Protein kinase

Overview
NameProtein kinase
Smed IDSMED30022787
Length (bp)1080
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase (SMED30022787) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase (SMED30022787) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase (SMED30022787) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase (SMED30022787) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022787

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30022787SMESG000039922.1 SmedASXL_001804SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30022787SMESG000039922.1 dd_Smed_v4_23655_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
glial cellSMED30022787SMESG000039922.1 dd_Smed_v6_23655_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase vs. Ensembl Human
Match: GSK3A (glycogen synthase kinase 3 alpha [Source:HGNC Symbol;Acc:HGNC:4616])

HSP 1 Score: 87.8113 bits (216), Expect = 1.536e-18
Identity = 50/148 (33.78%), Postives = 81/148 (54.73%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREK 898
            EY+PET++ +       +L +   Y+ +   QL   L Y+H     H +I P+++ VD     LK+ +F   +++    P V+ I ++ YRAPEL      Y + +DVWSAGCV+A ++L +PIF  DS    +  I  ++G P RE+
Sbjct:  114 EYVPETVYRVARHFTKAKLTIPILYVKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ 261          
BLAST of Protein kinase vs. Ensembl Human
Match: GSK3A (glycogen synthase kinase 3 alpha [Source:HGNC Symbol;Acc:HGNC:4616])

HSP 1 Score: 87.4261 bits (215), Expect = 2.616e-18
Identity = 50/148 (33.78%), Postives = 81/148 (54.73%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREK 898
            EY+PET++ +       +L +   Y+ +   QL   L Y+H     H +I P+++ VD     LK+ +F   +++    P V+ I ++ YRAPEL      Y + +DVWSAGCV+A ++L +PIF  DS    +  I  ++G P RE+
Sbjct:  196 EYVPETVYRVARHFTKAKLTIPILYVKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ 343          
BLAST of Protein kinase vs. Ensembl Human
Match: GSK3A (glycogen synthase kinase 3 alpha [Source:HGNC Symbol;Acc:HGNC:4616])

HSP 1 Score: 87.4261 bits (215), Expect = 2.616e-18
Identity = 50/148 (33.78%), Postives = 81/148 (54.73%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREK 898
            EY+PET++ +       +L +   Y+ +   QL   L Y+H     H +I P+++ VD     LK+ +F   +++    P V+ I ++ YRAPEL      Y + +DVWSAGCV+A ++L +PIF  DS    +  I  ++G P RE+
Sbjct:  196 EYVPETVYRVARHFTKAKLTIPILYVKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ 343          
BLAST of Protein kinase vs. Ensembl Human
Match: GSK3B (glycogen synthase kinase 3 beta [Source:HGNC Symbol;Acc:HGNC:4617])

HSP 1 Score: 85.5001 bits (210), Expect = 8.025e-18
Identity = 48/148 (32.43%), Postives = 80/148 (54.05%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREK 898
            +Y+PET++ +       +  L   Y+ +   QL   L Y+H     H +I P+++ +D     LK+ +F   +++    P V+ I ++ YRAPEL      Y + +DVWSAGCV+A ++L +PIF  DS    +  I  ++G P RE+
Sbjct:  133 DYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ 280          
BLAST of Protein kinase vs. Ensembl Human
Match: GSK3B (glycogen synthase kinase 3 beta [Source:HGNC Symbol;Acc:HGNC:4617])

HSP 1 Score: 85.8853 bits (211), Expect = 8.265e-18
Identity = 48/148 (32.43%), Postives = 80/148 (54.05%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREK 898
            +Y+PET++ +       +  L   Y+ +   QL   L Y+H     H +I P+++ +D     LK+ +F   +++    P V+ I ++ YRAPEL      Y + +DVWSAGCV+A ++L +PIF  DS    +  I  ++G P RE+
Sbjct:  133 DYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ 280          
BLAST of Protein kinase vs. Ensembl Celegans
Match: gsk-3 (Glycogen synthase kinase-3 [Source:UniProtKB/Swiss-Prot;Acc:Q9U2Q9])

HSP 1 Score: 83.5741 bits (205), Expect = 9.063e-18
Identity = 64/233 (27.47%), Postives = 115/233 (49.36%), Query Frame = 2
Query:  398 ITNPFLTSMKYAIPGSG------VMFILSEYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLRE--KSTNSFRND---PEVE----NNLSKIITNPYFANLLSVIFDYDYKKRITAAGVLE 1039
            + +P +  +KY    SG       + ++ EY+PET++ +      +R  +   Y+ +   QL+  L Y+H +   H +I P+++ +D     LK+ +F   + +  + P V+ I ++ YRAPEL      Y   +DVWSAG V+A ++L +PIF  DS    +  I  ++G P RE  +S N    +   P+++    N + ++ T     +L+S I +Y    R T     +
Sbjct:   84 LNHPNIVKLKYFFYSSGEKKDELYLNLILEYVPETVYRVARHYSKQRQQIPMIYVKLYMYQLLRSLAYIHSIGICHRDIKPQNLLIDPESGVLKLCDFGSAKYLVRNEPNVSYICSRYYRAPELIFGATNYTNSIDVWSAGTVMAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIQSMNPNYKEFKFPQIKAHPWNKVFRVHTPAEAIDLISKIIEYTPTSRPTPQAACQ 316          
BLAST of Protein kinase vs. Ensembl Celegans
Match: dyf-5 (Serine/threonine-protein kinase dyf-5 [Source:UniProtKB/Swiss-Prot;Acc:B3WFY8])

HSP 1 Score: 79.337 bits (194), Expect = 4.633e-16
Identity = 46/199 (23.12%), Postives = 105/199 (52.76%), Query Frame = 2
Query:  380 LNSLGFITNPFLTSMKYAIPGSGVMFILSEYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIF----KEDSIRSIFYLIGFPLREKSTNSFRNDPEVENNLSKIITNP 964
            + SL  + +P +  ++  I  + +++ + E+M E L+ +M+       +     II    Q++ GL ++H   + H ++ P +I  + TE+ +KI++F   R+I +  P    + T+ YRAPE+ L++  Y + +D+W+ GC++A + + +P+F    + D +  I  ++G P +++    ++    +     +++  P
Sbjct:   58 VKSLKKLNHPNIIKLREVIRENDILYFVFEFMQENLYELMKDRDRYFPESVIRNIIY---QVLQGLAFMHKNGFFHRDMKPENIMCNGTEL-VKIADFGLAREIRSKPPYTDYVSTRWYRAPEILLRSTSYNSPIDMWALGCIMAELYILRPLFPGTSEMDQLFKIISILGTPNKDEWPEGYQLASAMNFRFQQVVATP 252          
BLAST of Protein kinase vs. Ensembl Celegans
Match: dyf-5 (Serine/threonine-protein kinase dyf-5 [Source:UniProtKB/Swiss-Prot;Acc:B3WFY8])

HSP 1 Score: 78.9518 bits (193), Expect = 7.250e-16
Identity = 46/199 (23.12%), Postives = 105/199 (52.76%), Query Frame = 2
Query:  380 LNSLGFITNPFLTSMKYAIPGSGVMFILSEYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIF----KEDSIRSIFYLIGFPLREKSTNSFRNDPEVENNLSKIITNP 964
            + SL  + +P +  ++  I  + +++ + E+M E L+ +M+       +     II    Q++ GL ++H   + H ++ P +I  + TE+ +KI++F   R+I +  P    + T+ YRAPE+ L++  Y + +D+W+ GC++A + + +P+F    + D +  I  ++G P +++    ++    +     +++  P
Sbjct:   58 VKSLKKLNHPNIIKLREVIRENDILYFVFEFMQENLYELMKDRDRYFPESVIRNIIY---QVLQGLAFMHKNGFFHRDMKPENIMCNGTEL-VKIADFGLAREIRSKPPYTDYVSTRWYRAPEILLRSTSYNSPIDMWALGCIMAELYILRPLFPGTSEMDQLFKIISILGTPNKDEWPEGYQLASAMNFRFQQVVATP 252          
BLAST of Protein kinase vs. Ensembl Celegans
Match: C44H4.6 (pep chromosome:WBcel235:X:14596476:14599158:-1 gene:WBGene00008095.1 transcript:C44H4.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C44H4.6)

HSP 1 Score: 73.9442 bits (180), Expect = 1.981e-14
Identity = 40/116 (34.48%), Postives = 63/116 (54.31%), Query Frame = 2
Query:  560 QLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDSIRSIFYL----IGFPLRE 895
            QL+ G+ +LH  +  H +I P+++ VD +   LKI +F   +++  + P +T I ++ YRAPEL   +  Y T +D WS G V+  ++   PIF  DS   I  L     G P +E
Sbjct:  141 QLLRGIGFLHLHNIVHRDIKPKNLLVDESNGILKICDFGSAKRLEKNEPNITYICSRYYRAPELIFGSKNYDTSIDTWSVGTVVGELLHNSPIFLADSAVDILALQIKAFGTPSKE 256          
BLAST of Protein kinase vs. Ensembl Celegans
Match: pmk-1 (Mitogen-activated protein kinase pmk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17446])

HSP 1 Score: 73.559 bits (179), Expect = 2.613e-14
Identity = 52/175 (29.71%), Postives = 84/175 (48.00%), Query Frame = 2
Query:  560 QLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKE----DSIRSIFYLIGFPLR--------EKSTNSFRNDPEVENNLSKII---TNPYFANLLSVIFDYDYKKRITAAGVLE 1039
            Q++ GLKY+H  D  H ++ P +I V+  +  LKI +F   R+  +++     + T+ YRAPE+ L    Y   +DVWS GC++A +I  K +F      D +  I  + G P          E++ N  RN P++     K +     P   +LL  +   D  +R TA   +E
Sbjct:  144 QILRGLKYIHSADIIHRDLKPSNIAVN-EDCELKILDFGLARQTDSEM--TGYVATRWYRAPEIMLNWMHYTQTVDVWSVGCILAELITGKTLFPGSDHIDQLTRIMSVTGTPDEEFLKKISSEEARNYIRNLPKMTRRDFKRLFAQATPQAIDLLEKMLHLDPDRRPTAKEAME 315          
BLAST of Protein kinase vs. Ensembl Fly
Match: Pk34A (gene:FBgn0028410 transcript:FBtr0080432)

