Splicing factor 3b subunit 4

Overview
NameSplicing factor 3b subunit 4
Smed IDSMED30022786
Length (bp)1352
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Splicing factor 3b subunit 4 (SMED30022786) t-SNE clustered cells

Violin plots show distribution of expression levels for Splicing factor 3b subunit 4 (SMED30022786) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Splicing factor 3b subunit 4 (SMED30022786) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Splicing factor 3b subunit 4 (SMED30022786) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022786

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30022786h1SMcG0004236 SmedASXL_010016SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30022786h1SMcG0004236 SmedASXL_010016SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30022786h1SMcG0004236 dd_Smed_v4_3556_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30022786h1SMcG0004236 dd_Smed_v4_3556_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30022786h1SMcG0004236 dd_Smed_v4_3556_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Human
Match: SF3B4 (splicing factor 3b subunit 4 [Source:HGNC Symbol;Acc:HGNC:10771])

HSP 1 Score: 400.208 bits (1027), Expect = 1.889e-136
Identity = 186/211 (88.15%), Postives = 199/211 (94.31%), Query Frame = 3
Query:   99 MTVGAIEERNQDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLF 731
            M  G I ERNQDA++YVGGLD KV+E +LWELFLQAGPVVN HMPKDRVTG HQGYGFVEFL EEDADYA+KIMNMIKLYGKPIRVNKAS+H KNLD+GANIFIGNLDPE+DEKLLYDTFSAFGVILQTPKIMR+ ++GNSKGYAFIN+ASF+ASDAAIEAMNGQYLCNR ITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLF
Sbjct:    1 MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLF 211          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Human
Match: SF3B4 (splicing factor 3b subunit 4 [Source:HGNC Symbol;Acc:HGNC:10771])

HSP 1 Score: 329.331 bits (843), Expect = 4.396e-112
Identity = 154/168 (91.67%), Postives = 163/168 (97.02%), Query Frame = 3
Query:  228 MPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLF 731
            MPKDRVTG HQGYGFVEFL EEDADYA+KIMNMIKLYGKPIRVNKAS+H KNLD+GANIFIGNLDPE+DEKLLYDTFSAFGVILQTPKIMR+ ++GNSKGYAFIN+ASF+ASDAAIEAMNGQYLCNR ITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLF
Sbjct:    1 MPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLF 168          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Human
Match: PABPC4 (poly(A) binding protein cytoplasmic 4 [Source:HGNC Symbol;Acc:HGNC:8557])

HSP 1 Score: 132.494 bits (332), Expect = 7.852e-33
Identity = 79/184 (42.93%), Postives = 110/184 (59.78%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRV---NKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITV-SYAFKKDSKGERHGSAAE 674
            AS+YVG L   VTEA+L+E F  AGPV+++ + +D +T    GY +V F    DA+ A+  MN   + GKPIR+    +  S RK+  +G N+FI NLD  +D K LYDTFSAFG IL    +  E     SKGYAF+++ + EA+D AIE MNG  L +R + V  +  +K+ + E    A E
Sbjct:   11 ASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKS-GVG-NVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDEN---GSKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKE 189          

HSP 2 Score: 83.1889 bits (204), Expect = 1.968e-16
Identity = 57/187 (30.48%), Postives = 98/187 (52.41%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKAS-----------------SHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSK 647
            ++Y+     +V +  L ELF Q G  ++V + +D   G  +G+GFV +   EDA+ A++ MN  ++ GK I V +A                    R +   G N++I NLD  +D++ L   FS FG I  + K+M   E G SKG+ F+ ++S E +  A+  MNG+ + ++ + V+ A +K+ +
Sbjct:  192 NVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRD-PNGKSKGFGFVSYEKHEDANKAVEEMNGKEISGKIIFVGRAQKKVERQAELKRKFEQLKQERISRYQGVNLYIKNLDDTIDDEKLRKEFSPFGSIT-SAKVM--LEDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEER 374          

HSP 3 Score: 82.0333 bits (201), Expect = 5.795e-16
Identity = 54/174 (31.03%), Postives = 94/174 (54.02%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHR-KNLDIGA------NIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKK 638
            ++++  LD  +    L++ F   G +++  +  D      +GY FV F  +E AD A++ MN + L  + + V +  S + +  ++GA      N++I N   EVD++ L + FS FG  L   K+MR+  +G SKG+ F++Y   E ++ A+E MNG+ +  + I V  A KK
Sbjct:  100 NVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDE--NGSKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSV-KVMRDP-NGKSKGFGFVSYEKHEDANKAVEEMNGKEISGKIIFVGRAQKK 269          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Human
Match: PABPC4 (poly(A) binding protein cytoplasmic 4 [Source:HGNC Symbol;Acc:HGNC:8557])

HSP 1 Score: 132.494 bits (332), Expect = 8.755e-33
Identity = 79/184 (42.93%), Postives = 110/184 (59.78%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRV---NKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITV-SYAFKKDSKGERHGSAAE 674
            AS+YVG L   VTEA+L+E F  AGPV+++ + +D +T    GY +V F    DA+ A+  MN   + GKPIR+    +  S RK+  +G N+FI NLD  +D K LYDTFSAFG IL    +  E     SKGYAF+++ + EA+D AIE MNG  L +R + V  +  +K+ + E    A E
Sbjct:   11 ASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKS-GVG-NVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDEN---GSKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKE 189          

HSP 2 Score: 83.1889 bits (204), Expect = 1.925e-16
Identity = 57/187 (30.48%), Postives = 98/187 (52.41%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKAS-----------------SHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSK 647
            ++Y+     +V +  L ELF Q G  ++V + +D   G  +G+GFV +   EDA+ A++ MN  ++ GK I V +A                    R +   G N++I NLD  +D++ L   FS FG I  + K+M   E G SKG+ F+ ++S E +  A+  MNG+ + ++ + V+ A +K+ +
Sbjct:  192 NVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRD-PNGKSKGFGFVSYEKHEDANKAVEEMNGKEISGKIIFVGRAQKKVERQAELKRKFEQLKQERISRYQGVNLYIKNLDDTIDDEKLRKEFSPFGSIT-SAKVM--LEDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEER 374          

HSP 3 Score: 81.6481 bits (200), Expect = 6.085e-16
Identity = 54/174 (31.03%), Postives = 94/174 (54.02%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHR-KNLDIGA------NIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKK 638
            ++++  LD  +    L++ F   G +++  +  D      +GY FV F  +E AD A++ MN + L  + + V +  S + +  ++GA      N++I N   EVD++ L + FS FG  L   K+MR+  +G SKG+ F++Y   E ++ A+E MNG+ +  + I V  A KK
Sbjct:  100 NVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDE--NGSKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSV-KVMRDP-NGKSKGFGFVSYEKHEDANKAVEEMNGKEISGKIIFVGRAQKK 269          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Human
Match: PABPC4 (poly(A) binding protein cytoplasmic 4 [Source:HGNC Symbol;Acc:HGNC:8557])

HSP 1 Score: 132.494 bits (332), Expect = 9.089e-33
Identity = 79/184 (42.93%), Postives = 110/184 (59.78%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRV---NKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITV-SYAFKKDSKGERHGSAAE 674
            AS+YVG L   VTEA+L+E F  AGPV+++ + +D +T    GY +V F    DA+ A+  MN   + GKPIR+    +  S RK+  +G N+FI NLD  +D K LYDTFSAFG IL    +  E     SKGYAF+++ + EA+D AIE MNG  L +R + V  +  +K+ + E    A E
Sbjct:   11 ASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKS-GVG-NVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDEN---GSKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKE 189          

HSP 2 Score: 83.5741 bits (205), Expect = 1.791e-16
Identity = 57/187 (30.48%), Postives = 98/187 (52.41%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKAS-----------------SHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSK 647
            ++Y+     +V +  L ELF Q G  ++V + +D   G  +G+GFV +   EDA+ A++ MN  ++ GK I V +A                    R +   G N++I NLD  +D++ L   FS FG I  + K+M   E G SKG+ F+ ++S E +  A+  MNG+ + ++ + V+ A +K+ +
Sbjct:  192 NVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRD-PNGKSKGFGFVSYEKHEDANKAVEEMNGKEISGKIIFVGRAQKKVERQAELKRKFEQLKQERISRYQGVNLYIKNLDDTIDDEKLRKEFSPFGSIT-SAKVM--LEDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEER 374          

