y   LL ++   V +G+KFV  F+ I+LACV+ SI+CVY+G FV +P RS  VC LG+RLL +S       N T  C K +   L   YC        D+   YFK N V   PA+PG+   ++K   +  Y +    + G  G       G      D+  +F +L+ I+FPSVTGIM GSN SGDL +PQ  IP  +IAA  TTSFVYLS V  F+ T    VL DK+G S+G G+IVA+L WP+ WV+LIGS  ST GAGLQ L  APRLL AIA+D+VIPFL+VF   T+ GEP R   L++F +   +L+ ++D IAPL+ +FFLM Y FVNLA AL   L  P+WRPRF+YYHW  SL+G  L I ++F + WYY LV +AL   IYKY+EYRGA KEWGD  RG +++ AK ++L + ++  HTKNWRPQILIL   + + C K  +PKLI F  QLK GRGL I+ +++EG+  DK  +  +   KE L   +   ++KG  + +V S+V E I  L Q+ GLG L+ N VMV +P  W   +D+   +  +F+  +    ++++ +L+PKG+ ++P                +   GT+D+W I+ DGGLL++L  LL R R W +CE+RVF VA++ DN+I +K  +++++YDLRI A VEVVEL  +D ISAY  Q+T+ +  R+K++E M L   +   E QA +D  H+    L       + + DT     FSP     + DV E + T K  + +  E+    +   ++  +I  K KS N +  ++  P   P +N+ S+
Sbjct:   36 ITKEATPLTDEEIEMSDDEEPAGDSKFDLYEEEFHTRPPMANIFNKLAQYTGGIEPTSGETKKLKEKSSNKLGTILGVYFPCLQNIFGVLFFLRLVWIIGVSGTALGFVIVFVCCCSTMLTVLSMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLF----GPIELDENIMFNNTRVYGVILLCIMMSCVFIGIKFVSKFSTISLACVLCSILCVYIGIFVANPSRSLRVCMLGDRLLNRSVVLDKEANNTFRCTKDINGPLYKLYCRNGTKDLNDEACKYFKENNVTEFPAIPGFYRPLLKDGFFQNYYTTKGSLYGEPGKEPHLDKGQSPSVSDIYISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEWVILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIPFLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILINLD-ETCTKMSHPKLIDFCSQLKAGRGLTIVGTVIEGELGDK--KSDSIIAKETLNRAIRDKQIKGLSEIVVASNVIEAIKILCQTSGLGNLRHNCVMVSFPEEWA--NDKSHIKWKQFMATLRVCQASDLAVLVPKGIDQFPYRKSKKQSANVPSDGPVEMTGTVDMWCIVHDGGLLLLLAHLLIRARAWGKCELRVFVVASEKDNTITLKKEVIRFVYDLRINAQVEVVELDQAD-ISAYAFQRTMDLNMRKKILEDMNLRTVDTKREFQAILDKHHVAAGEL----TMMTNINDTSPDLPFSPLPTINV-DVHENQPTEKTEETVLDEDNHPDENKESMNSHI-SKLKSSNTEQTLILTPDSTPLQNQRSV 1044          

HSP 2 Score: 89.7373 bits (221), Expect = 9.704e-18
Identity = 45/105 (42.86%), Postives = 67/105 (63.81%), Query Frame = 2
Query: 2963 HQFTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHNAVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVLLVRGTGKEVITIYS 3277
            ++FTFSP  +  +K         K     N + +  ++MH+AV LN +I+ +S NA L+++NLPGP KN+ S   Y+ Y+  L++GL RVL VRGTGKEVIT ++
Sbjct: 1066 NEFTFSPGAMHGLKFDFSPSLGHK-----NRQTKTGRRMHSAVRLNEMIRSRSSNASLILVNLPGPSKNESSDYNYMQYVETLTDGLARVLFVRGTGKEVITAFA 1165          
BLAST of slc12a-1 vs. Planmine SMEST
Match: SMESG000033021.1 (SMESG000033021.1)

HSP 1 Score: 262.692 bits (670), Expect = 8.588e-73
Identity = 206/678 (30.38%), Postives = 311/678 (45.87%), Query Frame = 2
Query:  407 SVAGQKKNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGFLQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSAIGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMFNNFRTYASGLLFLVFV-IVALGVKFV--QLFAPITLACVIISIVCVYLGGFVRSPERSEMVCFLGERLLTKSFWTINKTLSCNKTMLEDYYCNGNLTTFCDDYFKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVMPGVKGLGGRDVTRDMMTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVYLSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTFGAGLQCLCSAPRLLHAIAKDDVIP-FLKVFSPITRFGEPFRCLLLSYFFAECALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHWFLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIRGLKLAGAKYSLLNIE-EETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQLKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTIVCSDVKEGISTLIQSIGLGALKPNTVMVGW 2425