HSP 1 Score: 90.1225 bits (222), Expect = 1.018e-19
Identity = 76/291 (26.12%), Postives = 137/291 (47.08%), Query Frame = 2
Query:  179 LSQHEPGKFVTKSVYLLPEIKVVQIGICYVNKNSFCHIKESKSVNYPKNSIATKMNMM--KVNMTETKILNSL----GFITNPFLTSMKYAIPGSGVMFILSEYMPETLFNMMEXXXXXXX-XXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIF---KED--SIRSIFYLIGFPLREKSTNSFRNDPEV----ENNLSKIITNPYFANLLSVIFDYD 1003
            +S +  G+  ++   +  E+K + IG     +    H+ ES+ +      +A K  +   K++  E +I+  L      +     +S+    P    + ++ EYMP TL + +           +   + ILS Q+  GL YLH L  +H ++ P ++ +D  ++ LK+S+F   + +    P+++ I ++LYRAPELF    +Y   +D+WSAGCV+A ++   P+F   K D   +R I  ++G       T+     PE+     N+L    T P +  LL+     D
Sbjct:   27 ISTYAVGRLCSEPALVRIEVKDL-IGSGSFGRVYQAHVNESEEI------VAVKQTLYNPKLSQGEAEIMGQLKDHNNIVRLIMHSSVSLGFPSVDYVLLVMEYMPMTLLDYINYHLTVLQPAERLINVRILSYQMFRGLGYLHLLGISHRDVKPENLLIDNQKMVLKLSDFGSAKLLVPQEPSISYICSRLYRAPELFAGYELYSCAVDIWSAGCVLAELLKGYPLFSSHKHDRKQLRLIVNMLG-------TDGLERAPEILSKCGNSLHPRTTRPSWNYLLNTAVPQD 303          
BLAST of Protein kinase vs. Ensembl Fly
Match: sgg (gene:FBgn0003371 transcript:FBtr0331752)

HSP 1 Score: 91.2781 bits (225), Expect = 1.080e-19
Identity = 60/198 (30.30%), Postives = 101/198 (51.01%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREKSTNSFRNDPEVE---------NNLSKIITNPYFANLLSVIFDYDYKKRIT 1021
            EY+PET++ +  +    +  +  ++I +   QL   L Y+H L   H +I P+++ +D     LK+ +F   +++    P V+ I ++ YRAPEL      Y T +DVWSAGCV+A ++L +PIF  DS    +  +  ++G P RE+      N  E +           + +I T     NL+S++ +Y    RIT
Sbjct:  724 EYIPETVYKVARQYAKTKQTIPINFIRLYMYQLFRSLAYIHSLGICHRDIKPQNLLLDPETAVLKLCDFGSAKQLLHGEPNVSYICSRYYRAPELIFGAINYTTKIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEVIKVLGTPTREQIREMNPNYTEFKFPQIKSHPWQKVFRIRTPTEAINLVSLLLEYTPSARIT 921          
BLAST of Protein kinase vs. Ensembl Fly
Match: sgg (gene:FBgn0003371 transcript:FBtr0070476)

HSP 1 Score: 89.7373 bits (221), Expect = 1.345e-19
Identity = 60/198 (30.30%), Postives = 105/198 (53.03%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREKSTNSFRND-----PEVENN----LSKIITNPYFANLLSVIFDYDYKKRIT 1021
            EY+PET++ +  +    +  +  ++I +   QL   L Y+H L   H +I P+++ +D     LK+ +F   +++    P V+ I ++ YRAPEL      Y T +DVWSAGCV+A ++L +PIF  DS    +  +  ++G P RE+      N      P+++++    + +I T     NL+S++ +Y    RIT
Sbjct:   33 EYIPETVYKVARQYAKTKQTIPINFIRLYMYQLFRSLAYIHSLGICHRDIKPQNLLLDPETAVLKLCDFGSAKQLLHGEPNVSYICSRYYRAPELIFGAINYTTKIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEVIKVLGTPTREQIREMNPNYTEFKFPQIKSHPWQKVFRIRTPTEAINLVSLLLEYTPSARIT 230          
BLAST of Protein kinase vs. Ensembl Fly
Match: sgg (gene:FBgn0003371 transcript:FBtr0301966)

HSP 1 Score: 89.7373 bits (221), Expect = 1.345e-19
Identity = 60/198 (30.30%), Postives = 105/198 (53.03%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREKSTNSFRND-----PEVENN----LSKIITNPYFANLLSVIFDYDYKKRIT 1021
            EY+PET++ +  +    +  +  ++I +   QL   L Y+H L   H +I P+++ +D     LK+ +F   +++    P V+ I ++ YRAPEL      Y T +DVWSAGCV+A ++L +PIF  DS    +  +  ++G P RE+      N      P+++++    + +I T     NL+S++ +Y    RIT
Sbjct:   33 EYIPETVYKVARQYAKTKQTIPINFIRLYMYQLFRSLAYIHSLGICHRDIKPQNLLLDPETAVLKLCDFGSAKQLLHGEPNVSYICSRYYRAPELIFGAINYTTKIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEVIKVLGTPTREQIREMNPNYTEFKFPQIKSHPWQKVFRIRTPTEAINLVSLLLEYTPSARIT 230          
BLAST of Protein kinase vs. Ensembl Fly
Match: sgg (gene:FBgn0003371 transcript:FBtr0302185)

HSP 1 Score: 90.1225 bits (222), Expect = 1.488e-19
Identity = 60/198 (30.30%), Postives = 105/198 (53.03%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREKSTNSFRND-----PEVENN----LSKIITNPYFANLLSVIFDYDYKKRIT 1021
            EY+PET++ +  +    +  +  ++I +   QL   L Y+H L   H +I P+++ +D     LK+ +F   +++    P V+ I ++ YRAPEL      Y T +DVWSAGCV+A ++L +PIF  DS    +  +  ++G P RE+      N      P+++++    + +I T     NL+S++ +Y    RIT
Sbjct:   33 EYIPETVYKVARQYAKTKQTIPINFIRLYMYQLFRSLAYIHSLGICHRDIKPQNLLLDPETAVLKLCDFGSAKQLLHGEPNVSYICSRYYRAPELIFGAINYTTKIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEVIKVLGTPTREQIREMNPNYTEFKFPQIKSHPWQKVFRIRTPTEAINLVSLLLEYTPSARIT 230          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: gsk3ba (glycogen synthase kinase 3 beta, genome duplicate a [Source:ZFIN;Acc:ZDB-GENE-990714-4])

HSP 1 Score: 85.8853 bits (211), Expect = 4.137e-18
Identity = 48/148 (32.43%), Postives = 80/148 (54.05%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREK 898
            +Y+PET++ +       +  L   Y+ +   QL   L Y+H     H +I P+++ +D     LK+ +F   +++    P V+ I ++ YRAPEL      Y + +DVWSAGCV+A ++L +PIF  DS    +  I  ++G P RE+
Sbjct:  133 DYVPETVYRVARHYSRAKQTLPMVYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ 280          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: gsk3aa (glycogen synthase kinase 3 alpha a [Source:ZFIN;Acc:ZDB-GENE-060503-796])

HSP 1 Score: 84.3445 bits (207), Expect = 1.492e-17
Identity = 47/148 (31.76%), Postives = 80/148 (54.05%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREK 898
            +Y+PET++ +       +  +   Y+ +   QL   L Y+H     H +I P+++ VD     LK+ +F   +++    P V+ I ++ YRAPEL      Y + +D+WSAGCV+A ++L +PIF  DS    +  I  ++G P RE+
Sbjct:  187 DYVPETVYRVARHFSKAKTIIPIFYVKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPETAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSNIDIWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ 334          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: gsk3ab (glycogen synthase kinase 3 alpha b [Source:ZFIN;Acc:ZDB-GENE-990714-3])

HSP 1 Score: 83.1889 bits (204), Expect = 4.215e-17
Identity = 46/148 (31.08%), Postives = 80/148 (54.05%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREK 898
            +++PET++ +       +  +   Y+ +   QL   L Y+H     H +I P+++ VD     LK+ +F   +++    P V+ I ++ YRAPEL      Y + +D+WSAGCV+A ++L +PIF  DS    +  I  ++G P RE+
Sbjct:  160 DFVPETVYRVARHFNKSKTTIPIIYVKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSNIDIWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ 307          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: gsk3bb (glycogen synthase kinase 3 beta, genome duplicate b [Source:ZFIN;Acc:ZDB-GENE-090312-2])

HSP 1 Score: 82.8037 bits (203), Expect = 4.617e-17
Identity = 46/151 (30.46%), Postives = 82/151 (54.30%), Query Frame = 2
Query:  458 ILSEYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREK 898
            ++ +Y+PE ++ +       + +L   Y+ +   QL   L Y+H     H +I P+++ +D     LK+ +F   +++    P V+ I ++ YRAPEL      Y + +D+WSAGCV+A ++L +PIF  DS    +  I  ++G P RE+
Sbjct:  130 LVMDYVPENVYRVARHYSKAKQNLPMVYVKLYMYQLFRSLAYIHSYGICHRDIKPQNLLLDPETAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDIWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ 280          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: mak (male germ cell-associated kinase [Source:ZFIN;Acc:ZDB-GENE-030131-7279])

HSP 1 Score: 78.9518 bits (193), Expect = 1.427e-15
Identity = 63/242 (26.03%), Postives = 120/242 (49.59%), Query Frame = 2
Query:  356 VNMTETKILNSLGFITNPFLTSMKYAIPGSGVMFILSEYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIF----KEDSIRSIFYLIG------FPLREK--STNSFRNDPEVENNLSKIITNP--YFANLLSVIFDYDYKKRITAAGVLE 1039
            +N+ E K L  L       +  +K  I  +  ++ + EYM E L+ +M+  + K     +   I+   Q++SGL ++H   + H ++ P ++     E+ +KI++F   R+I +  P    + T+ YRAPE+ L++P+Y + +D+W+ GC++A +   +P+F    + D I  I  ++G      +P   +  S  +FR    V   L  +I N      +++  +  +D KKR +A   L 
Sbjct:   46 MNLREVKSLKKLNHAN---VVKLKEVIRENDHLYFVFEYMKENLYQLMKDRENKMFTENEIRNIMF--QVLSGLAFVHKHGFFHRDMKPENLLCMGPEL-VKIADFGLAREIRSRPPYTDYVSTRWYRAPEVLLRSPVYSSPIDIWAVGCIMAELYTLRPLFPGNSEVDEIFKICQVLGTVKKSDWPEGHQLASAMNFRFPQCVPTPLKTLIPNATNEALDIMRDLLQWDPKKRPSAVKALR 281          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: GSK3B (glycogen synthase kinase 3 beta [Source:NCBI gene;Acc:100489648])