HSP 3 Score: 82.0333 bits (201), Expect = 5.178e-16
Identity = 54/174 (31.03%), Postives = 94/174 (54.02%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHR-KNLDIGA------NIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKK 638
            ++++  LD  +    L++ F   G +++  +  D      +GY FV F  +E AD A++ MN + L  + + V +  S + +  ++GA      N++I N   EVD++ L + FS FG  L   K+MR+  +G SKG+ F++Y   E ++ A+E MNG+ +  + I V  A KK
Sbjct:  100 NVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDE--NGSKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSV-KVMRDP-NGKSKGFGFVSYEKHEDANKAVEEMNGKEISGKIIFVGRAQKK 269          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Celegans
Match: sap-49 (Splicing factor 3B subunit 4 [Source:UniProtKB/Swiss-Prot;Acc:Q09442])

HSP 1 Score: 375.17 bits (962), Expect = 1.564e-127
Identity = 171/213 (80.28%), Postives = 198/213 (92.96%), Query Frame = 3
Query:   99 MTVGAIEERNQDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFAD 737
            M+ G I ERNQDA+IYVGGLD KV+E+ILWEL +QAGPVV+V+MPKDRVT  HQG+GFVEF+GEEDADYA+KI+NMIKLYGKPI+VNKAS+H KN+D+GANIF+GNLDPEVDEKLLYDTFSAFGVILQ PKIMR+ +SG SKG+AFIN+ASFEASD A+EAMNGQ+LCNRAITVSYAFK+DSKGERHG+AAER+LAAQNPL   DRPHQ+F+D
Sbjct:    1 MSAGPIVERNQDATIYVGGLDEKVSESILWELMVQAGPVVSVNMPKDRVTANHQGFGFVEFMGEEDADYAIKILNMIKLYGKPIKVNKASAHEKNMDVGANIFVGNLDPEVDEKLLYDTFSAFGVILQVPKIMRDVDSGTSKGFAFINFASFEASDTALEAMNGQFLCNRAITVSYAFKRDSKGERHGTAAERMLAAQNPLFPKDRPHQVFSD 213          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Celegans
Match: pab-1 (Polyadenylate-binding protein [Source:UniProtKB/TrEMBL;Acc:Q7K797])

HSP 1 Score: 119.013 bits (297), Expect = 1.638e-28
Identity = 71/183 (38.80%), Postives = 101/183 (55.19%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIGA-NIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERL 680
            AS+YVG L   V E+IL+E F  AGPV+++ + +D  T L  GY +V F    DA+ AM  MN   L+GKP+R+  +         GA NIFI NLD  +D K +YDTFS FG IL     +   E G SKGY F+++ + EA+  AI+ +NG  L  + + V     +  +    G  A++ 
Sbjct:   32 ASLYVGDLHPDVNESILFEKFSAAGPVLSIRVCRDNATRLSLGYAYVNFQQPADAERAMDTMNFEALHGKPMRIMWSQRDPAMRRSGAGNIFIKNLDKVIDNKSIYDTFSLFGNILSCKVAI--DEDGFSKGYGFVHFETEEAAQNAIQKVNGMLLAGKKVFVGKFQPRAQRNRELGETAKQF 212          

HSP 2 Score: 69.3218 bits (168), Expect = 2.185e-12
Identity = 50/210 (23.81%), Postives = 102/210 (48.57%), Query Frame = 3
Query:  117 EERNQDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLD-------------------IGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERLLAA 689
            E   Q  ++YV        +  L +LF + G + +  +    V G  +G+GFV F   E+A+ A++ ++   + G  ++++   + +K+                      G N+++ NLD  VD+  L   F ++G I  + K+M + E+G SKG+ F+ +   E + +A+  MN + +C++ + V+ A +K+ +  +  S   + LA+
Sbjct:  207 ETAKQFTNVYVKNFGDHYNKETLEKLFAKFGNITSCEVMT--VEGKSKGFGFVAFANPEEAETAVQALHDSTIEGTDLKLHVCRAQKKSERHAELKKKHEQHKAERMQKYQGVNLYVKNLDETVDDDGLKKQFESYGNIT-SAKVMTD-ENGRSKGFGFVCFEKPEEATSAVTEMNSKMVCSKPLYVAIAQRKEDRRAQLASQYMQRLAS 412          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Celegans
Match: pab-1 (Polyadenylate-binding protein [Source:UniProtKB/TrEMBL;Acc:Q7K797])

HSP 1 Score: 119.013 bits (297), Expect = 1.638e-28
Identity = 71/183 (38.80%), Postives = 101/183 (55.19%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIGA-NIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERL 680
            AS+YVG L   V E+IL+E F  AGPV+++ + +D  T L  GY +V F    DA+ AM  MN   L+GKP+R+  +         GA NIFI NLD  +D K +YDTFS FG IL     +   E G SKGY F+++ + EA+  AI+ +NG  L  + + V     +  +    G  A++ 
Sbjct:   32 ASLYVGDLHPDVNESILFEKFSAAGPVLSIRVCRDNATRLSLGYAYVNFQQPADAERAMDTMNFEALHGKPMRIMWSQRDPAMRRSGAGNIFIKNLDKVIDNKSIYDTFSLFGNILSCKVAI--DEDGFSKGYGFVHFETEEAAQNAIQKVNGMLLAGKKVFVGKFQPRAQRNRELGETAKQF 212          

HSP 2 Score: 69.3218 bits (168), Expect = 2.185e-12
Identity = 50/210 (23.81%), Postives = 102/210 (48.57%), Query Frame = 3
Query:  117 EERNQDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLD-------------------IGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERLLAA 689
            E   Q  ++YV        +  L +LF + G + +  +    V G  +G+GFV F   E+A+ A++ ++   + G  ++++   + +K+                      G N+++ NLD  VD+  L   F ++G I  + K+M + E+G SKG+ F+ +   E + +A+  MN + +C++ + V+ A +K+ +  +  S   + LA+
Sbjct:  207 ETAKQFTNVYVKNFGDHYNKETLEKLFAKFGNITSCEVMT--VEGKSKGFGFVAFANPEEAETAVQALHDSTIEGTDLKLHVCRAQKKSERHAELKKKHEQHKAERMQKYQGVNLYVKNLDETVDDDGLKKQFESYGNIT-SAKVMTD-ENGRSKGFGFVCFEKPEEATSAVTEMNSKMVCSKPLYVAIAQRKEDRRAQLASQYMQRLAS 412          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Celegans
Match: pab-1 (Polyadenylate-binding protein [Source:UniProtKB/TrEMBL;Acc:Q7K797])

HSP 1 Score: 119.013 bits (297), Expect = 1.638e-28
Identity = 71/183 (38.80%), Postives = 101/183 (55.19%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIGA-NIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERL 680
            AS+YVG L   V E+IL+E F  AGPV+++ + +D  T L  GY +V F    DA+ AM  MN   L+GKP+R+  +         GA NIFI NLD  +D K +YDTFS FG IL     +   E G SKGY F+++ + EA+  AI+ +NG  L  + + V     +  +    G  A++ 
Sbjct:   32 ASLYVGDLHPDVNESILFEKFSAAGPVLSIRVCRDNATRLSLGYAYVNFQQPADAERAMDTMNFEALHGKPMRIMWSQRDPAMRRSGAGNIFIKNLDKVIDNKSIYDTFSLFGNILSCKVAI--DEDGFSKGYGFVHFETEEAAQNAIQKVNGMLLAGKKVFVGKFQPRAQRNRELGETAKQF 212          

HSP 2 Score: 69.3218 bits (168), Expect = 2.185e-12
Identity = 50/210 (23.81%), Postives = 102/210 (48.57%), Query Frame = 3
Query:  117 EERNQDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLD-------------------IGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERLLAA 689
            E   Q  ++YV        +  L +LF + G + +  +    V G  +G+GFV F   E+A+ A++ ++   + G  ++++   + +K+                      G N+++ NLD  VD+  L   F ++G I  + K+M + E+G SKG+ F+ +   E + +A+  MN + +C++ + V+ A +K+ +  +  S   + LA+
Sbjct:  207 ETAKQFTNVYVKNFGDHYNKETLEKLFAKFGNITSCEVMT--VEGKSKGFGFVAFANPEEAETAVQALHDSTIEGTDLKLHVCRAQKKSERHAELKKKHEQHKAERMQKYQGVNLYVKNLDETVDDDGLKKQFESYGNIT-SAKVMTD-ENGRSKGFGFVCFEKPEEATSAVTEMNSKMVCSKPLYVAIAQRKEDRRAQLASQYMQRLAS 412          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Celegans
Match: pab-1 (Polyadenylate-binding protein [Source:UniProtKB/TrEMBL;Acc:Q7K797])