            +++  +    L    GV+ P     F  ++FLRL +++G +G L     + +  L   LT +S+ AI+TNG +K GG YFMISR LGP+ G +IGILF+L N  ++A+++   +E L+    P              D   +  NF       LF   V I  LGV  V   LFA   L   II  VC +          S +V FL  +        IN  +          Y N N T F +               G +     +NL+  Y                D T      FF + AI FP VTGIM G+NMSG+L  P   IPR T+AA L T   Y+    + A T  R +L + Y       +      W  +  ++IG   +   A L     A R+L A+A+DD+   FLK     T+ G P   +++S+   +  LL+G V++IAP+V +FFL+ YA VNLACAL +   A N+RP F+Y+ W+ SL+G A  + + F   + Y L   +L   I   + +R  +  WG   + L     +  LL I+  + H K WRPQIL+L             L+ F   LK G GL ++  +++ D+   + ++   +++ N  +     K+K F+   +   +++G   L    GLG L  NTV +G+
Sbjct:   34 TLSSDQTKRNLKTFTGVFCPVALAQFSSLLFLRLGFVLGQTGLLLAILQLIMAYLILLLTVLSICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGPL----------GRVDADLIQENF---GWNYLFATCVCIFCLGVCLVGGSLFAKTNLFIFIIVFVCFF----------SVIVSFLFHKAFQVPIPKINTIV----------YSNSNETQFGN-------------YTGLSGTTFINNLYANYTV--------------DFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNL------W--KPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYIYSLGIFSLFFIIIVILNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPR----SQASLVQFVNILKKG-GLFVIGHVIKTDFEHIE-KNPVHEIEGNFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGF 637          
The following BLAST results are available for this feature:
BLAST of slc12a-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC12A40.000e+046.24solute carrier family 12 member 4 [Source:HGNC Sym... [more]
SLC12A40.000e+046.24solute carrier family 12 member 4 [Source:HGNC Sym... [more]
SLC12A40.000e+046.24solute carrier family 12 member 4 [Source:HGNC Sym... [more]
SLC12A60.000e+044.55solute carrier family 12 member 6 [Source:HGNC Sym... [more]
SLC12A40.000e+047.66solute carrier family 12 member 4 [Source:HGNC Sym... [more]
back to top
BLAST of slc12a-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcc-10.000e+043.78K+/Cl-Cotransporter [Source:UniProtKB/TrEMBL;Acc:... [more]
kcc-10.000e+043.78K+/Cl-Cotransporter [Source:UniProtKB/TrEMBL;Acc:... [more]
kcc-10.000e+043.78K+/Cl-Cotransporter [Source:UniProtKB/TrEMBL;Acc:... [more]
kcc-10.000e+045.21K+/Cl-Cotransporter [Source:UniProtKB/TrEMBL;Acc:... [more]
kcc-10.000e+045.12K+/Cl-Cotransporter [Source:UniProtKB/TrEMBL;Acc:... [more]
back to top
BLAST of slc12a-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcc0.000e+045.86gene:FBgn0261794 transcript:FBtr0072136[more]
kcc0.000e+046.10gene:FBgn0261794 transcript:FBtr0072138[more]