HSP 1 Score: 85.8853 bits (211), Expect = 4.939e-18
Identity = 48/148 (32.43%), Postives = 80/148 (54.05%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREK 898
            +Y+PET++ +       +  L   Y+ +   QL   L Y+H     H +I P+++ +D     LK+ +F   +++    P V+ I ++ YRAPEL      Y + +DVWSAGCV+A ++L +PIF  DS    +  I  ++G P RE+
Sbjct:  112 DYVPETVYRVARHYSRAKQALPMIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPETAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ 259          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: GSK3B (glycogen synthase kinase 3 beta [Source:NCBI gene;Acc:100489648])

HSP 1 Score: 86.2705 bits (212), Expect = 5.243e-18
Identity = 48/148 (32.43%), Postives = 80/148 (54.05%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREK 898
            +Y+PET++ +       +  L   Y+ +   QL   L Y+H     H +I P+++ +D     LK+ +F   +++    P V+ I ++ YRAPEL      Y + +DVWSAGCV+A ++L +PIF  DS    +  I  ++G P RE+
Sbjct:  133 DYVPETVYRVARHYSRAKQALPMIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPETAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ 280          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: GSK3B (glycogen synthase kinase 3 beta [Source:NCBI gene;Acc:100489648])

HSP 1 Score: 85.8853 bits (211), Expect = 5.528e-18
Identity = 48/148 (32.43%), Postives = 80/148 (54.05%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREK 898
            +Y+PET++ +       +  L   Y+ +   QL   L Y+H     H +I P+++ +D     LK+ +F   +++    P V+ I ++ YRAPEL      Y + +DVWSAGCV+A ++L +PIF  DS    +  I  ++G P RE+
Sbjct:  133 DYVPETVYRVARHYSRAKQALPMIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPETAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ 280          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: GSK3B (glycogen synthase kinase 3 beta [Source:NCBI gene;Acc:100489648])

HSP 1 Score: 85.8853 bits (211), Expect = 6.536e-18
Identity = 48/148 (32.43%), Postives = 80/148 (54.05%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREK 898
            +Y+PET++ +       +  L   Y+ +   QL   L Y+H     H +I P+++ +D     LK+ +F   +++    P V+ I ++ YRAPEL      Y + +DVWSAGCV+A ++L +PIF  DS    +  I  ++G P RE+
Sbjct:  133 DYVPETVYRVARHYSRAKQALPMIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPETAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ 280          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: GSK3B (glycogen synthase kinase 3 beta [Source:NCBI gene;Acc:100489648])

HSP 1 Score: 85.8853 bits (211), Expect = 6.986e-18
Identity = 48/148 (32.43%), Postives = 80/148 (54.05%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREK 898
            +Y+PET++ +       +  L   Y+ +   QL   L Y+H     H +I P+++ +D     LK+ +F   +++    P V+ I ++ YRAPEL      Y + +DVWSAGCV+A ++L +PIF  DS    +  I  ++G P RE+
Sbjct:  112 DYVPETVYRVARHYSRAKQALPMIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPETAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ 259          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Gsk3a (glycogen synthase kinase 3 alpha [Source:MGI Symbol;Acc:MGI:2152453])

HSP 1 Score: 87.4261 bits (215), Expect = 2.170e-18
Identity = 51/148 (34.46%), Postives = 80/148 (54.05%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREK 898
            EY+PET++ +       +L     YI +   QL   L Y+H     H +I P+++ VD     LK+ +F   +++    P V+ I ++ YRAPEL      Y + +DVWSAGCV+A ++L +PIF  DS    +  I  ++G P RE+
Sbjct:  196 EYVPETVYRVARHFTKAKLITPIIYIKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ 343          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Gsk3a (glycogen synthase kinase 3 alpha [Source:MGI Symbol;Acc:MGI:2152453])

HSP 1 Score: 87.0409 bits (214), Expect = 2.418e-18
Identity = 51/148 (34.46%), Postives = 80/148 (54.05%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREK 898
            EY+PET++ +       +L     YI +   QL   L Y+H     H +I P+++ VD     LK+ +F   +++    P V+ I ++ YRAPEL      Y + +DVWSAGCV+A ++L +PIF  DS    +  I  ++G P RE+
Sbjct:  196 EYVPETVYRVARHFTKAKLITPIIYIKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ 343          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Gsk3b (glycogen synthase kinase 3 beta [Source:MGI Symbol;Acc:MGI:1861437])

HSP 1 Score: 85.5001 bits (210), Expect = 6.051e-18
Identity = 48/148 (32.43%), Postives = 80/148 (54.05%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREK 898
            +Y+PET++ +       +  L   Y+ +   QL   L Y+H     H +I P+++ +D     LK+ +F   +++    P V+ I ++ YRAPEL      Y + +DVWSAGCV+A ++L +PIF  DS    +  I  ++G P RE+
Sbjct:  133 DYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ 280          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Gsk3b (glycogen synthase kinase 3 beta [Source:MGI Symbol;Acc:MGI:1861437])

HSP 1 Score: 85.5001 bits (210), Expect = 7.101e-18
Identity = 48/148 (32.43%), Postives = 80/148 (54.05%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREK 898
            +Y+PET++ +       +  L   Y+ +   QL   L Y+H     H +I P+++ +D     LK+ +F   +++    P V+ I ++ YRAPEL      Y + +DVWSAGCV+A ++L +PIF  DS    +  I  ++G P RE+
Sbjct:  133 DYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ 280          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Mapk12 (mitogen-activated protein kinase 12 [Source:MGI Symbol;Acc:MGI:1353438])

HSP 1 Score: 81.2629 bits (199), Expect = 1.310e-16
Identity = 56/174 (32.18%), Postives = 89/174 (51.15%), Query Frame = 2
Query:  560 QLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKE----DSIRSIFYLIGFPLRE--------KSTNSFRNDPEVE-NNLSKIITN--PYFANLLSVIFDYDYKKRITAAGVL 1036
            Q++ GLKY+H     H ++ P ++ V+  +  LKI +F   R+  AD      + T+ YRAPE+ L    Y   +D+WS GC++A MI  K +FK     D ++ I  + G P  E        ++ N     PE+E  + + ++TN  P   NLL  +   D ++R+TAA  L
Sbjct:  136 QMLKGLKYIHAAGVIHRDLKPGNLAVN-EDCELKILDFGLARQ--ADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKILFKGNDHLDQLKEIMKITGTPPPEFVQKLQSAEAKNYMEGLPELEKKDFASVLTNASPQAVNLLERMLVLDAEQRVTAAEAL 306          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q388M1|GSK3B_TRYB2 (Glycogen synthase kinase 3 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=GSK3 PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 3.798e-19
Identity = 67/245 (27.35%), Postives = 112/245 (45.71%), Query Frame = 2
Query:  368 ETKILNSLGFITNPFLTSMK---YAIPGSG-----VMFILSEYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLH--DLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIF----KEDSIRSIFYLIGFPLREKSTNSFRNDPEVENN-----LSKIITNPYFA---NLLSVIFDYDYKKRITAAGVL 1036
            E +I+  L  + +P +  +K   Y + G G      + ++ E++PETL         +  +     + +   QL+  +  LH   ++  H +I P ++ VD     LK+ +F   +++ AD P V  I ++ YRAPEL   N  Y T +D+WS GC+ A M+L +PIF        +R I  ++G P +E+      +  E+  N        +   P  A   +L   IF Y   +RIT    L
Sbjct:   61 ELQIMQHLARLRHPNIVMLKNYFYTVGGEGRRNDVYLNVVMEFVPETLHRTCRNYYRRMTNPPLILVKVFMFQLLRSIACLHIPVINICHRDIKPHNVLVDEQTGELKLCDFGSAKRLAADEPNVAYICSRYYRAPELIFGNQFYTTAVDIWSVGCIFAEMLLGEPIFCGENTSGQLREIVKILGKPTKEELHKLNGSSTEINANAKATPWENVFKQPLPAEVYDLCGKIFKYVPDQRITPLDAL 305          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|P18431|SGG_DROME (Protein kinase shaggy OS=Drosophila melanogaster OX=7227 GN=sgg PE=1 SV=3)