HSP 1 Score: 119.013 bits (297), Expect = 1.638e-28
Identity = 71/183 (38.80%), Postives = 101/183 (55.19%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIGA-NIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERL 680
            AS+YVG L   V E+IL+E F  AGPV+++ + +D  T L  GY +V F    DA+ AM  MN   L+GKP+R+  +         GA NIFI NLD  +D K +YDTFS FG IL     +   E G SKGY F+++ + EA+  AI+ +NG  L  + + V     +  +    G  A++ 
Sbjct:   32 ASLYVGDLHPDVNESILFEKFSAAGPVLSIRVCRDNATRLSLGYAYVNFQQPADAERAMDTMNFEALHGKPMRIMWSQRDPAMRRSGAGNIFIKNLDKVIDNKSIYDTFSLFGNILSCKVAI--DEDGFSKGYGFVHFETEEAAQNAIQKVNGMLLAGKKVFVGKFQPRAQRNRELGETAKQF 212          

HSP 2 Score: 69.3218 bits (168), Expect = 2.185e-12
Identity = 50/210 (23.81%), Postives = 102/210 (48.57%), Query Frame = 3
Query:  117 EERNQDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLD-------------------IGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERLLAA 689
            E   Q  ++YV        +  L +LF + G + +  +    V G  +G+GFV F   E+A+ A++ ++   + G  ++++   + +K+                      G N+++ NLD  VD+  L   F ++G I  + K+M + E+G SKG+ F+ +   E + +A+  MN + +C++ + V+ A +K+ +  +  S   + LA+
Sbjct:  207 ETAKQFTNVYVKNFGDHYNKETLEKLFAKFGNITSCEVMT--VEGKSKGFGFVAFANPEEAETAVQALHDSTIEGTDLKLHVCRAQKKSERHAELKKKHEQHKAERMQKYQGVNLYVKNLDETVDDDGLKKQFESYGNIT-SAKVMTD-ENGRSKGFGFVCFEKPEEATSAVTEMNSKMVCSKPLYVAIAQRKEDRRAQLASQYMQRLAS 412          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Fly
Match: Spx (gene:FBgn0015818 transcript:FBtr0070894)

HSP 1 Score: 382.489 bits (981), Expect = 5.346e-131
Identity = 178/214 (83.18%), Postives = 195/214 (91.12%), Query Frame = 3
Query:   99 MTVGAIEERNQDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADG 740
            M  G I ERNQDA+IY GGLD KV+E +LWELF+QAGPVVNVHMPKDRVT +HQGYGFVEFL EEDADY +KIMNMIKLYGKPIRVNKAS+H+KNLD+GANIFIGNLD EVDEKLLYDTFSAFGVILQTPKIMR+ E+G SK +AFIN+ASFEASDAA++AMNGQYLCNR I+VSYAFKKD KGERHGSAAERLLAAQNP + ADRPHQLFAD 
Sbjct:    1 MAAGPIAERNQDATIYAGGLDDKVSETLLWELFVQAGPVVNVHMPKDRVTQMHQGYGFVEFLSEEDADYGIKIMNMIKLYGKPIRVNKASAHQKNLDVGANIFIGNLDVEVDEKLLYDTFSAFGVILQTPKIMRDPETGKSKSFAFINFASFEASDAAMDAMNGQYLCNRPISVSYAFKKDHKGERHGSAAERLLAAQNPSTHADRPHQLFADA 214          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Fly
Match: pAbp (gene:FBgn0265297 transcript:FBtr0086738)

HSP 1 Score: 114.005 bits (284), Expect = 9.331e-27
Identity = 68/183 (37.16%), Postives = 107/183 (58.47%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRV---NKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAE 674
            AS+YVG L   V E+ L++ F  AGPV+++ + +D +T    GY +V F    DA+ A+  MN   +  KPIR+    +  S R++  +G N+FI NLD  +D K +YDTFSAFG IL   K+  + E GNSKGY F+++ + EA++ +I+ +NG  L  + + V     +  + +  G  A+
Sbjct:    2 ASLYVGDLPQDVNESGLFDKFSSAGPVLSIRVCRDVITRRSLGYAYVNFQQPADAERALDTMNFDLVRNKPIRIMWSQRDPSLRRS-GVG-NVFIKNLDRAIDNKAIYDTFSAFGNILSC-KVATD-EKGNSKGYGFVHFETEEAANTSIDKVNGMLLNGKKVYVGKFIPRKEREKELGEKAK 180          

HSP 2 Score: 70.8626 bits (172), Expect = 9.181e-13
Identity = 50/189 (26.46%), Postives = 100/189 (52.91%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNK-ASSHRKNLDIG------ANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCN-RAITVSYAFKKDSKGERHGSAAERL 680
            ++++  LD  +    +++ F   G +++  +  D   G  +GYGFV F  EE A+ ++  +N + L GK + V K      +  ++G       N+++ N   + D++ L + F  +G I  + K+M + E G SKG+ F+ + + EA++AA++A+NG+ +   +++ V+ A KK  + +      E L
Sbjct:   91 NVFIKNLDRAIDNKAIYDTFSAFGNILSCKVATDE-KGNSKGYGFVHFETEEAANTSIDKVNGMLLNGKKVYVGKFIPRKEREKELGEKAKLFTNVYVKNFTEDFDDEKLKEFFEPYGKIT-SYKVMSK-EDGKSKGFGFVAFETTEAAEAAVQALNGKDMGEGKSLYVARAQKKAERQQELKRKFEEL 276          

HSP 3 Score: 58.5362 bits (140), Expect = 7.473e-9
Identity = 46/188 (24.47%), Postives = 89/188 (47.34%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKL-YGKPI---RVNKASSHRKNLD--------------IGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSK 647
            ++YV        +  L E F   G + +  +   +  G  +G+GFV F   E A+ A++ +N   +  GK +   R  K +  ++ L                G N+++ NLD  +D+  L   FS +G I  + K+M + E G SKG+ F+ + +   +  A+  +NG+ + ++ + V+ A +K+ +
Sbjct:  184 NVYVKNFTEDFDDEKLKEFFEPYGKITSYKV-MSKEDGKSKGFGFVAFETTEAAEAAVQALNGKDMGEGKSLYVARAQKKAERQQELKRKFEELKQKRHESVFGVNLYVKNLDDTIDDDRLRIAFSPYGNIT-SAKVMTD-EEGRSKGFGFVCFNAASEATCAVTELNGRVVGSKPLYVALAQRKEER 368          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Fly
Match: pAbp (gene:FBgn0265297 transcript:FBtr0086736)

HSP 1 Score: 114.005 bits (284), Expect = 9.331e-27
Identity = 68/183 (37.16%), Postives = 107/183 (58.47%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRV---NKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAE 674
            AS+YVG L   V E+ L++ F  AGPV+++ + +D +T    GY +V F    DA+ A+  MN   +  KPIR+    +  S R++  +G N+FI NLD  +D K +YDTFSAFG IL   K+  + E GNSKGY F+++ + EA++ +I+ +NG  L  + + V     +  + +  G  A+
Sbjct:    2 ASLYVGDLPQDVNESGLFDKFSSAGPVLSIRVCRDVITRRSLGYAYVNFQQPADAERALDTMNFDLVRNKPIRIMWSQRDPSLRRS-GVG-NVFIKNLDRAIDNKAIYDTFSAFGNILSC-KVATD-EKGNSKGYGFVHFETEEAANTSIDKVNGMLLNGKKVYVGKFIPRKEREKELGEKAK 180          

HSP 2 Score: 70.8626 bits (172), Expect = 9.181e-13
Identity = 50/189 (26.46%), Postives = 100/189 (52.91%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNK-ASSHRKNLDIG------ANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCN-RAITVSYAFKKDSKGERHGSAAERL 680
            ++++  LD  +    +++ F   G +++  +  D   G  +GYGFV F  EE A+ ++  +N + L GK + V K      +  ++G       N+++ N   + D++ L + F  +G I  + K+M + E G SKG+ F+ + + EA++AA++A+NG+ +   +++ V+ A KK  + +      E L
Sbjct:   91 NVFIKNLDRAIDNKAIYDTFSAFGNILSCKVATDE-KGNSKGYGFVHFETEEAANTSIDKVNGMLLNGKKVYVGKFIPRKEREKELGEKAKLFTNVYVKNFTEDFDDEKLKEFFEPYGKIT-SYKVMSK-EDGKSKGFGFVAFETTEAAEAAVQALNGKDMGEGKSLYVARAQKKAERQQELKRKFEEL 276          