kcc0.000e+045.43gene:FBgn0261794 transcript:FBtr0072139[more]
kcc0.000e+045.19gene:FBgn0261794 transcript:FBtr0072137[more]
kcc0.000e+045.52gene:FBgn0261794 transcript:FBtr0343300[more]
back to top
BLAST of slc12a-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc12a40.000e+044.86solute carrier family 12 member 4 [Source:ZFIN;Acc... [more]
slc12a7b0.000e+043.89solute carrier family 12 member 7b [Source:ZFIN;Ac... [more]
slc12a7b0.000e+043.16solute carrier family 12 member 7b [Source:ZFIN;Ac... [more]
slc12a7a0.000e+042.54solute carrier family 12 member 7a [Source:ZFIN;Ac... [more]
slc12a7a0.000e+043.32solute carrier family 12 member 7a [Source:ZFIN;Ac... [more]
back to top
BLAST of slc12a-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000004203.10.000e+045.91solute carrier family 12 (potassium/chloride trans... [more]
ENSXETT00000003001.10.000e+045.77solute carrier family 12 (potassium/chloride trans... [more]
ENSXETT00000002965.10.000e+047.09solute carrier family 12 (potassium/chloride trans... [more]
ENSXETT00000002952.10.000e+047.09solute carrier family 12 (potassium/chloride trans... [more]
il4i10.000e+045.71interleukin 4 induced 1 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of slc12a-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc12a40.000e+046.29solute carrier family 12, member 4 [Source:MGI Sym... [more]
Slc12a40.000e+046.29solute carrier family 12, member 4 [Source:MGI Sym... [more]
Slc12a60.000e+045.77solute carrier family 12, member 6 [Source:MGI Sym... [more]
Slc12a60.000e+045.85solute carrier family 12, member 6 [Source:MGI Sym... [more]
Slc12a50.000e+042.63solute carrier family 12, member 5 [Source:MGI Sym... [more]
back to top
BLAST of slc12a-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q63632|S12A4_RAT0.000e+046.53Solute carrier family 12 member 4 OS=Rattus norveg... [more]
sp|Q9JIS8|S12A4_MOUSE0.000e+046.29Solute carrier family 12 member 4 OS=Mus musculus ... [more]
sp|Q28677|S12A4_RABIT0.000e+046.22Solute carrier family 12 member 4 OS=Oryctolagus c... [more]
sp|Q9UP95|S12A4_HUMAN0.000e+046.24Solute carrier family 12 member 4 OS=Homo sapiens ... [more]
sp|Q9UHW9|S12A6_HUMAN0.000e+045.74Solute carrier family 12 member 6 OS=Homo sapiens ... [more]
back to top
BLAST of slc12a-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YEZ50.000e+0100.00Slc12a-1 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A5S6QAR50.000e+049.73Uncharacterized protein OS=Trichuris muris OX=7041... [more]
A0A085MGU90.000e+049.08Uncharacterized protein OS=Trichuris suis OX=68888... [more]
A0A077Z8J70.000e+050.09Amino acid permease OS=Trichuris trichiura OX=3608... [more]
A0A267F7995.900e-1452.80Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of slc12a-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC12A60.000e+044.00solute carrier family 12 member 6 [Source:NCBI gen... [more]