HSP 1 Score: 90.1225 bits (222), Expect = 1.770e-18
Identity = 60/198 (30.30%), Postives = 105/198 (53.03%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREKSTNSFRND-----PEVENN----LSKIITNPYFANLLSVIFDYDYKKRIT 1021
            EY+PET++ +  +    +  +  ++I +   QL   L Y+H L   H +I P+++ +D     LK+ +F   +++    P V+ I ++ YRAPEL      Y T +DVWSAGCV+A ++L +PIF  DS    +  +  ++G P RE+      N      P+++++    + +I T     NL+S++ +Y    RIT
Sbjct:  131 EYIPETVYKVARQYAKTKQTIPINFIRLYMYQLFRSLAYIHSLGICHRDIKPQNLLLDPETAVLKLCDFGSAKQLLHGEPNVSYICSRYYRAPELIFGAINYTTKIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEVIKVLGTPTREQIREMNPNYTEFKFPQIKSHPWQKVFRIRTPTEAINLVSLLLEYTPSARIT 328          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|P23111|CDC2_MAIZE (Cell division control protein 2 homolog OS=Zea mays OX=4577 GN=CDC2 PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 3.230e-18
Identity = 58/175 (33.14%), Postives = 90/175 (51.43%), Query Frame = 2
Query:  560 QLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVT-SIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREKSTNSFRNDPEVE--------NNLSKIITN--PYFANLLSVIFDYDYKKRITAAGVLE 1039
            Q++ G+ Y H     H ++ P+++ +D     LK+++F   R  G  + T T  + T  YRAPE+ L    Y T +DVWS GC+ A M+ QKP+F  DS    +  IF ++G P  E+S       P+ +         +L+ ++ N  P   +LLS +  Y+  KRITA   LE
Sbjct:  110 QILHGVAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGARQYSTPVDVWSVGCIFAEMVNQKPLFPGDSEIDELFKIFRILGTP-NEQSWPGVSCLPDFKTAFPRWQAQDLATVVPNLDPAGLDLLSKMLRYEPSKRITARQALE 283          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|P29618|CDKA1_ORYSJ (Cyclin-dependent kinase A-1 OS=Oryza sativa subsp. japonica OX=39947 GN=CDKA-1 PE=1 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 5.478e-18
Identity = 57/175 (32.57%), Postives = 93/175 (53.14%), Query Frame = 2
Query:  560 QLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVT-SIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREKSTNSFRNDPEVEN--------NLSKIIT--NPYFANLLSVIFDYDYKKRITAAGVLE 1039
            Q++ G+ Y H     H ++ P+++ +D     LK+++F   R  G  + T T  + T  YRAPE+ L +  Y T +D+WS GC+ A M+ QKP+F  DS    +  IF ++G P  E+S     + P+ ++        +L+ I+   +P   +LLS +  Y+  KRITA   LE
Sbjct:  110 QILRGVAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRQYSTPVDMWSVGCIFAEMVNQKPLFPGDSEIDELFKIFRVLGTP-NEQSWPGVSSLPDYKSAFPKWQAQDLATIVPTLDPAGLDLLSKMLRYEPNKRITARQALE 283          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|P93101|CDC2_OXYRB (Cell division control protein 2 homolog OS=Oxybasis rubra OX=3560 GN=CDC2 PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 8.418e-18
Identity = 59/174 (33.91%), Postives = 91/174 (52.30%), Query Frame = 2
Query:  560 QLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVT-SIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLRE-----KSTNSFRND-PE-VENNLSKIITN--PYFANLLSVIFDYDYKKRITAAGVLE 1039
            Q++ G+ Y H     H ++ P+++ +D     LK+++F   R  G  + T T  + T  YRAPE+ L +  Y T +DVWS GC+ A M+ QKP+F  DS    +  IF  +G P  E      S   F++  P+ +  +LS ++ N  P   +LL+ +   D  KRITA   LE
Sbjct:  110 QILRGIAYCHSHRVLHRDLKPQNLLIDRQTNALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQKPLFPGDSEIDELFKIFRTLGTPNEETWPGVTSLPDFKSSFPKWISKDLSAVVPNLDPAGIDLLNKMLCLDPSKRITARNALE 283          
BLAST of Protein kinase vs. TrEMBL
Match: A0A078AEL1 (Protein kinase domain-containing protein OS=Stylonychia lemnae OX=5949 GN=Contig11525.g585 PE=3 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 3.912e-20
Identity = 57/185 (30.81%), Postives = 98/185 (52.97%), Query Frame = 2
Query:  380 LNSLGFITNPFLTSMKYAI------PGSGVMFILSEYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKE----DSIRSIFYLIGFPLREKST 904
            L  L  + +PF   M++        P    + ++ +Y+PET++ +M+     +  +    + + + QLM  + Y+H L   H +I P+++ VD +   LK+ +F   +++ A  P V+ I ++ YRAPEL   N  Y   +DVWS GCVIA ++L +PIF      D +  I  ++G P RE+ T
Sbjct:   61 LQILKMLHHPFCVEMRHYFYTNGDKPDEVYLNVVMDYIPETIYKIMKSYLKMKQMVPPLLVKLYAYQLMRSIAYIHALGICHRDIKPQNVLVDPSSHVLKLCDFGSAKQLVAGEPNVSYICSRYYRAPELIFGNSDYNCIIDVWSVGCVIAELLLGQPIFPGESGVDQLVEIIKILGTPSREQIT 245          
BLAST of Protein kinase vs. TrEMBL
Match: J9IEF3 (Glycogen synthase kinase 3 beta protein OS=Oxytricha trifallax OX=1172189 GN=OXYTRI_23761 PE=3 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 5.366e-20
Identity = 57/185 (30.81%), Postives = 98/185 (52.97%), Query Frame = 2
Query:  380 LNSLGFITNPFLTSMKYAI------PGSGVMFILSEYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKE----DSIRSIFYLIGFPLREKST 904
            L  L  + +PF   M++        P    + ++ +Y+PET++ +M+     +  +    + + + QLM  + Y+H L   H +I P+++ VD +   LK+ +F   +++ A  P V+ I ++ YRAPEL   N  Y   +DVWS GCVIA ++L +PIF      D +  I  ++G P RE+ T
Sbjct:   65 LQILKMLHHPFCVEMRHYFYTNGDKPEEVYLNVVMDYIPETIYKIMKYYLKMKQMVPPLLVKLYAYQLMRSIAYIHALGICHRDIKPQNVLVDPSSHVLKMCDFGSAKQLVAGEPNVSYICSRYYRAPELIFGNSDYNCIIDVWSVGCVIAELLLGQPIFPGESGVDQLVEIIKILGTPTREQIT 249          
BLAST of Protein kinase vs. TrEMBL
Match: A0A510P6V5 (Hypothetical_protein OS=Candida auris OX=498019 GN=CAJCM15448_32000 PE=3 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 1.417e-19
Identity = 79/288 (27.43%), Postives = 142/288 (49.31%), Query Frame = 2
Query:  242 VVQIGICYVNKNSFCHIKESKSVNYPKNSIATKMNMMKVNMTETKILNSL---GFITNPFLTSMKYAIPGSGVMFILSEYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFK----EDSIRSIFYLIGFPLREKSTNSFRNDPEVENNL--SKI--------------ITNPYFANLLSVIFDYDYKKRITAAGVL 1036
            VV+  + YVN +   H ++ K   +   +I   +   +    E +IL ++     +T  F    +  + G     ++ E +P  L N ++  +  +  +   ++   + QL   + YLH L+ +H +I P +I VD + VRLKI +F   +++  + P+V+ I ++ YRAPEL +   +Y T +D+W  GCVIA M L KPIF+    E  ++ I  L+G P +   T  F+++P+   N+  +K+              ++ P   +LL  I  YD + R + + VL
Sbjct:   43 VVEACLSYVNDDG--HPQDEKLGPF---AIKRVLAQTEYKCRELEILRTVKHPNIVTLRFFFDKRSKLDGKMYQNLVMECLPSNLQNEIKYYRQSKYTIPYPHMKAYTFQLTRAMLYLHSLNISHRDIKPSNILVDPSTVRLKICDFGSAKQLEPNQPSVSYICSRYYRAPELIVGCTVYTTKIDIWGLGCVIAEMFLGKPIFQGQSSESQLKEISKLLGPPPK---TFFFKSNPQYRGNMFSTKLFSCSVQERFEQIFSMSPPDVIDLLLKILVYDPEFRASPSAVL 322          
BLAST of Protein kinase vs. TrEMBL
Match: A0A5C1DUE9 (Protein kinase domain-containing protein OS=Candida auris OX=498019 GN=CJJ09_002517 PE=3 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 3.846e-19
Identity = 69/241 (28.63%), Postives = 124/241 (51.45%), Query Frame = 2
Query:  242 VVQIGICYVNKNSFCHIKESKSVNYPKNSIATKMNMMKVNMTETKILNSL---GFITNPFLTSMKYAIPGSGVMFILSEYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREKSTNSFRNDPEVENNL 943
            VV+  + YVN +   H ++ K   +   +I   +   +    E +IL ++     +T  F    +  + G     ++ E +P  L N ++  +  +  +   ++   + QL   + YLH L+ +H +I P +I VD + VRLKI +F   +++  + P+V+ I ++ YRAPEL +   +Y T +D+W  GCVIA M L KPIF+  S    ++ I  L+G P +   T  F+++P+   N+
Sbjct:   43 VVEACLSYVNDDG--HPQDEKLGPF---AIKRVLAQTEYKCRELEILRTVKHPNIVTLRFFFDKRSKLDGKMYQNLVMECLPSNLQNEIKYYRQSKYTIPYPHMKAYTFQLTRAMLYLHSLNISHRDIKPSNILVDPSTVRLKICDFGSAKQLEPNQPSVSYICSRYYRAPELIVGCTVYTTKIDIWGLGCVIAEMFLGKPIFQGQSSELQLKEISKLLGPPPK---TFFFKSNPQYRGNM 275          
BLAST of Protein kinase vs. TrEMBL
Match: A0A2H1A4X2 (Protein kinase domain-containing protein OS=Candida auris OX=498019 GN=B9J08_000552 PE=3 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 4.039e-19
Identity = 69/241 (28.63%), Postives = 124/241 (51.45%), Query Frame = 2
Query:  242 VVQIGICYVNKNSFCHIKESKSVNYPKNSIATKMNMMKVNMTETKILNSL---GFITNPFLTSMKYAIPGSGVMFILSEYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREKSTNSFRNDPEVENNL 943
            VV+  + YVN +   H ++ K   +   +I   +   +    E +IL ++     +T  F    +  + G     ++ E +P  L N ++  +  +  +   ++   + QL   + YLH L+ +H +I P +I VD + VRLKI +F   +++  + P+V+ I ++ YRAPEL +   +Y T +D+W  GCVIA M L KPIF+  S    ++ I  L+G P +   T  F+++P+   N+
Sbjct:   43 VVEACLSYVNDDG--HPQDEKLGPF---AIKRVLAQTEYKCRELEILRTVKHPNIVTLRFFFDKRSKLDGKMYQNLVMECLPSNLQNEIKYYRQSKYTIPYPHMKAYTFQLTRAMLYLHSLNISHRDIKPSNILVDPSTVRLKICDFGSAKQLEPNQPSVSYICSRYYRAPELIVGCTVYTTKIDIWGLGCVIAEMFLGKPIFQGQSSELQLKEISKLLGPPPK---TFFFKSNPQYRGNM 275          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: gsk3ba (glycogen synthase kinase 3 beta [Source:NCBI gene;Acc:103021870])

HSP 1 Score: 85.8853 bits (211), Expect = 3.674e-18
Identity = 48/148 (32.43%), Postives = 80/148 (54.05%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREK 898
            +Y+PET++ +       +  L   Y+ +   QL   L Y+H     H +I P+++ +D     LK+ +F   +++    P V+ I ++ YRAPEL      Y + +DVWSAGCV+A ++L +PIF  DS    +  I  ++G P RE+
Sbjct:  133 DYVPETVYRVARHYSRAKQTLPMVYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPETAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ 280          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: gsk3ba (glycogen synthase kinase 3 beta [Source:NCBI gene;Acc:103021870])