HSP 3 Score: 58.5362 bits (140), Expect = 7.473e-9
Identity = 46/188 (24.47%), Postives = 89/188 (47.34%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKL-YGKPI---RVNKASSHRKNLD--------------IGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSK 647
            ++YV        +  L E F   G + +  +   +  G  +G+GFV F   E A+ A++ +N   +  GK +   R  K +  ++ L                G N+++ NLD  +D+  L   FS +G I  + K+M + E G SKG+ F+ + +   +  A+  +NG+ + ++ + V+ A +K+ +
Sbjct:  184 NVYVKNFTEDFDDEKLKEFFEPYGKITSYKV-MSKEDGKSKGFGFVAFETTEAAEAAVQALNGKDMGEGKSLYVARAQKKAERQQELKRKFEELKQKRHESVFGVNLYVKNLDDTIDDDRLRIAFSPYGNIT-SAKVMTD-EEGRSKGFGFVCFNAASEATCAVTELNGRVVGSKPLYVALAQRKEER 368          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Fly
Match: pAbp (gene:FBgn0265297 transcript:FBtr0086740)

HSP 1 Score: 114.005 bits (284), Expect = 9.331e-27
Identity = 68/183 (37.16%), Postives = 107/183 (58.47%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRV---NKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAE 674
            AS+YVG L   V E+ L++ F  AGPV+++ + +D +T    GY +V F    DA+ A+  MN   +  KPIR+    +  S R++  +G N+FI NLD  +D K +YDTFSAFG IL   K+  + E GNSKGY F+++ + EA++ +I+ +NG  L  + + V     +  + +  G  A+
Sbjct:    2 ASLYVGDLPQDVNESGLFDKFSSAGPVLSIRVCRDVITRRSLGYAYVNFQQPADAERALDTMNFDLVRNKPIRIMWSQRDPSLRRS-GVG-NVFIKNLDRAIDNKAIYDTFSAFGNILSC-KVATD-EKGNSKGYGFVHFETEEAANTSIDKVNGMLLNGKKVYVGKFIPRKEREKELGEKAK 180          

HSP 2 Score: 70.8626 bits (172), Expect = 9.181e-13
Identity = 50/189 (26.46%), Postives = 100/189 (52.91%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNK-ASSHRKNLDIG------ANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCN-RAITVSYAFKKDSKGERHGSAAERL 680
            ++++  LD  +    +++ F   G +++  +  D   G  +GYGFV F  EE A+ ++  +N + L GK + V K      +  ++G       N+++ N   + D++ L + F  +G I  + K+M + E G SKG+ F+ + + EA++AA++A+NG+ +   +++ V+ A KK  + +      E L
Sbjct:   91 NVFIKNLDRAIDNKAIYDTFSAFGNILSCKVATDE-KGNSKGYGFVHFETEEAANTSIDKVNGMLLNGKKVYVGKFIPRKEREKELGEKAKLFTNVYVKNFTEDFDDEKLKEFFEPYGKIT-SYKVMSK-EDGKSKGFGFVAFETTEAAEAAVQALNGKDMGEGKSLYVARAQKKAERQQELKRKFEEL 276          

HSP 3 Score: 58.5362 bits (140), Expect = 7.473e-9
Identity = 46/188 (24.47%), Postives = 89/188 (47.34%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKL-YGKPI---RVNKASSHRKNLD--------------IGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSK 647
            ++YV        +  L E F   G + +  +   +  G  +G+GFV F   E A+ A++ +N   +  GK +   R  K +  ++ L                G N+++ NLD  +D+  L   FS +G I  + K+M + E G SKG+ F+ + +   +  A+  +NG+ + ++ + V+ A +K+ +
Sbjct:  184 NVYVKNFTEDFDDEKLKEFFEPYGKITSYKV-MSKEDGKSKGFGFVAFETTEAAEAAVQALNGKDMGEGKSLYVARAQKKAERQQELKRKFEELKQKRHESVFGVNLYVKNLDDTIDDDRLRIAFSPYGNIT-SAKVMTD-EEGRSKGFGFVCFNAASEATCAVTELNGRVVGSKPLYVALAQRKEER 368          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Fly
Match: Rox8 (gene:FBgn0005649 transcript:FBtr0084592)

HSP 1 Score: 100.138 bits (248), Expect = 1.631e-22
Identity = 60/177 (33.90%), Postives = 104/177 (58.76%), Query Frame = 3
Query:  120 ERNQDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASS--HRKNLDIGAN--IFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKK 638
            + +Q  ++YVG LD  V+E +L  LF   GPV +  +   R  G +  Y F+E+   + A  A+  MN      K I+VN A+S  ++   DI ++  IF+G+L PE++ + L + F+ FG I    +I+R+  +  SKGYAF+++     ++ AI+AMNGQ++ +R+I  +++ +K
Sbjct:    2 DESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKI--IREPG-NDPYAFIEYSNYQAATTALTAMNKRLFLEKEIKVNWATSPGNQPKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNC-RIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWSTRK 174          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Zebrafish
Match: sf3b4 (splicing factor 3b, subunit 4 [Source:ZFIN;Acc:ZDB-GENE-020419-22])

HSP 1 Score: 405.216 bits (1040), Expect = 5.556e-139
Identity = 188/214 (87.85%), Postives = 201/214 (93.93%), Query Frame = 3
Query:   99 MTVGAIEERNQDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADG 740
            M  G I ERNQDA++YVGGLD KV+E +LWELFLQAGPVVN HMPKDRVTG HQGYGFVEFL EEDADYA+KIMNMIKLYGKPIRVNKAS+H KNLD+GANIFIGNLDPE+DEKLLYDTFSAFGVILQTPKIMR+ ++GNSKGYAFIN+ASF+ASDAAIEAMNGQYLCNR ITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFAD 
Sbjct:    1 MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADA 214          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Zebrafish
Match: pabpc4 (poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:ZFIN;Acc:ZDB-GENE-030131-9663])

HSP 1 Score: 129.798 bits (325), Expect = 4.388e-32
Identity = 77/184 (41.85%), Postives = 110/184 (59.78%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRV---NKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITV-SYAFKKDSKGERHGSAAE 674
            AS+YVG L   +TEA+L+E F  AGPV+++ + +D +T    GY +V F    DA+ A+  MN   + GKPIR+    +  S RK+  +G N+FI NLD  +D K LYDTFSAFG IL    +  E     SKGYAF+++ + +A+D AIE MNG  L +R + V  +  +K+ + E    A E
Sbjct:   12 ASLYVGDLHPDITEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVVKGKPIRIMWSQRDPSLRKS-GVG-NVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDEN---GSKGYAFVHFETQDAADRAIEKMNGMLLNDRKVFVGRFKSRKEREAEMGAKAKE 190          

HSP 2 Score: 82.0333 bits (201), Expect = 2.932e-16
Identity = 56/187 (29.95%), Postives = 97/187 (51.87%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKAS-----------------SHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSK 647
            ++Y+      + +  L ELF + G  ++V +  D  TG  +G+GFV +   EDA+ A++ MN  +L GK + V +A                    R +   G N++I NLD  +D++ L   FS FG I  + K+M   E G SKG+ F+ ++S E +  A+  MNG+ + ++ + V+ A +K+ +
Sbjct:  193 NVYIKNFGDDMDDQRLKELFDKYGKTLSVKVMTD-PTGKSRGFGFVSYEKHEDANKAVEEMNGTELNGKTVFVGRAQKKMERQAELKRKFEQLKQERISRYQGVNLYIKNLDDTIDDEKLRKEFSPFGSIT-SAKVM--LEEGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEER 375          

HSP 3 Score: 70.4774 bits (171), Expect = 1.394e-12
Identity = 47/174 (27.01%), Postives = 91/174 (52.30%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHR-KNLDIGA------NIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKK 638
            ++++  LD  +    L++ F   G +++  +  D      +GY FV F  ++ AD A++ MN + L  + + V +  S + +  ++GA      N++I N   ++D++ L + F  +G  L   K+M +  +G S+G+ F++Y   E ++ A+E MNG  L  + + V  A KK
Sbjct:  101 NVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDE--NGSKGYAFVHFETQDAADRAIEKMNGMLLNDRKVFVGRFKSRKEREAEMGAKAKEFTNVYIKNFGDDMDDQRLKELFDKYGKTLSV-KVMTDP-TGKSRGFGFVSYEKHEDANKAVEEMNGTELNGKTVFVGRAQKK 270          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Zebrafish
Match: pabpc4 (poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:ZFIN;Acc:ZDB-GENE-030131-9663])