SLC12A60.000e+043.59solute carrier family 12 member 6 [Source:NCBI gen... [more]
slc12a7b0.000e+042.99solute carrier family 12 member 7-like [Source:NCB... [more]
slc12a7b0.000e+042.98solute carrier family 12 member 7-like [Source:NCB... [more]
slc12a7b0.000e+042.86solute carrier family 12 member 7-like [Source:NCB... [more]
back to top
BLAST of slc12a-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc12a40.000e+046.44solute carrier family 12 member 4 [Source:ZFIN;Acc... [more]
slc12a40.000e+046.32solute carrier family 12 member 4 [Source:ZFIN;Acc... [more]
slc12a94.589e-8028.67solute carrier family 12 member 9 [Source:NCBI gen... [more]
ENSPMAT00000000732.12.331e-5223.76pep scaffold:Pmarinus_7.0:GL479336:3629:33813:1 ge... [more]
ENSPMAT00000003053.12.017e-3725.74pep scaffold:Pmarinus_7.0:GL478333:5880:33924:-1 g... [more]
back to top
BLAST of slc12a-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
VHC13.805e-6327.56Vacuolar membrane cation-chloride cotransporter (C... [more]
back to top
BLAST of slc12a-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO354430.000e+042.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493611.093e-9928.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419172.170e-8631.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO413913.722e-7027.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO464304.775e-2031.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc12a-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc12a40.000e+045.21solute carrier family 12 member 4 [Source:NCBI gen... [more]
slc12a40.000e+045.21solute carrier family 12 member 4 [Source:NCBI gen... [more]
ENSORLT00000011204.20.000e+043.56solute carrier family 12 member 6 [Source:NCBI gen... [more]
ENSORLT00000028149.10.000e+043.15solute carrier family 12 member 6 [Source:NCBI gen... [more]
slc12a40.000e+046.28solute carrier family 12 member 4 [Source:NCBI gen... [more]
back to top
BLAST of slc12a-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043220.10.000e+099.80SMESG000043220.1[more]
SMESG000043221.10.000e+099.78SMESG000043221.1[more]
SMESG000019076.15.254e-1741.99SMESG000019076.1[more]
SMESG000019076.19.704e-1842.54SMESG000019076.1[more]
SMESG000033021.18.588e-7330.38SMESG000033021.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30022804
GenBankAKN21475.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022804 ID=SMED30022804|Name=slc12a-1|organism=Schmidtea mediterranea sexual|type=transcript|length=3395bp
TATAAACTGAAGGATAACCTATTGCTAATATATTTTTATTGAAATCTTGC
ATAAAATAAAATAATTCATCAAGAATTATTTTATAATGCTAAATACAAAT
AATGTGAAAGATTGTGTGAACAATGTGAAAGATTCGGACAACCAAAACGG
AGATCAAAATGCGCTTCTTCTTAACGATGAAAATAGGGAGCATTCAGTTT
CATTTCGTGACCGACATAGCATTATTAATGATCAAAAAATTGGAAAACTT
GAAGTTCGAAAGGTGAGTAGTGGCCTCACGGATAATGTTGAAGAAGGACA
TGAATCCGATGACGACGTAAAGGATGAAACAATGGCCTTATATCAAGAGG
ATTATTCGATTATGAACTCAATCAGTGGATACTTGAGAGCAATGACATAT