HSP 1 Score: 85.5001 bits (210), Expect = 4.195e-18
Identity = 48/148 (32.43%), Postives = 80/148 (54.05%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREK 898
            +Y+PET++ +       +  L   Y+ +   QL   L Y+H     H +I P+++ +D     LK+ +F   +++    P V+ I ++ YRAPEL      Y + +DVWSAGCV+A ++L +PIF  DS    +  I  ++G P RE+
Sbjct:  133 DYVPETVYRVARHYSRAKQTLPMVYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPETAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ 280          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: ENSAMXT00000005621.2 (glycogen synthase kinase-3 beta-like [Source:NCBI gene;Acc:103043574])

HSP 1 Score: 84.7297 bits (208), Expect = 7.219e-18
Identity = 48/148 (32.43%), Postives = 80/148 (54.05%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREK 898
            +Y+PET++ +       +  L   Y+ +   QL   L Y+H     H +I P+++ +D     LK+ +F   +++    P V+ I ++ YRAPEL      Y + +DVWSAGCV+A ++L +PIF  DS    +  I  ++G P RE+
Sbjct:  115 DYVPETVYRVSRHYSRAKQILPMLYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPETAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ 262          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: gsk3ab (glycogen synthase kinase 3 alpha [Source:NCBI gene;Acc:103036469])

HSP 1 Score: 85.1149 bits (209), Expect = 7.838e-18
Identity = 47/148 (31.76%), Postives = 80/148 (54.05%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREK 898
            +Y+PET++ +       +  +   Y+ +   QL   L Y+H     H +I P+++ VD     LK+ +F   +++    P V+ I ++ YRAPEL      Y + +D+WSAGCV+A ++L +PIF  DS    +  I  ++G P RE+
Sbjct:  160 DYVPETVYRVARHFNKAKTTIPIIYVKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSNIDIWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ 307          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: ENSAMXT00000036323.1 (glycogen synthase kinase-3 beta-like [Source:NCBI gene;Acc:103043574])

HSP 1 Score: 84.7297 bits (208), Expect = 8.495e-18
Identity = 48/148 (32.43%), Postives = 80/148 (54.05%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREK 898
            +Y+PET++ +       +  L   Y+ +   QL   L Y+H     H +I P+++ +D     LK+ +F   +++    P V+ I ++ YRAPEL      Y + +DVWSAGCV+A ++L +PIF  DS    +  I  ++G P RE+
Sbjct:  132 DYVPETVYRVSRHYSRAKQILPMLYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPETAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ 279          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: cdk4 (cyclin-dependent kinase 4 [Source:ZFIN;Acc:ZDB-GENE-060929-974])

HSP 1 Score: 71.633 bits (174), Expect = 2.431e-14
Identity = 39/116 (33.62%), Postives = 67/116 (57.76%), Query Frame = 2
Query:  560 QLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKE----DSIRSIFYLIGFPLRE 895
            QL+SGL +LH     H ++ P++I V  ++ ++K+++F   R     +   + + T  YRAPE+ L++  Y T +D+WS GC+ A M  ++P+F      D +  IF L+G P R+
Sbjct:  130 QLLSGLDFLHTHRVVHRDLKPQNILV-TSDGQVKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSS-YATTVDLWSVGCIFAEMFRRRPLFCGSSDFDQLTKIFDLLGLPNRD 243          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: mak (male germ cell-associated kinase [Source:ZFIN;Acc:ZDB-GENE-030131-7279])

HSP 1 Score: 72.0182 bits (175), Expect = 4.810e-14
Identity = 59/242 (24.38%), Postives = 112/242 (46.28%), Query Frame = 2
Query:  356 VNMTETKILNSLGFITNPFLTSMKYAIPGSGVMFILSEYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKE----DSIRSIFYLIGFPLRE--------KSTNSFRNDPEVENNLSKIITNPY--FANLLSVIFDYDYKKRITAAGVLE 1039
            +N+ E K L  L       +  +K  I  +  ++ + EYM E L+ +M+       +     I+    Q++ GL ++H   + H ++ P ++     E+ +KI++F   R+I +  P    + T+ YR PE+ L++  Y + +D+W+ GC++A +   +P+F      D I  I  ++G P +          +  +FR    V  NL  +I N      +L+  +  ++ KKR  A   L 
Sbjct:   46 MNLREVKSLKKLNHAN---VIKLKEVIRENDCLYFVFEYMKENLYQLMKDRNKLFPESMIRNIMY---QILQGLAFIHKHGFFHRDMKPENLLCMGPEL-VKIADFGLAREIRSRPPYTDYVSTRWYRGPEVLLRSTSYSSPIDIWALGCIMAELYTLRPLFPGSSEVDQIFKICQVLGTPKKNDWPEGHQLAAAMNFRWPQCVPTNLKTLIPNASNEAIHLMRDMLHWEPKKRPNAVQSLR 280          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: cdk2 (cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2741])

HSP 1 Score: 70.0922 bits (170), Expect = 6.749e-14
Identity = 49/170 (28.82%), Postives = 83/170 (48.82%), Query Frame = 2
Query:  560 QLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVT-SIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREKSTNSFRNDPE--------VENNLSKIITNPYFA--NLLSVIFDYDYKKRITA 1024
            QL+ G+ + H     H ++ P+++ ++  E  +K+++F   R  G    T T  + T  YRAPE+ L    Y T +DVWS GC+ A M+ ++ +F  DS    +  IF  +G P  E         P+            L+K++    F   +LL+++  YD  +R+TA
Sbjct:  110 QLLQGIAFCHSHRILHRDLKPQNLLIN-AEGAIKLADFGLARAFGVPQRTYTHEVVTLWYRAPEILLGCKHYSTSVDVWSIGCIFAEMLTRRALFPGDSEIDQLFRIFRTLGTP-DEVVWPGVSQLPDYKSTFPRWANQELTKVVPTLNFEGRDLLALMLQYDPNQRVTA 277          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: cdk2 (cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2741])

HSP 1 Score: 70.0922 bits (170), Expect = 7.625e-14
Identity = 48/175 (27.43%), Postives = 85/175 (48.57%), Query Frame = 2
Query:  557 RQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVT-SIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREKSTNSFRNDPEVE--------NNLSKIIT--NPYFANLLSVIFDYDYKKRITAAGVL 1036
             QL+ G+ + H     H ++ P+++ ++  +  +K+++F   R  G  L T T  + T  YRAPE+ L    Y T +DVWS GC+ A M+ ++ +F  DS    +  IF  +G P  E         P+ +         +L+K++   +    +LL  +  YD  +R++A   L
Sbjct:  109 HQLLQGIAFCHAQRTLHRDLKPQNLLIN-ADGAIKLADFGLARAFGVPLRTYTHEVVTLWYRAPEILLGCKYYSTAVDVWSLGCIFAEMLTRRALFPGDSEIDQLFRIFRTLGTP-DETVWQGITQLPDYKPSFPRWCAQDLTKVVPLLDAAGHDLLMQMLQYDPTRRVSAKAAL 281          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: mapk12a (mitogen-activated protein kinase 12a [Source:NCBI gene;Acc:30681])

HSP 1 Score: 70.0922 bits (170), Expect = 1.101e-13
Identity = 51/175 (29.14%), Postives = 83/175 (47.43%), Query Frame = 2
Query:  560 QLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKE----DSIRSIFYLIGFPLR--------EKSTNSFRNDPEVENNLSKII---TNPYFANLLSVIFDYDYKKRITAAGVLE 1039
            Q++ GLKY+H     H ++ P ++ V+  +  LKI +F   R   AD      + T+ YRAPE+ L    Y   +D+WS GC++A MI  KP+F      D +  I  L G P +         ++    +  P++E      +    NP   +LL  +   D ++R TA+  L+
Sbjct:  136 QILKGLKYIHSSGIIHRDLKPGNLAVN-EDCELKILDFGLARH--ADQEMTGYVVTRWYRAPEVILNWMHYTQTVDIWSVGCIMAEMITGKPLFPGNDHMDQLMLILKLTGTPPQYLVDRMDENEAAKYIKTLPKMEKRRISTVFPNANPIAIDLLEKMLALDPEQRPTASEALQ 307          
BLAST of Protein kinase vs. Ensembl Yeast
Match: MRK1 (Glycogen synthase kinase 3 (GSK-3) homolog; one of four GSK-3 homologs in S. cerevisiae that function to activate Msn2p-dependent transcription of stress responsive genes and that function in protein degradation; MRK1 has a paralog, RIM11, that arose from the whole genome duplication [Source:SGD;Acc:S000002237])

HSP 1 Score: 83.5741 bits (205), Expect = 4.290e-18
Identity = 47/149 (31.54%), Postives = 79/149 (53.02%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDL-DYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKE----DSIRSIFYLIGFPLREK 898
            +YMP++L+  +      ++ +    I   + QL   L YLH++    H +I P+++ VD T    KI +F   + +  D P V+ I ++ YRAPEL      Y   +DVWS+ CVIA ++L KP+F      D +  I  ++G P +++
Sbjct:  240 DYMPQSLYQRLRHFVNLKMQMPRVEIKFYAYQLFKALNYLHNVPRICHRDIKPQNLLVDPTTFSFKICDFGSAKCLKPDQPNVSYICSRYYRAPELMFGATNYSNQVDVWSSACVIAELLLGKPLFSGESGIDQLVEIIKIMGIPTKDE 388          
BLAST of Protein kinase vs. Ensembl Yeast
Match: MCK1 (Dual-specificity ser/thr and tyrosine protein kinase; roles in chromosome segregation, meiotic entry, genome stability, phosphorylation-dependent protein degradation (Rcn1p and Cdc6p), inhibition of protein kinase A, transcriptional regulation, inhibition of RNA pol III, calcium stress and inhibition of Clb2p-Cdc28p after nuclear division; MCK1 has a paralog, YGK3, that arose from the whole genome duplication [Source:SGD;Acc:S000005251])