HSP 1 Score: 130.183 bits (326), Expect = 4.502e-32
Identity = 77/184 (41.85%), Postives = 110/184 (59.78%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRV---NKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITV-SYAFKKDSKGERHGSAAE 674
            AS+YVG L   +TEA+L+E F  AGPV+++ + +D +T    GY +V F    DA+ A+  MN   + GKPIR+    +  S RK+  +G N+FI NLD  +D K LYDTFSAFG IL    +  E     SKGYAF+++ + +A+D AIE MNG  L +R + V  +  +K+ + E    A E
Sbjct:   12 ASLYVGDLHPDITEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVVKGKPIRIMWSQRDPSLRKS-GVG-NVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDEN---GSKGYAFVHFETQDAADRAIEKMNGMLLNDRKVFVGRFKSRKEREAEMGAKAKE 190          

HSP 2 Score: 82.4185 bits (202), Expect = 2.707e-16
Identity = 56/187 (29.95%), Postives = 97/187 (51.87%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKAS-----------------SHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSK 647
            ++Y+      + +  L ELF + G  ++V +  D  TG  +G+GFV +   EDA+ A++ MN  +L GK + V +A                    R +   G N++I NLD  +D++ L   FS FG I  + K+M   E G SKG+ F+ ++S E +  A+  MNG+ + ++ + V+ A +K+ +
Sbjct:  193 NVYIKNFGDDMDDQRLKELFDKYGKTLSVKVMTD-PTGKSRGFGFVSYEKHEDANKAVEEMNGTELNGKTVFVGRAQKKMERQAELKRKFEQLKQERISRYQGVNLYIKNLDDTIDDEKLRKEFSPFGSIT-SAKVM--LEEGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEER 375          

HSP 3 Score: 70.8626 bits (172), Expect = 1.245e-12
Identity = 47/174 (27.01%), Postives = 91/174 (52.30%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHR-KNLDIGA------NIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKK 638
            ++++  LD  +    L++ F   G +++  +  D      +GY FV F  ++ AD A++ MN + L  + + V +  S + +  ++GA      N++I N   ++D++ L + F  +G  L   K+M +  +G S+G+ F++Y   E ++ A+E MNG  L  + + V  A KK
Sbjct:  101 NVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDE--NGSKGYAFVHFETQDAADRAIEKMNGMLLNDRKVFVGRFKSRKEREAEMGAKAKEFTNVYIKNFGDDMDDQRLKELFDKYGKTLSV-KVMTDP-TGKSRGFGFVSYEKHEDANKAVEEMNGTELNGKTVFVGRAQKK 270          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Zebrafish
Match: pabpc4 (poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:ZFIN;Acc:ZDB-GENE-030131-9663])

HSP 1 Score: 130.183 bits (326), Expect = 4.502e-32
Identity = 77/184 (41.85%), Postives = 110/184 (59.78%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRV---NKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITV-SYAFKKDSKGERHGSAAE 674
            AS+YVG L   +TEA+L+E F  AGPV+++ + +D +T    GY +V F    DA+ A+  MN   + GKPIR+    +  S RK+  +G N+FI NLD  +D K LYDTFSAFG IL    +  E     SKGYAF+++ + +A+D AIE MNG  L +R + V  +  +K+ + E    A E
Sbjct:   12 ASLYVGDLHPDITEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVVKGKPIRIMWSQRDPSLRKS-GVG-NVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDEN---GSKGYAFVHFETQDAADRAIEKMNGMLLNDRKVFVGRFKSRKEREAEMGAKAKE 190          

HSP 2 Score: 82.4185 bits (202), Expect = 2.707e-16
Identity = 56/187 (29.95%), Postives = 97/187 (51.87%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKAS-----------------SHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSK 647
            ++Y+      + +  L ELF + G  ++V +  D  TG  +G+GFV +   EDA+ A++ MN  +L GK + V +A                    R +   G N++I NLD  +D++ L   FS FG I  + K+M   E G SKG+ F+ ++S E +  A+  MNG+ + ++ + V+ A +K+ +
Sbjct:  193 NVYIKNFGDDMDDQRLKELFDKYGKTLSVKVMTD-PTGKSRGFGFVSYEKHEDANKAVEEMNGTELNGKTVFVGRAQKKMERQAELKRKFEQLKQERISRYQGVNLYIKNLDDTIDDEKLRKEFSPFGSIT-SAKVM--LEEGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEER 375          

HSP 3 Score: 70.8626 bits (172), Expect = 1.245e-12
Identity = 47/174 (27.01%), Postives = 91/174 (52.30%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHR-KNLDIGA------NIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKK 638
            ++++  LD  +    L++ F   G +++  +  D      +GY FV F  ++ AD A++ MN + L  + + V +  S + +  ++GA      N++I N   ++D++ L + F  +G  L   K+M +  +G S+G+ F++Y   E ++ A+E MNG  L  + + V  A KK
Sbjct:  101 NVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDE--NGSKGYAFVHFETQDAADRAIEKMNGMLLNDRKVFVGRFKSRKEREAEMGAKAKEFTNVYIKNFGDDMDDQRLKELFDKYGKTLSV-KVMTDP-TGKSRGFGFVSYEKHEDANKAVEEMNGTELNGKTVFVGRAQKK 270          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Zebrafish
Match: pabpc1a (poly(A) binding protein, cytoplasmic 1a [Source:ZFIN;Acc:ZDB-GENE-030131-3238])

HSP 1 Score: 127.487 bits (319), Expect = 3.654e-31
Identity = 75/184 (40.76%), Postives = 109/184 (59.24%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRV---NKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITV-SYAFKKDSKGERHGSAAE 674
            AS+YVG L   VTEA+L+E F  AGP++++ + +D +T    GY +V F    DA+ A+  MN   + G+P+R+    +  S RK+  +G NIFI NLD  +D K LYDTFSAFG IL    +  E     SKGY F+++ + EA++ AIE MNG  L +R + V  +  +K+ + E    A E
Sbjct:   11 ASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMMTRRSLGYAYVNFQQPADAERALDTMNFDVIKGRPVRIMWSQRDPSLRKS-GVG-NIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDEN---GSKGYGFVHFETHEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAEMGARAKE 189          

HSP 2 Score: 82.4185 bits (202), Expect = 2.602e-16
Identity = 53/187 (28.34%), Postives = 93/187 (49.73%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSH-----------------RKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSK 647
            ++Y+      + +  L E+F + GP +++ +  D  +G  +G+GFV F   EDA  A+  MN  ++ GK + V +A                    R     G N+++ NLD  +D++ L   FS FG I    K+M   E G SKG+ F+ ++S E +  A+  MNG+ +  + + V+ A +K+ +
Sbjct:  192 NVYIKNFGEDMDDEKLKEIFCKYGPALSIRVMTDD-SGKSKGFGFVSFERHEDAQRAVDEMNGKEMNGKQVYVGRAQKKGERQTELKRKFEQMKQDRMTRYQGVNLYVKNLDDGLDDERLRKEFSPFGTITSA-KVM--MEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEER 374          

HSP 3 Score: 70.4774 bits (171), Expect = 1.750e-12
Identity = 50/181 (27.62%), Postives = 95/181 (52.49%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHR-KNLDIGA------NIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERH 659
            +I++  LD  +    L++ F   G +++  +  D      +GYGFV F   E A+ A++ MN + L  + + V +  S + +  ++GA      N++I N   ++D++ L + F  +G  L   ++M + +SG SKG+ F+++   E +  A++ MNG+ +  + + V  A K   KGER 
Sbjct:  100 NIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDE--NGSKGYGFVHFETHEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAEMGARAKEFTNVYIKNFGEDMDDEKLKEIFCKYGPALSI-RVMTD-DSGKSKGFGFVSFERHEDAQRAVDEMNGKEMNGKQVYVGRAQK---KGERQ 273          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Xenopus
Match: hoxa3 (homeobox A3 [Source:Xenbase;Acc:XB-GENE-482267])