CAGACTTCAGTAGCGGGACAAAAAAAGAATCCGAAACTCAATGGAATAAT
CGGGGTGTACCTGCCGACGCTTCAACATATTTTTGGAGTTATAATGTTTC
TGCGACTTTATTGGATTATTGGAAACTCGGGATTTCTACAAGGATTTTTC
ATGGTTTTCATATGCTGTCTATGTACATTTCTAACTTCAATATCAATGAG
TGCAATTGCTACAAATGGGAAAGTTAAAAGTGGTGGCTCATATTTTATGA
TTTCAAGGAATCTTGGACCTCAATTCGGTAGTGCAATTGGGATATTATTT
TACCTCGGAAATGCCATTGCGACAGCTATGTATCTAGTCGGAACGATTGA
AATTCTTCTCACATATGTGGCACCAACTTTACCTCAATTCCAAAGCAAAC
CTGGATCAAGTCACGATGACCATACAGCGATGTTTAATAATTTTCGCACA
TACGCATCGGGCTTACTTTTTCTCGTATTCGTCATCGTGGCTCTTGGAGT
TAAATTCGTACAGTTATTCGCTCCCATAACTTTGGCTTGTGTCATTATCT
CAATTGTTTGCGTTTATCTCGGCGGATTTGTTCGCAGTCCTGAAAGAAGC
GAAATGGTTTGTTTTCTTGGAGAGCGACTATTAACAAAATCATTTTGGAC
GATAAATAAAACTTTATCGTGCAATAAAACAATGCTAGAGGATTATTATT
GTAATGGAAACCTGACAACCTTCTGTGATGACTACTTCAAAGCAAATCCA
GTCCAATATCTTCCAGCAATGCCTGGTTACGCCAGTGGCGTAATAAAAAG
TAACCTCTGGCCAGTTTACATGAGTGAAGGAGAAGTTATGCCAGGAGTTA
AAGGACTCGGTGGGAGAGACGTAACAAGAGATATGATGACAAACTTTTTT
GTACTTTTGGCAATTTATTTTCCATCAGTCACAGGAATAATGACAGGATC
AAACATGTCAGGTGATTTAAAAGACCCACAAAAAGACATTCCAAGATATA
CAATTGCAGCACAATTAACAACATCGTTTGTTTATTTATCATTTGTTTGC
ATTTTTGCTGGAACAACCAGACGAGAAGTTCTCCTAGATAAATATGGAGT
CAGTATGGGAGGGGGAATGATTGTCGCAGAGCTTTGTTGGCCTCATCGGT
GGGTGCTGCTGATTGGATCATTGACGTCAACATTTGGAGCAGGTCTTCAA
TGTTTATGCAGTGCTCCACGGCTGTTGCATGCAATCGCAAAAGATGATGT
TATCCCATTTTTGAAAGTTTTTTCACCAATAACTCGTTTTGGAGAACCTT
TTAGATGTTTATTACTTTCATATTTTTTCGCTGAATGTGCTCTTCTTTTG
GGTAATGTGGATCTCATCGCTCCTTTGGTTGACATATTTTTTCTGATGCT
TTACGCATTTGTCAATTTGGCATGTGCTCTTCAAAATATCCTTAATGCAC
CAAACTGGCGGCCAAGATTCAGATATTATCATTGGTTTCTTTCTTTAGTT
GGAGCAGCATTAAGTATTTTTATAATATTTGCAACTTACTGGTATTACGG
ACTTGTTACTGTTGCATTGACCTTAGCCATTTATAAATATGTTGAGTATC
GGGGAGCTGAAAAAGAATGGGGAGATGGAATCAGGGGCTTAAAATTGGCC
GGTGCCAAATATTCATTGTTAAATATCGAAGAAGAAACTCACACTAAAAA
TTGGAGACCCCAGATATTGATATTATGCAAAACTAATTCTGATTTATGTA
TAAAGTATCCTAAATTAATATCGTTTGCTGGTCAGTTAAAAGGCGGTCGA
GGATTAGTGATTTTGGCGAGTCTCGTCGAAGGAGATTATGCAGATAAAGA
TGTTCGCGATAAAGCACAGAAAGTTAAAGAAAATTTGAAAGAGTGTATGG
TAACGACAAAAGTTAAAGGATTTGTACAGACAATCGTATGTAGTGATGTT
AAGGAAGGTATTAGTACACTCATTCAATCAATTGGGTTAGGTGCACTCAA
GCCTAACACAGTCATGGTTGGTTGGCCACATACATGGAAAGGTATTTCGG
ATGAAGAAAGTCCAGAACATGAATTTTTGGATGCGATCCATCGAGTTGTA
TCGGCAGAGATTTGCATGCTCATTCCAAAAGGTGTCAGCGAATATCCAAG
CATCTCTTGTAAAGGAACCATTGACATTTGGTGGATAATGCAGGACGGGG
GGTTGCTGATGATGTTGCCAGTCCTGTTGAAAAGACACCGAGTTTGGGAG
CGCTGTGAAGTGCGAGTATTTACAGTGGCCACTCAATCAGACAACAGCAT
TCTAATGAAAGACTCCCTTGTGAAATGGTTGTATGACCTTCGAATCAAAG
CCACAGTTGAAGTTGTCGAACTGCCAAACAGTGATGCCATATCAGCATAT
TTACATCAAAAAACTTTGGTCATGGAAGAACGGGAAAAACTAATTGAACA
AATGAAATTAACCGCTAAAGAGGTAGATTTAGAACCGCAAGCCAGAATTG
ACCATCTACGTAAAGCCAGTTTAAAAGATTTTCATGTAGATCAGTCAAAA
TTAGTTGATACTCACCAGTTTACATTTAGTCCGGCTACTTTAGCTCAAAT
GAAGGATGTGCTAGAAATGAAGACAACAACTAAAAAATCAAAAAAACTCA
ATCCTGAAAATGAAGAGGCGAAAAAAATGCATAATGCCGTCGAATTGAAT
ATTCTTATCAAAGAAAAGTCATTGAATGCAGATTTGGTAATTTTAAATTT
ACCAGGACCTCCGAAAAATAAGCATTCTCTCGAATGTTATTTAAATTATT
TGGGTGTGCTTTCTGAAGGTCTCCCGAGAGTATTATTGGTCAGAGGAACT