HSP 1 Score: 78.1814 bits (191), Expect = 1.611e-16
Identity = 40/113 (35.40%), Postives = 63/113 (55.75%), Query Frame = 2
Query:  560 QLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKED----SIRSIFYLIGFP 886
            Q+  G+ YLH L   H +I P ++ VD     LKI +F   +K+  + P+++ I ++ YRAPEL +    Y T +D+W  GCV+  M++ K IF+       +R I  L+G P
Sbjct:  147 QIARGMLYLHGLGVCHRDIKPSNVLVDPETGVLKICDFGSAKKLEHNQPSISYICSRFYRAPELIIGCTQYTTQIDIWGLGCVMGEMLIGKAIFQGQEPLLQLREIAKLLGPP 259          
BLAST of Protein kinase vs. Ensembl Yeast
Match: RIM11 (Protein kinase; required for signal transduction during entry into meiosis; promotes the formation of the Ime1p-Ume6p complex by phosphorylating Ime1p and Ume6p; shares similarity with mammalian glycogen synthase kinase 3-beta; protein abundance increases in response to DNA replication stress; RIM11 has a paralog, MRK1, that arose from the whole genome duplication [Source:SGD;Acc:S000004747])

HSP 1 Score: 77.0258 bits (188), Expect = 3.755e-16
Identity = 45/152 (29.61%), Postives = 80/152 (52.63%), Query Frame = 2
Query:  458 ILSEYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDL-DYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKE----DSIRSIFYLIGFPLREK 898
            ++ EYMP++L+  +     +R  +    I     QL   L YLH   +  H +I P+++ VD     LK+ +F   +++    P V+ I ++ YRAPEL      Y   +D+WS+GCV+A ++L +P+F      D +  I  ++G P +++
Sbjct:  112 LILEYMPQSLYQRLRHFVHQRTPMSRLEIKYYMFQLFKSLNYLHHFANVCHRDIKPQNLLVDPETWSLKLCDFGSAKQLKPTEPNVSYICSRYYRAPELIFGATNYTNQIDIWSSGCVMAELLLGQPMFPGESGIDQLVEIIKILGTPSKQE 263          
BLAST of Protein kinase vs. Ensembl Yeast
Match: SMK1 (Middle sporulation-specific mitogen-activated protein kinase (MAPK); required for production of the outer spore wall layers; negatively regulates activity of the glucan synthase subunit Gsc2p [Source:SGD;Acc:S000006258])

HSP 1 Score: 75.485 bits (184), Expect = 1.071e-15
Identity = 42/116 (36.21%), Postives = 63/116 (54.31%), Query Frame = 2
Query:  560 QLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADL--------PTVTS-IGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIF-KEDSIRSIFYLI 877
            Q++ GLKY+H  D  H ++ P +I   +    LKI +F   R I A          P +T+ + T+ YRAPEL L N  Y   +D+W+ GC++A    +KP+F   DS+  IF +I
Sbjct:  149 QILCGLKYIHSADVIHRDLKPGNILCTLNGC-LKICDFGLARGIHAGFFKCHSTVQPHITNYVATRWYRAPELLLSNQPYSKSVDIWAVGCILAEFYARKPVFMGRDSMHQIFEII 263          
BLAST of Protein kinase vs. Ensembl Yeast
Match: YGK3 (Protein kinase related to mammalian GSK-3 glycogen synthase kinases; GSK-3 homologs (Mck1p, Rim11p, Mrk1p, Ygk3p) are involved in control of Msn2p-dependent transcription of stress responsive genes and in protein degradation; YGK3 has a paralog, MCK1, that arose from the whole genome duplication [Source:SGD;Acc:S000005488])

HSP 1 Score: 75.0998 bits (183), Expect = 1.475e-15
Identity = 45/160 (28.12%), Postives = 82/160 (51.25%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDSIRSIFYLIGFPLREKSTNSFRNDPEVENNLS 946
            EY+P+TL + +         +   +I + + Q++  L  LH +   H ++ P +I +  +    K+ +F   +++  +    T   ++ YRAPEL L +  Y T +D+WS GC+I  MI  +P+FK DS  S    I   L     +S +N  E++++L+
Sbjct:  125 EYIPQTLSSEIHEYFDNGSKMPTKHIKLYTFQILRALLTLHSMSICHGDLKPSNILIIPSSGIAKVCDFGSAQRLDDNTELKTYFCSRFYRAPELLLNSKDYTTQIDIWSLGCIIGEMIKGQPLFKGDSANSQLEEIAKLLGRFPKSSIKNSQELQDSLN 284          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO36371 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIW0])

HSP 1 Score: 85.8853 bits (211), Expect = 1.212e-18
Identity = 60/199 (30.15%), Postives = 96/199 (48.24%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLRE--KSTNSFRND-------PEVENNLSKIITNPYFANLLSVIFDYDYKKRITA 1024
            +++PET++ +       +  +   YI +   QL   L Y+H L   H +I P+++ +D     LK+ +F   + +    P V+ I ++ YRAPEL      Y   +DVWSAGCV+A ++L +PIF  DS    +  I  ++G P RE  K  N    +       P   N + +  T P   NL S + +Y    R+ A
Sbjct:  132 DFIPETVYRVARHYSKAKQTIPMLYIKLYMYQLFRSLTYIHCLGICHRDIKPQNLLLDPETAVLKLCDFGSAKVLVKGEPNVSYICSRYYRAPELIFGATDYSPDIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIKEMNPHYTEFKFPQIKPHPWNKVFRPKTPPESINLCSRLLEYTPSGRLNA 330          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO45693 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RS71])

HSP 1 Score: 80.1073 bits (196), Expect = 7.567e-17
Identity = 55/179 (30.73%), Postives = 84/179 (46.93%), Query Frame = 2
Query:  560 QLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPT----VTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIF--KEDSIRSIFYLIGFPLREKSTNSFRNDPEVENNLSKII--------------TNPYFANLLSVIFDYDYKKRITAAGVL 1036
            QL+ GLKY+H  +  H +I P ++ VD   + LKI +F   R +  +         S  T  Y+APELFL +  Y   +D+W AGCV A M+L KP+F  + D  +    L   P+  K  N+   D  ++ N  K++               +P   +LL  +  +  + RITA   L
Sbjct:  131 QLLRGLKYIHSANVLHRDIKPSNLLVDSETLMLKIGDFGQTRVVDPEFDHDGYLTHSPSTLWYKAPELFLNSTGYSNAIDIWGAGCVFAEMLLGKPLFEGRHDIEQLQLILDTIPVDSKGLNNLEFD--MKANFDKMLLDGPKEPLYSKFQDLDPKALDLLKQMLRFSPESRITAEDAL 307          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO41147 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S560])

HSP 1 Score: 77.411 bits (189), Expect = 4.380e-16
Identity = 62/242 (25.62%), Postives = 116/242 (47.93%), Query Frame = 2
Query:  356 VNMTETKILNSLGFITNPFLTSMKYAIPGSGVMFILSEYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIF----KEDSIRSIFYLIGFPLREK--------STNSFRNDPEVENNLSKIITNPYFA--NLLSVIFDYDYKKRITAAGVLE 1039
            +N+ E K L  L   TN  +  +K  I  +  ++ + EYM E L+ MM+       +     +I    Q++ GL ++H   Y H ++ P ++     E+ +KI++F   R+  +  P    + T+ YRAPE+ L++  Y + +D+W+ GC++A +   +P+F    + D I  +  ++G P  ++        S  +F+       +L  +I N       L+  +  ++ KKR TAA  L 
Sbjct:   46 INLREVKSLRKLSH-TN--IVKLKEVIRENDHLYFVFEYMKENLYQMMKNRDKLLPESVIRNVIY---QILQGLAFIHKHGYFHRDMKPENLLCTGHEL-VKIADFGLARETRSRPPYTDYVSTRWYRAPEVLLRSTNYSSPIDIWAVGCIMAELYTLRPLFPGSSEVDEIFKVCSVLGPPKPDEWPEGHKLASAMNFKFPQTKATSLHSLIPNASAEAIQLMQEMLFWNPKKRPTAAQALH 280          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO46881 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNM4])

HSP 1 Score: 72.7886 bits (177), Expect = 2.325e-14
Identity = 52/174 (29.89%), Postives = 83/174 (47.70%), Query Frame = 2
Query:  560 QLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKE----DSIRSIFYLIGFP----LREKSTNSFRNDPEVENNLSK-------IITNPYFANLLSVIFDYDYKKRITAAGVL 1036
            Q++ GLKY+H     H ++ P +I V+  +  LKI +F   R   A++     + T+ YRAPE+ L    Y   +D+WS GC++A ++  K +F      D +  I  L+G P    L++  + S RN      +  K       +  NP   +LL  + + D   RITA   L
Sbjct:  140 QILRGLKYIHSAGVIHRDLKPSNIAVN-EDCELKILDFGLARMTDAEM--TGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTSKTLFPGNDHIDQLTKIMQLVGKPSDDFLQKIDSESARNYIAQMPDYRKTPFDEYFVGANPLAVDLLEKMLNLDTDHRITAVEAL 310          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO46173 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQW1])

HSP 1 Score: 69.707 bits (169), Expect = 1.780e-13
Identity = 42/135 (31.11%), Postives = 68/135 (50.37%), Query Frame = 2
Query:  443 SGVMFILSEYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGAD--LPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIF 841
             G  +++ EYM   L  ++E   +   +      I   RQL+ GL Y H  ++ H +I   +I ++  +  +K+++F   R   AD   P    + T  YR PEL L    YG  +D+WS GC++A +  +KPIF
Sbjct:   81 KGAFYLVFEYMDHDLMGLLESGLVHLTEDHIKSFI---RQLLDGLNYCHKKNFLHRDIKCSNILLN-NKGEIKLADFGLARLYEADERRPYTNKVITLWYRPPELLLGEERYGPGIDIWSVGCILAELFTKKPIF 211          
BLAST of Protein kinase vs. Ensembl Medaka
Match: ENSORLT00000027319.1 (glycogen synthase kinase-3 beta [Source:NCBI gene;Acc:101160344])