HSP 1 Score: 405.986 bits (1042), Expect = 2.405e-139
Identity = 188/213 (88.26%), Postives = 201/213 (94.37%), Query Frame = 3
Query:   99 MTVGAIEERNQDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFAD 737
            M  G I ERNQDA++YVGGLD KV+E +LWELFLQAGPVVN HMPKDRVTG HQGYGFVEFL EEDADYA+KIMNMIKLYGKPIRVNKAS+H KNLD+GANIFIGNLDPE+DEKLLYDTFSAFGVILQTPKIMR+ ++GNSKGYAFIN+ASF+ASDAAIEAMNGQYLCNR ITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFAD
Sbjct:    1 MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFAD 213          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Xenopus
Match: hoxa3 (homeobox A3 [Source:Xenbase;Acc:XB-GENE-482267])

HSP 1 Score: 387.882 bits (995), Expect = 4.567e-132
Identity = 180/201 (89.55%), Postives = 193/201 (96.02%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFAD 737
            A++YVGGLD KV+E +LWELFLQAGPVVN HMPKDRVTG HQGYGFVEFL EEDADYA+KIMNMIKLYGKPIRVNKAS+H KNLD+GANIFIGNLDPE+DEKLLYDTFSAFGVILQTPKIMR+ ++GNSKGYAFIN+ASF+ASDAAIEAMNGQYLCNR ITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFAD
Sbjct:   19 ATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFAD 219          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Xenopus
Match: pabpc4 (poly(A) binding protein cytoplasmic 4 [Source:NCBI gene;Acc:548470])

HSP 1 Score: 129.413 bits (324), Expect = 1.814e-34
Identity = 77/184 (41.85%), Postives = 110/184 (59.78%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRV---NKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITV-SYAFKKDSKGERHGSAAE 674
            AS+YVG L   VTEA+L+E F  AGPV+++ + +D +T    GY +V F    DA+ A+  MN   + GKPIR+    +  S RK+  +G N+FI NLD  +D K LYDTFSAFG IL    +  E     SKGYAF+++ + +A+D AIE MNG  L +R + V  +  +++ + E    A E
Sbjct:   11 ASLYVGDLHPDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKS-GVG-NVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDEN---GSKGYAFVHFETQDAADRAIEKMNGMLLNDRKVFVGRFKCRREREAELGAKAKE 189          

HSP 2 Score: 48.1358 bits (113), Expect = 7.835e-6
Identity = 30/119 (25.21%), Postives = 61/119 (51.26%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHR-KNLDIGA------NIFIGNLDPEVDEKLLYDTFSAFGV 473
            ++++  LD  +    L++ F   G +++  +  D      +GY FV F  ++ AD A++ MN + L  + + V +    R +  ++GA      N++I N   ++D++ L +TFS +G 
Sbjct:  100 NVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDE--NGSKGYAFVHFETQDAADRAIEKMNGMLLNDRKVFVGRFKCRREREAELGAKAKEFTNVYIKNFGEDMDDERLKETFSKYGC 216          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Xenopus
Match: pabpc4 (poly(A) binding protein cytoplasmic 4 [Source:NCBI gene;Acc:548470])

HSP 1 Score: 129.413 bits (324), Expect = 7.790e-33
Identity = 77/184 (41.85%), Postives = 110/184 (59.78%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRV---NKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITV-SYAFKKDSKGERHGSAAE 674
            AS+YVG L   VTEA+L+E F  AGPV+++ + +D +T    GY +V F    DA+ A+  MN   + GKPIR+    +  S RK+  +G N+FI NLD  +D K LYDTFSAFG IL    +  E     SKGYAF+++ + +A+D AIE MNG  L +R + V  +  +++ + E    A E
Sbjct:   11 ASLYVGDLHPDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKS-GVG-NVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDEN---GSKGYAFVHFETQDAADRAIEKMNGMLLNDRKVFVGRFKCRREREAELGAKAKE 189          

HSP 2 Score: 72.0182 bits (175), Expect = 4.159e-13
Identity = 48/174 (27.59%), Postives = 93/174 (53.45%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHR-KNLDIGA------NIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKK 638
            ++++  LD  +    L++ F   G +++  +  D      +GY FV F  ++ AD A++ MN + L  + + V +    R +  ++GA      N++I N   ++D++ L +TFS +G  L   K+M +  SG SKG+ F+++   E ++ A++ MNG+ +  + + V  A KK
Sbjct:  100 NVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDE--NGSKGYAFVHFETQDAADRAIEKMNGMLLNDRKVFVGRFKCRREREAELGAKAKEFTNVYIKNFGEDMDDERLKETFSKYGKTLSV-KVMTDP-SGKSKGFGFVSFERHEDANKAVDDMNGKDVNGKIMFVGRAQKK 269          

HSP 3 Score: 71.2478 bits (173), Expect = 7.093e-13
Identity = 52/180 (28.89%), Postives = 89/180 (49.44%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASS-----------------HRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVS 623
             ++Y+      + +  L E F + G  ++V +  D  +G  +G+GFV F   EDA+ A+  MN   + GK + V +A                    R +   G N++I NLD  +D++ L   FS FG I  + K+M   E G SKG+ F+ ++S E +  A+  MNG+ + ++ + V+
Sbjct:  191 TNVYIKNFGEDMDDERLKETFSKYGKTLSVKVMTD-PSGKSKGFGFVSFERHEDANKAVDDMNGKDVNGKIMFVGRAQKKVERQAELKRRFEQLKQERISRYQGVNLYIKNLDDTIDDEKLRKEFSPFGSIT-SAKVM--LEEGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVA 366          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Xenopus
Match: pabpc4 (poly(A) binding protein cytoplasmic 4 [Source:NCBI gene;Acc:548470])

HSP 1 Score: 130.183 bits (326), Expect = 3.426e-32
Identity = 77/184 (41.85%), Postives = 110/184 (59.78%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRV---NKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITV-SYAFKKDSKGERHGSAAE 674
            AS+YVG L   VTEA+L+E F  AGPV+++ + +D +T    GY +V F    DA+ A+  MN   + GKPIR+    +  S RK+  +G N+FI NLD  +D K LYDTFSAFG IL    +  E     SKGYAF+++ + +A+D AIE MNG  L +R + V  +  +++ + E    A E
Sbjct:   11 ASLYVGDLHPDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKS-GVG-NVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDEN---GSKGYAFVHFETQDAADRAIEKMNGMLLNDRKVFVGRFKCRREREAELGAKAKE 189          

HSP 2 Score: 74.7146 bits (182), Expect = 8.768e-14
Identity = 54/188 (28.72%), Postives = 94/188 (50.00%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKAS-----------------SHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSK 647
             ++Y+      + +  L E F + G  ++V +  D  +G  +G+GFV F   EDA+ A+  MN   + GK + V +A                    R +   G N++I NLD  +D++ L   FS FG I  + K+M   E G SKG+ F+ ++S E +  A+  MNG+ + ++ + V+ A +K+ +
Sbjct:  191 TNVYIKNFGEDMDDERLKETFSKYGKTLSVKVMTD-PSGKSKGFGFVSFERHEDANKAVDDMNGKDVNGKIMFVGRAQKKVERQAELKRRFEQLKQERISRYQGVNLYIKNLDDTIDDEKLRKEFSPFGSIT-SAKVM--LEEGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEER 374          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Mouse
Match: Sf3b4 (splicing factor 3b, subunit 4 [Source:MGI Symbol;Acc:MGI:109580])

HSP 1 Score: 400.208 bits (1027), Expect = 1.215e-136
Identity = 186/211 (88.15%), Postives = 199/211 (94.31%), Query Frame = 3
Query:   99 MTVGAIEERNQDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLF 731
            M  G I ERNQDA++YVGGLD KV+E +LWELFLQAGPVVN HMPKDRVTG HQGYGFVEFL EEDADYA+KIMNMIKLYGKPIRVNKAS+H KNLD+GANIFIGNLDPE+DEKLLYDTFSAFGVILQTPKIMR+ ++GNSKGYAFIN+ASF+ASDAAIEAMNGQYLCNR ITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLF
Sbjct:    1 MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLF 211          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Mouse
Match: Pabpc4 (poly(A) binding protein, cytoplasmic 4 [Source:MGI Symbol;Acc:MGI:2385206])