GGCAAAGAAGTTATAACAATATATTCATAGTTTCATCTTTCTAGAATTGC
TATTTTATATTTCTGCCTCTATGCTCAATTACTTGCTCAGTAGTTTTAAT
AAACTATTTATTTAGACAAATATATAATATACTCTTTCAAAAAAA
back to top

protein sequence of SMED30022804-orf-1

>SMED30022804-orf-1 ID=SMED30022804-orf-1|Name=SMED30022804-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1065bp
MLNTNNVKDCVNNVKDSDNQNGDQNALLLNDENREHSVSFRDRHSIINDQ
KIGKLEVRKVSSGLTDNVEEGHESDDDVKDETMALYQEDYSIMNSISGYL
RAMTYQTSVAGQKKNPKLNGIIGVYLPTLQHIFGVIMFLRLYWIIGNSGF
LQGFFMVFICCLCTFLTSISMSAIATNGKVKSGGSYFMISRNLGPQFGSA
IGILFYLGNAIATAMYLVGTIEILLTYVAPTLPQFQSKPGSSHDDHTAMF
NNFRTYASGLLFLVFVIVALGVKFVQLFAPITLACVIISIVCVYLGGFVR
SPERSEMVCFLGERLLTKSFWTINKTLSCNKTMLEDYYCNGNLTTFCDDY
FKANPVQYLPAMPGYASGVIKSNLWPVYMSEGEVMPGVKGLGGRDVTRDM
MTNFFVLLAIYFPSVTGIMTGSNMSGDLKDPQKDIPRYTIAAQLTTSFVY
LSFVCIFAGTTRREVLLDKYGVSMGGGMIVAELCWPHRWVLLIGSLTSTF
GAGLQCLCSAPRLLHAIAKDDVIPFLKVFSPITRFGEPFRCLLLSYFFAE
CALLLGNVDLIAPLVDIFFLMLYAFVNLACALQNILNAPNWRPRFRYYHW
FLSLVGAALSIFIIFATYWYYGLVTVALTLAIYKYVEYRGAEKEWGDGIR
GLKLAGAKYSLLNIEEETHTKNWRPQILILCKTNSDLCIKYPKLISFAGQ
LKGGRGLVILASLVEGDYADKDVRDKAQKVKENLKECMVTTKVKGFVQTI
VCSDVKEGISTLIQSIGLGALKPNTVMVGWPHTWKGISDEESPEHEFLDA
IHRVVSAEICMLIPKGVSEYPSISCKGTIDIWWIMQDGGLLMMLPVLLKR
HRVWERCEVRVFTVATQSDNSILMKDSLVKWLYDLRIKATVEVVELPNSD
AISAYLHQKTLVMEEREKLIEQMKLTAKEVDLEPQARIDHLRKASLKDFH
VDQSKLVDTHQFTFSPATLAQMKDVLEMKTTTKKSKKLNPENEEAKKMHN
AVELNILIKEKSLNADLVILNLPGPPKNKHSLECYLNYLGVLSEGLPRVL
LVRGTGKEVITIYS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
GO:0015379potassium:chloride symporter activity
GO:0005215transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000047collecting duct
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000106ciliated epithelial cell
PLANA:0000140anterior region of the whole animal
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR030364KCC3
IPR004841AA-permease/SLC12A_dom
IPR018491SLC12_C
Vocabulary: biological process
TermDefinition
GO:0071477cellular hypotonic salinity response
GO:1902476chloride transmembrane transport
GO:0006810transport
GO:0055085transmembrane transport
GO:0006811ion transport
Vocabulary: cellular component
TermDefinition
GO:0005887integral component of plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR018491SLC12A transporter, C-terminalPFAMPF03522SLC12coord: 345..587
e-value: 7.2E-30
score: 104.4
coord: 215..336
e-value: 1.1E-15
score: 57.7
NoneNo IPR availableGENE3DG3DSA:1.20.1740.10coord: 2..175
e-value: 4.4E-15
score: 57.3
NoneNo IPR availablePANTHERPTHR11827SOLUTE CARRIER FAMILY 12, CATION COTRANSPORTERScoord: 2..586
NoneNo IPR availableTMHMMTMhelixcoord: 87..109
NoneNo IPR availableTMHMMTMhelixcoord: 122..144
NoneNo IPR availableTMHMMTMhelixcoord: 12..34
IPR004841Amino acid permease/ SLC12A domainPFAMPF00324AA_permeasecoord: 13..201
e-value: 3.9E-27
score: 95.0
IPR030364K/Cl co-transporter 3PANTHERPTHR11827:SF66SOLUTE CARRIER FAMILY 12 MEMBER 6coord: 2..586