HSP 1 Score: 83.1889 bits (204), Expect = 3.088e-17
Identity = 46/148 (31.08%), Postives = 80/148 (54.05%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREK 898
            +++PET++ +       +  +   Y+ +   QL   L Y+H     H +I P+++ VD     LK+ +F   +++    P V+ I ++ YRAPEL      Y + +D+WSAGCV+A ++L +PIF  DS    +  I  ++G P RE+
Sbjct:  160 DFVPETVYRVARHFNKAKTTIPIIYVKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPETAILKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSNIDIWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ 307          
BLAST of Protein kinase vs. Ensembl Medaka
Match: ENSORLT00000016710.2 (glycogen synthase kinase-3 beta [Source:NCBI gene;Acc:101160344])

HSP 1 Score: 82.8037 bits (203), Expect = 3.999e-17
Identity = 46/148 (31.08%), Postives = 80/148 (54.05%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREK 898
            +++PET++ +       +  +   Y+ +   QL   L Y+H     H +I P+++ VD     LK+ +F   +++    P V+ I ++ YRAPEL      Y + +D+WSAGCV+A ++L +PIF  DS    +  I  ++G P RE+
Sbjct:  164 DFVPETVYRVARHFNKAKTTIPIIYVKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPETAILKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSNIDIWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ 311          
BLAST of Protein kinase vs. Ensembl Medaka
Match: ENSORLT00000044063.1 (glycogen synthase kinase-3 beta [Source:NCBI gene;Acc:101160344])

HSP 1 Score: 83.1889 bits (204), Expect = 4.073e-17
Identity = 46/148 (31.08%), Postives = 80/148 (54.05%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREK 898
            +++PET++ +       +  +   Y+ +   QL   L Y+H     H +I P+++ VD     LK+ +F   +++    P V+ I ++ YRAPEL      Y + +D+WSAGCV+A ++L +PIF  DS    +  I  ++G P RE+
Sbjct:  200 DFVPETVYRVARHFNKAKTTIPIIYVKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPETAILKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSNIDIWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ 347          
BLAST of Protein kinase vs. Ensembl Medaka
Match: gsk3aa (glycogen synthase kinase-3 beta [Source:NCBI gene;Acc:101168720])

HSP 1 Score: 82.4185 bits (202), Expect = 4.580e-17
Identity = 46/148 (31.08%), Postives = 79/148 (53.38%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREK 898
            +++PET++ +       +  +   Y+ +   QL   L Y+H     H +I P+++ VD     LK+ +F   +++    P V+ I ++ YRAPEL      Y   +D+WSAGCV+A ++L +PIF  DS    +  I  ++G P RE+
Sbjct:  126 DFVPETVYRVARHFNKAKSIIPIIYVKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPETAILKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTANIDIWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ 273          
BLAST of Protein kinase vs. Ensembl Medaka
Match: gsk3aa (glycogen synthase kinase-3 beta [Source:NCBI gene;Acc:101168720])

HSP 1 Score: 82.4185 bits (202), Expect = 5.498e-17
Identity = 46/148 (31.08%), Postives = 79/148 (53.38%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREK 898
            +++PET++ +       +  +   Y+ +   QL   L Y+H     H +I P+++ VD     LK+ +F   +++    P V+ I ++ YRAPEL      Y   +D+WSAGCV+A ++L +PIF  DS    +  I  ++G P RE+
Sbjct:  160 DFVPETVYRVARHFNKAKSIIPIIYVKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPETAILKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTANIDIWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ 307          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000039922.1 (SMESG000039922.1)

HSP 1 Score: 588.186 bits (1515), Expect = 0.000e+0
Identity = 305/309 (98.71%), Postives = 307/309 (99.35%), Query Frame = 2
Query:  137 MTEDLDTCSLQSFSLSQHEPGKFVTKSVYLLPEIKVVQIGICYVNKNSFCHIKESKSVNYPKNSIATKMNMMKVNMTETKILNSLGFITNPFLTSMKYAIPGSGVMFILSEYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDSIRSIFYLIGFPLREKSTNSFRNDPEVENNLSKIITNPYFANLLSVIFDYDYKKRITAAGVLEILNENKMI 1063
            MTEDLDTCSLQSFSLSQHEPGKFVTKSVYLLPEIKVVQIGICYVNKNSFCHIKESKSVNYPKNSIATKMNMMKVNMTETKILNSLGFITNPFL SMKYAIPGSGVMFILSEYMPETLFNMMERLKLKRLDLKDDYIIILSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTF+DVWSAGCVIALMILQKPIFKEDSIRSIFYLIGFPLREKSTNSFRNDPE ENNLSKIITNPYFANLLS+IFDYDYKKRITAAGVLEILNENKMI
Sbjct:    1 MTEDLDTCSLQSFSLSQHEPGKFVTKSVYLLPEIKVVQIGICYVNKNSFCHIKESKSVNYPKNSIATKMNMMKVNMTETKILNSLGFITNPFLISMKYAIPGSGVMFILSEYMPETLFNMMERLKLKRLDLKDDYIIILSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFIDVWSAGCVIALMILQKPIFKEDSIRSIFYLIGFPLREKSTNSFRNDPEAENNLSKIITNPYFANLLSLIFDYDYKKRITAAGVLEILNENKMI 309          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000023764.1 (SMESG000023764.1)

HSP 1 Score: 87.8113 bits (216), Expect = 7.149e-19
Identity = 50/148 (33.78%), Postives = 81/148 (54.73%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREK 898
            E++PET++ +       +  +   +I +   QLM  L Y+H+L   H +I P+++ VD     LK+ +F   + +    P V+ I ++ YRAPEL      Y   +DVWSAGCV+A ++L +PIF  DS    +  I  ++G P RE+
Sbjct:  128 EFIPETVYRVARHYHKNKQTIPLLFIKLYMYQLMRSLAYIHNLGICHRDIKPQNLLVDPDTGVLKLCDFGSAKMLQRGEPNVSYICSRYYRAPELIFGATDYTCQIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPSREQ 275          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000023764.1 (SMESG000023764.1)

HSP 1 Score: 87.8113 bits (216), Expect = 7.151e-19
Identity = 50/148 (33.78%), Postives = 81/148 (54.73%), Query Frame = 2
Query:  467 EYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREK 898
            E++PET++ +       +  +   +I +   QLM  L Y+H+L   H +I P+++ VD     LK+ +F   + +    P V+ I ++ YRAPEL      Y   +DVWSAGCV+A ++L +PIF  DS    +  I  ++G P RE+
Sbjct:  128 EFIPETVYRVARHYHKNKQTIPLLFIKLYMYQLMRSLAYIHNLGICHRDIKPQNLLVDPDTGVLKLCDFGSAKMLQRGEPNVSYICSRYYRAPELIFGATDYTCQIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPSREQ 275          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000021290.1 (SMESG000021290.1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.620e-18
Identity = 64/190 (33.68%), Postives = 95/190 (50.00%), Query Frame = 2
Query:  356 VNMTETKILNSLGFITNPFLTSMKYAIP-----GSGVMFILSEYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFK----EDSIRSIFYLIGFPLREK 898
            VN  E KI + L    + ++ S+KY        G     ++ E MPE+L+ +++RL+ K + L  +        L+SGL Y+H+    H +I   +I VDI E  +KI++F     I         +GT+ YRAPEL  +NP Y   +DVWS   V   MIL   IFK     D +  IF ++G P  E+
Sbjct:  125 VNEQERKIHSFLSG-NHRYIISLKYHCYSRNDYGDVEQCLIMELMPESLYGLLQRLRNKNVTLPSEKRHFFMCSLLSGLNYMHNNSIGHRDIKSHNILVDIDENLIKIADFGCAEIIKPGSMNKVDVGTRYYRAPELLCRNPKYNLSIDVWSMAIVFMDMILFDAIFKGENDNDQLMKIFQILGVPNEEE 313          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000052413.1 (SMESG000052413.1)