HSP 1 Score: 129.798 bits (325), Expect = 2.587e-35
Identity = 74/163 (45.40%), Postives = 101/163 (61.96%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRV---NKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAI 614
            AS+YVG L   VTEA+L+E F  AGPV+++ + +D +T    GY +V F    DA+ A+  MN   + GKPIR+    +  S RK+  +G N+FI NLD  +D K LYDTFSAFG IL    +  E     SKGYAF+++ + EA+D AIE MNG  L +R +
Sbjct:   11 ASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVMKGKPIRIMWSQRDPSLRKS-GVG-NVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDEN---GSKGYAFVHFETQEAADKAIEKMNGMLLNDRKV 168          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Mouse
Match: Pabpc4 (poly(A) binding protein, cytoplasmic 4 [Source:MGI Symbol;Acc:MGI:2385206])

HSP 1 Score: 132.88 bits (333), Expect = 4.165e-33
Identity = 79/184 (42.93%), Postives = 110/184 (59.78%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRV---NKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITV-SYAFKKDSKGERHGSAAE 674
            AS+YVG L   VTEA+L+E F  AGPV+++ + +D +T    GY +V F    DA+ A+  MN   + GKPIR+    +  S RK+  +G N+FI NLD  +D K LYDTFSAFG IL    +  E     SKGYAF+++ + EA+D AIE MNG  L +R + V  +  +K+ + E    A E
Sbjct:   11 ASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVMKGKPIRIMWSQRDPSLRKS-GVG-NVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDEN---GSKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKE 189          

HSP 2 Score: 85.1149 bits (209), Expect = 3.865e-17
Identity = 56/174 (32.18%), Postives = 95/174 (54.60%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHR-KNLDIGA------NIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKK 638
            ++++  LD  +    L++ F   G +++  +  D      +GY FV F  +E AD A++ MN + L  + + V +  S + +  ++GA      N++I N   EVD+  L + FS FG  L   K+MR++ SG SKG+ F++Y   E ++ A+E MNG+ +  +AI V  A KK
Sbjct:  100 NVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGS--KGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGEEVDDGNLKELFSQFGKTLSV-KVMRDS-SGKSKGFGFVSYEKHEDANKAVEEMNGKEMSGKAIFVGRAQKK 269          

HSP 3 Score: 84.7297 bits (208), Expect = 4.622e-17
Identity = 57/187 (30.48%), Postives = 99/187 (52.94%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKAS-----------------SHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSK 647
            ++Y+     +V +  L ELF Q G  ++V + +D  +G  +G+GFV +   EDA+ A++ MN  ++ GK I V +A                    R +   G N++I NLD  +D++ L   FS FG I  + K+M   E G SKG+ F+ ++S E +  A+  MNG+ + ++ + V+ A +K+ +
Sbjct:  192 NVYIKNFGEEVDDGNLKELFSQFGKTLSVKVMRDS-SGKSKGFGFVSYEKHEDANKAVEEMNGKEMSGKAIFVGRAQKKVERQAELKRKFEQLKQERISRYQGVNLYIKNLDDTIDDEKLRREFSPFGSIT-SAKVM--LEDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEER 374          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Mouse
Match: Pabpc4 (poly(A) binding protein, cytoplasmic 4 [Source:MGI Symbol;Acc:MGI:2385206])

HSP 1 Score: 132.88 bits (333), Expect = 4.738e-33
Identity = 79/184 (42.93%), Postives = 110/184 (59.78%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRV---NKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITV-SYAFKKDSKGERHGSAAE 674
            AS+YVG L   VTEA+L+E F  AGPV+++ + +D +T    GY +V F    DA+ A+  MN   + GKPIR+    +  S RK+  +G N+FI NLD  +D K LYDTFSAFG IL    +  E     SKGYAF+++ + EA+D AIE MNG  L +R + V  +  +K+ + E    A E
Sbjct:   11 ASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVMKGKPIRIMWSQRDPSLRKS-GVG-NVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDEN---GSKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKE 189          

HSP 2 Score: 84.7297 bits (208), Expect = 4.287e-17
Identity = 56/174 (32.18%), Postives = 95/174 (54.60%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHR-KNLDIGA------NIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKK 638
            ++++  LD  +    L++ F   G +++  +  D      +GY FV F  +E AD A++ MN + L  + + V +  S + +  ++GA      N++I N   EVD+  L + FS FG  L   K+MR++ SG SKG+ F++Y   E ++ A+E MNG+ +  +AI V  A KK
Sbjct:  100 NVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDE--NGSKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGEEVDDGNLKELFSQFGKTLSV-KVMRDS-SGKSKGFGFVSYEKHEDANKAVEEMNGKEMSGKAIFVGRAQKK 269          

HSP 3 Score: 84.7297 bits (208), Expect = 5.127e-17
Identity = 57/187 (30.48%), Postives = 99/187 (52.94%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKAS-----------------SHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSK 647
            ++Y+     +V +  L ELF Q G  ++V + +D  +G  +G+GFV +   EDA+ A++ MN  ++ GK I V +A                    R +   G N++I NLD  +D++ L   FS FG I  + K+M   E G SKG+ F+ ++S E +  A+  MNG+ + ++ + V+ A +K+ +
Sbjct:  192 NVYIKNFGEEVDDGNLKELFSQFGKTLSVKVMRDS-SGKSKGFGFVSYEKHEDANKAVEEMNGKEMSGKAIFVGRAQKKVERQAELKRKFEQLKQERISRYQGVNLYIKNLDDTIDDEKLRREFSPFGSIT-SAKVM--LEDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEER 374          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Mouse
Match: Pabpc4 (poly(A) binding protein, cytoplasmic 4 [Source:MGI Symbol;Acc:MGI:2385206])

HSP 1 Score: 132.88 bits (333), Expect = 4.875e-33
Identity = 79/184 (42.93%), Postives = 110/184 (59.78%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRV---NKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITV-SYAFKKDSKGERHGSAAE 674
            AS+YVG L   VTEA+L+E F  AGPV+++ + +D +T    GY +V F    DA+ A+  MN   + GKPIR+    +  S RK+  +G N+FI NLD  +D K LYDTFSAFG IL    +  E     SKGYAF+++ + EA+D AIE MNG  L +R + V  +  +K+ + E    A E
Sbjct:   11 ASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVMKGKPIRIMWSQRDPSLRKS-GVG-NVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDEN---GSKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKE 189          

HSP 2 Score: 85.1149 bits (209), Expect = 3.585e-17
Identity = 56/174 (32.18%), Postives = 95/174 (54.60%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHR-KNLDIGA------NIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKK 638
            ++++  LD  +    L++ F   G +++  +  D      +GY FV F  +E AD A++ MN + L  + + V +  S + +  ++GA      N++I N   EVD+  L + FS FG  L   K+MR++ SG SKG+ F++Y   E ++ A+E MNG+ +  +AI V  A KK
Sbjct:  100 NVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDE--NGSKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGEEVDDGNLKELFSQFGKTLSV-KVMRDS-SGKSKGFGFVSYEKHEDANKAVEEMNGKEMSGKAIFVGRAQKK 269          

HSP 3 Score: 84.7297 bits (208), Expect = 4.442e-17
Identity = 57/187 (30.48%), Postives = 99/187 (52.94%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKAS-----------------SHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSK 647
            ++Y+     +V +  L ELF Q G  ++V + +D  +G  +G+GFV +   EDA+ A++ MN  ++ GK I V +A                    R +   G N++I NLD  +D++ L   FS FG I  + K+M   E G SKG+ F+ ++S E +  A+  MNG+ + ++ + V+ A +K+ +
Sbjct:  192 NVYIKNFGEEVDDGNLKELFSQFGKTLSVKVMRDS-SGKSKGFGFVSYEKHEDANKAVEEMNGKEMSGKAIFVGRAQKKVERQAELKRKFEQLKQERISRYQGVNLYIKNLDDTIDDEKLRREFSPFGSIT-SAKVM--LEDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEER 374          
BLAST of Splicing factor 3b subunit 4 vs. UniProt/SwissProt
Match: sp|Q6AYL5|SF3B4_RAT (Splicing factor 3B subunit 4 OS=Rattus norvegicus OX=10116 GN=Sf3b4 PE=2 SV=1)

HSP 1 Score: 400.208 bits (1027), Expect = 8.499e-136
Identity = 186/211 (88.15%), Postives = 199/211 (94.31%), Query Frame = 3
Query:   99 MTVGAIEERNQDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLF 731
            M  G I ERNQDA++YVGGLD KV+E +LWELFLQAGPVVN HMPKDRVTG HQGYGFVEFL EEDADYA+KIMNMIKLYGKPIRVNKAS+H KNLD+GANIFIGNLDPE+DEKLLYDTFSAFGVILQTPKIMR+ ++GNSKGYAFIN+ASF+ASDAAIEAMNGQYLCNR ITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLF
Sbjct:    1 MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLF 211          
BLAST of Splicing factor 3b subunit 4 vs. UniProt/SwissProt
Match: sp|Q8QZY9|SF3B4_MOUSE (Splicing factor 3B subunit 4 OS=Mus musculus OX=10090 GN=Sf3b4 PE=1 SV=1)