HSP 1 Score: 85.1149 bits (209), Expect = 2.178e-18
Identity = 79/277 (28.52%), Postives = 133/277 (48.01%), Query Frame = 2
Query:  254 GICY--VNK--NSFCHIKESKSVNYPKNSIATKMNMMKVNMTETKILNSLGFITNPFLTSMKYAIPGSGVMFILSEYMPETLFNMMEXXXXXXXXXXXXXXXXXSRQLMSGLKYLHDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVT-SIGTQLYRAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDS----IRSIFYLIGFPLREKSTNSFRNDPEVENNLSKII-TNPYFANLLSVIFDYDYKKRITAAGVLEILNEN 1054
            GI Y  +NK  N F  IK+ +S N  ++ IA         + E  IL  L    +P +  ++  I   G ++++ EY+   L   ++  +    D+        S Q+M GL Y H   + H ++ P+++ VD  +  +K+++F   R  GA +  +T  + T  YRAPE+ L    Y   +DVWS  C++A MI  KP+F+ DS    + +IF ++G P           D +V  +L K    NP F      ++ YD + R+     +E+++EN
Sbjct:   20 GIVYKSINKITNEFAAIKKIRSEN-DEDGIAP------TTLREISILKEL---RHPNIVYLQQTIAEKGKLYLVFEYLNMDLRRYLDNEENPMNDIILKKF---SYQIMQGLLYCHTRRFMHRDLKPQNLLVDTNKHIIKLADFGLARCYGAPVKNLTHEVVTLWYRAPEVILNAKRYSCAIDVWSVACIMAEMITYKPLFRGDSEIDQLFAIFKVLGTP-----------DNKVWPDLDKFPGWNPLFP-----VWRYDLRSRL-----VEVIDEN 262          
The following BLAST results are available for this feature:
BLAST of Protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GSK3A1.536e-1833.78glycogen synthase kinase 3 alpha [Source:HGNC Symb... [more]
GSK3A2.616e-1833.78glycogen synthase kinase 3 alpha [Source:HGNC Symb... [more]
GSK3A2.616e-1833.78glycogen synthase kinase 3 alpha [Source:HGNC Symb... [more]
GSK3B8.025e-1832.43glycogen synthase kinase 3 beta [Source:HGNC Symbo... [more]
GSK3B8.265e-1832.43glycogen synthase kinase 3 beta [Source:HGNC Symbo... [more]
back to top
BLAST of Protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gsk-39.063e-1827.47Glycogen synthase kinase-3 [Source:UniProtKB/Swis... [more]
dyf-54.633e-1623.12Serine/threonine-protein kinase dyf-5 [Source:Uni... [more]
dyf-57.250e-1623.12Serine/threonine-protein kinase dyf-5 [Source:Uni... [more]
C44H4.61.981e-1434.48pep chromosome:WBcel235:X:14596476:14599158:-1 gen... [more]
pmk-12.613e-1429.71Mitogen-activated protein kinase pmk-1 [Source:Un... [more]
back to top
BLAST of Protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pk34A1.018e-1926.12gene:FBgn0028410 transcript:FBtr0080432[more]
sgg1.080e-1930.30gene:FBgn0003371 transcript:FBtr0331752[more]
sgg1.345e-1930.30gene:FBgn0003371 transcript:FBtr0070476[more]
sgg1.345e-1930.30gene:FBgn0003371 transcript:FBtr0301966[more]
sgg1.488e-1930.30gene:FBgn0003371 transcript:FBtr0302185[more]
back to top
BLAST of Protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gsk3ba4.137e-1832.43glycogen synthase kinase 3 beta, genome duplicate ... [more]
gsk3aa1.492e-1731.76glycogen synthase kinase 3 alpha a [Source:ZFIN;Ac... [more]
gsk3ab4.215e-1731.08glycogen synthase kinase 3 alpha b [Source:ZFIN;Ac... [more]
gsk3bb4.617e-1730.46glycogen synthase kinase 3 beta, genome duplicate ... [more]
mak1.427e-1526.03male germ cell-associated kinase [Source:ZFIN;Acc:... [more]
back to top
BLAST of Protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GSK3B4.939e-1832.43glycogen synthase kinase 3 beta [Source:NCBI gene;... [more]
GSK3B5.243e-1832.43glycogen synthase kinase 3 beta [Source:NCBI gene;... [more]
GSK3B5.528e-1832.43glycogen synthase kinase 3 beta [Source:NCBI gene;... [more]
GSK3B6.536e-1832.43glycogen synthase kinase 3 beta [Source:NCBI gene;... [more]
GSK3B6.986e-1832.43glycogen synthase kinase 3 beta [Source:NCBI gene;... [more]
back to top
BLAST of Protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gsk3a2.170e-1834.46glycogen synthase kinase 3 alpha [Source:MGI Symbo... [more]
Gsk3a2.418e-1834.46glycogen synthase kinase 3 alpha [Source:MGI Symbo... [more]
Gsk3b6.051e-1832.43glycogen synthase kinase 3 beta [Source:MGI Symbol... [more]
Gsk3b7.101e-1832.43glycogen synthase kinase 3 beta [Source:MGI Symbol... [more]
Mapk121.310e-1632.18mitogen-activated protein kinase 12 [Source:MGI Sy... [more]
back to top
BLAST of Protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q388M1|GSK3B_TRYB23.798e-1927.35Glycogen synthase kinase 3 OS=Trypanosoma brucei b... [more]
sp|P18431|SGG_DROME1.770e-1830.30Protein kinase shaggy OS=Drosophila melanogaster O... [more]
sp|P23111|CDC2_MAIZE3.230e-1833.14Cell division control protein 2 homolog OS=Zea may... [more]
sp|P29618|CDKA1_ORYSJ5.478e-1832.57Cyclin-dependent kinase A-1 OS=Oryza sativa subsp.... [more]
sp|P93101|CDC2_OXYRB8.418e-1833.91Cell division control protein 2 homolog OS=Oxybasi... [more]
back to top
BLAST of Protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A078AEL13.912e-2030.81Protein kinase domain-containing protein OS=Stylon... [more]
J9IEF35.366e-2030.81Glycogen synthase kinase 3 beta protein OS=Oxytric... [more]
A0A510P6V51.417e-1927.43Hypothetical_protein OS=Candida auris OX=498019 GN... [more]
A0A5C1DUE93.846e-1928.63Protein kinase domain-containing protein OS=Candid... [more]
A0A2H1A4X24.039e-1928.63Protein kinase domain-containing protein OS=Candid... [more]
back to top
BLAST of Protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gsk3ba3.674e-1832.43glycogen synthase kinase 3 beta [Source:NCBI gene;... [more]
gsk3ba4.195e-1832.43glycogen synthase kinase 3 beta [Source:NCBI gene;... [more]
ENSAMXT00000005621.27.219e-1832.43glycogen synthase kinase-3 beta-like [Source:NCBI ... [more]
gsk3ab7.838e-1831.76glycogen synthase kinase 3 alpha [Source:NCBI gene... [more]
ENSAMXT00000036323.18.495e-1832.43glycogen synthase kinase-3 beta-like [Source:NCBI ... [more]
back to top
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdk42.431e-1433.62cyclin-dependent kinase 4 [Source:ZFIN;Acc:ZDB-GEN... [more]
mak4.810e-1424.38male germ cell-associated kinase [Source:ZFIN;Acc:... [more]
cdk26.749e-1428.82cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
cdk27.625e-1427.43cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
mapk12a1.101e-1329.14mitogen-activated protein kinase 12a [Source:NCBI ... [more]
back to top
BLAST of Protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MRK14.290e-1831.54Glycogen synthase kinase 3 (GSK-3) homolog; one of... [more]
MCK11.611e-1635.40Dual-specificity ser/thr and tyrosine protein kina... [more]
RIM113.755e-1629.61Protein kinase; required for signal transduction d... [more]
SMK11.071e-1536.21Middle sporulation-specific mitogen-activated prot... [more]
YGK31.475e-1528.13Protein kinase related to mammalian GSK-3 glycogen... [more]
back to top
BLAST of Protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO363711.212e-1830.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO456937.567e-1730.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411474.380e-1625.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468812.325e-1429.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461731.780e-1331.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000027319.13.088e-1731.08glycogen synthase kinase-3 beta [Source:NCBI gene;... [more]
ENSORLT00000016710.23.999e-1731.08glycogen synthase kinase-3 beta [Source:NCBI gene;... [more]
ENSORLT00000044063.14.073e-1731.08glycogen synthase kinase-3 beta [Source:NCBI gene;... [more]
gsk3aa4.580e-1731.08glycogen synthase kinase-3 beta [Source:NCBI gene;... [more]
gsk3aa5.498e-1731.08glycogen synthase kinase-3 beta [Source:NCBI gene;... [more]
back to top
BLAST of Protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000039922.10.000e+098.71SMESG000039922.1[more]
SMESG000023764.17.149e-1933.78SMESG000023764.1[more]
SMESG000023764.17.151e-1933.78SMESG000023764.1[more]
SMESG000021290.11.620e-1833.68SMESG000021290.1[more]
SMESG000052413.12.178e-1828.52SMESG000052413.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022787 ID=SMED30022787|Name=Protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1080bp
AAAATTACAAATCCATTTTCTAAATTGAAATTTTTTAATTTTTTCGAATT
CAAAAAATTTCAATTAAAAATATTTCTCAAAATATTCGTTTGAAAATAAC
AAAATTTATTTGAAAAAAAATTTACAAACCAACAAAATGACAGAGGATTT
GGACACCTGCTCTCTTCAAAGCTTCAGTTTAAGTCAGCACGAACCAGGCA
AATTTGTCACCAAATCCGTTTATTTATTACCGGAAATCAAGGTGGTTCAG
ATAGGGATTTGTTACGTGAATAAAAATTCATTTTGTCATATAAAGGAAAG
TAAGTCGGTAAATTATCCAAAAAACTCCATTGCAACAAAAATGAATATGA
TGAAGGTTAATATGACAGAAACTAAGATACTGAACTCTCTGGGATTTATT
ACAAATCCGTTTCTAACTTCCATGAAATATGCGATTCCTGGCTCTGGTGT
GATGTTTATATTATCTGAATATATGCCCGAAACTCTGTTCAACATGATGG
AAAGATTGAAGTTGAAAAGACTGGATTTAAAAGATGATTACATCATAATC
TTATCCAGACAATTGATGTCCGGCCTGAAATATTTGCACGATTTGGATTA
CGCGCATTGCAATATCAATCCAAGAGATATTTTCGTCGATATCACTGAAG
TGCGATTAAAGATTTCGAATTTTTTTTATTTGCGCAAAATCGGTGCAGAT
TTGCCGACTGTAACTTCAATTGGCACTCAATTGTACAGGGCGCCGGAATT
GTTTCTCAAAAATCCAATTTACGGCACATTTATGGACGTGTGGAGCGCTG
GATGCGTTATCGCATTAATGATTCTCCAAAAACCAATTTTCAAGGAAGAT
TCAATTAGATCTATTTTCTACTTAATCGGATTTCCGCTAAGGGAGAAATC
AACAAACTCCTTTAGGAACGATCCGGAAGTGGAGAATAATTTATCAAAAA
TTATTACAAATCCCTATTTTGCTAATCTTTTGTCAGTGATATTTGATTAC
GACTACAAAAAAAGAATAACTGCTGCAGGAGTTCTTGAAATTCTCAATGA
AAATAAAATGATTTAATTTTGTAATTCATA
back to top

protein sequence of SMED30022787-orf-1

>SMED30022787-orf-1 ID=SMED30022787-orf-1|Name=SMED30022787-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=310bp
MTEDLDTCSLQSFSLSQHEPGKFVTKSVYLLPEIKVVQIGICYVNKNSFC
HIKESKSVNYPKNSIATKMNMMKVNMTETKILNSLGFITNPFLTSMKYAI
PGSGVMFILSEYMPETLFNMMERLKLKRLDLKDDYIIILSRQLMSGLKYL
HDLDYAHCNINPRDIFVDITEVRLKISNFFYLRKIGADLPTVTSIGTQLY
RAPELFLKNPIYGTFMDVWSAGCVIALMILQKPIFKEDSIRSIFYLIGFP
LREKSTNSFRNDPEVENNLSKIITNPYFANLLSVIFDYDYKKRITAAGVL
EILNENKMI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
GO:0040007growth
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0050321tau-protein kinase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 43..302
e-value: 9.7E-13
score: 48.6
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 70..300
e-value: 3.5E-29
score: 102.0
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 28..309
score: 23.99
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 117..308
e-value: 4.6E-33
score: 116.7
NoneNo IPR availablePANTHERPTHR24056:SF350GLYCOGEN SYNTHASE KINASE-3 HOMOLOG YGK3coord: 45..300
NoneNo IPR availablePANTHERPTHR24056CELL DIVISION PROTEIN KINASEcoord: 45..300
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 75..301