HSP 1 Score: 400.208 bits (1027), Expect = 8.499e-136
Identity = 186/211 (88.15%), Postives = 199/211 (94.31%), Query Frame = 3
Query:   99 MTVGAIEERNQDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLF 731
            M  G I ERNQDA++YVGGLD KV+E +LWELFLQAGPVVN HMPKDRVTG HQGYGFVEFL EEDADYA+KIMNMIKLYGKPIRVNKAS+H KNLD+GANIFIGNLDPE+DEKLLYDTFSAFGVILQTPKIMR+ ++GNSKGYAFIN+ASF+ASDAAIEAMNGQYLCNR ITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLF
Sbjct:    1 MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLF 211          
BLAST of Splicing factor 3b subunit 4 vs. UniProt/SwissProt
Match: sp|Q15427|SF3B4_HUMAN (Splicing factor 3B subunit 4 OS=Homo sapiens OX=9606 GN=SF3B4 PE=1 SV=1)

HSP 1 Score: 400.208 bits (1027), Expect = 9.072e-136
Identity = 186/211 (88.15%), Postives = 199/211 (94.31%), Query Frame = 3
Query:   99 MTVGAIEERNQDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLF 731
            M  G I ERNQDA++YVGGLD KV+E +LWELFLQAGPVVN HMPKDRVTG HQGYGFVEFL EEDADYA+KIMNMIKLYGKPIRVNKAS+H KNLD+GANIFIGNLDPE+DEKLLYDTFSAFGVILQTPKIMR+ ++GNSKGYAFIN+ASF+ASDAAIEAMNGQYLCNR ITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLF
Sbjct:    1 MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLF 211          
BLAST of Splicing factor 3b subunit 4 vs. UniProt/SwissProt
Match: sp|Q09442|SF3B4_CAEEL (Splicing factor 3B subunit 4 OS=Caenorhabditis elegans OX=6239 GN=sap-49 PE=1 SV=2)

HSP 1 Score: 375.17 bits (962), Expect = 1.989e-126
Identity = 171/213 (80.28%), Postives = 198/213 (92.96%), Query Frame = 3
Query:   99 MTVGAIEERNQDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFAD 737
            M+ G I ERNQDA+IYVGGLD KV+E+ILWEL +QAGPVV+V+MPKDRVT  HQG+GFVEF+GEEDADYA+KI+NMIKLYGKPI+VNKAS+H KN+D+GANIF+GNLDPEVDEKLLYDTFSAFGVILQ PKIMR+ +SG SKG+AFIN+ASFEASD A+EAMNGQ+LCNRAITVSYAFK+DSKGERHG+AAER+LAAQNPL   DRPHQ+F+D
Sbjct:    1 MSAGPIVERNQDATIYVGGLDEKVSESILWELMVQAGPVVSVNMPKDRVTANHQGFGFVEFMGEEDADYAIKILNMIKLYGKPIKVNKASAHEKNMDVGANIFVGNLDPEVDEKLLYDTFSAFGVILQVPKIMRDVDSGTSKGFAFINFASFEASDTALEAMNGQFLCNRAITVSYAFKRDSKGERHGTAAERMLAAQNPLFPKDRPHQVFSD 213          
BLAST of Splicing factor 3b subunit 4 vs. UniProt/SwissProt
Match: sp|O14102|SAP49_SCHPO (Spliceosome-associated protein 49 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sap49 PE=3 SV=2)

HSP 1 Score: 254.988 bits (650), Expect = 2.405e-80
Identity = 116/183 (63.39%), Postives = 151/183 (82.51%), Query Frame = 3
Query:  117 EERNQDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRK-NLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHG 662
            E+RNQDA+IY+G LD KVT++IL+EL LQAGPVVN+H+P+DRV   H G+GF EFL E+D +YA +I+N +KL+GKPIRVN+AS  R  N  IGAN+F+GNLDP VDE++LYDTFSA G +++ P++ R+ E+G SKGY F++Y SFE +DAAIEAMN Q+L N+ ITVSYAFK++ KGERHG
Sbjct:    5 EDRNQDATIYLGNLDEKVTDSILFELCLQAGPVVNIHIPRDRVRNSHNGFGFCEFLHEQDVEYACQILNQVKLFGKPIRVNRASQDRGVNTLIGANLFVGNLDPLVDERVLYDTFSALGQLVKAPQVARD-ENGRSKGYGFVSYDSFETADAAIEAMNNQFLMNKPITVSYAFKREGKGERHG 186          
BLAST of Splicing factor 3b subunit 4 vs. TrEMBL
Match: A0A0X3NQF5 (Uncharacterized protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR162793 PE=4 SV=1)

HSP 1 Score: 412.535 bits (1059), Expect = 9.688e-139
Identity = 193/215 (89.77%), Postives = 205/215 (95.35%), Query Frame = 3
Query:   96 KMTVGAIEERNQDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADG 740
            KMT G +EERNQDA+IYVGGLD K TEAILWELFLQAGPVVNVHMPKDR+T  HQGYGFVEFL EEDADYAM+IMNMIKLY KPIRVNKAS+++KNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMR+ E+GNSKGYAFIN+ASFEASDAAIEAMNGQYLCNRAIT+SYAFKKDSKGERHGSAAERLLAAQ+PLSQADRPHQLFAD 
Sbjct:    8 KMTTGPVEERNQDATIYVGGLDEKTTEAILWELFLQAGPVVNVHMPKDRITMQHQGYGFVEFLTEEDADYAMRIMNMIKLYNKPIRVNKASANQKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRDPETGNSKGYAFINFASFEASDAAIEAMNGQYLCNRAITISYAFKKDSKGERHGSAAERLLAAQSPLSQADRPHQLFADA 222          
BLAST of Splicing factor 3b subunit 4 vs. TrEMBL
Match: A0A4S2LJ90 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006769 PE=4 SV=1)

HSP 1 Score: 411.764 bits (1057), Expect = 1.091e-138
Identity = 190/214 (88.79%), Postives = 206/214 (96.26%), Query Frame = 3
Query:   99 MTVGAIEERNQDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADG 740
            MTVG +EERNQDA+IYVGGLD K TE+ILWELFLQAGPVVNVHMPKDR+T  HQGYGFVEF+ EEDADYAM+IMNMIKL+GKPIRVNKAS+++KNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMR+ E+GNSKGYAFIN+ASFEASDAAIEAMNGQYLCNRAIT+SYAFKKDSKGERHGSAAERLLAAQ+PLSQA+RPHQLFAD 
Sbjct:    1 MTVGGVEERNQDATIYVGGLDEKTTESILWELFLQAGPVVNVHMPKDRITMQHQGYGFVEFMTEEDADYAMRIMNMIKLFGKPIRVNKASANQKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRDPETGNSKGYAFINFASFEASDAAIEAMNGQYLCNRAITISYAFKKDSKGERHGSAAERLLAAQSPLSQAERPHQLFADA 214          
BLAST of Splicing factor 3b subunit 4 vs. TrEMBL
Match: A0A075A283 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_03828 PE=4 SV=1)

HSP 1 Score: 411.379 bits (1056), Expect = 1.327e-138
Identity = 190/214 (88.79%), Postives = 206/214 (96.26%), Query Frame = 3
Query:   99 MTVGAIEERNQDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADG 740
            MTVG +EERNQDA+IYVGGLD K TE+ILWELFLQAGPVVNVHMPKDR+T  HQGYGFVEF+ EEDADYAM+IMNMIKL+GKPIRVNKAS+++KNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMR+ E+GNSKGYAFIN+ASFEASDAAIEAMNGQYLCNRAIT+SYAFKKDSKGERHGSAAERLLAAQ+PLSQA+RPHQLFAD 
Sbjct:    1 MTVGGVEERNQDATIYVGGLDEKTTESILWELFLQAGPVVNVHMPKDRITMQHQGYGFVEFMTEEDADYAMRIMNMIKLFGKPIRVNKASANQKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRDPETGNSKGYAFINFASFEASDAAIEAMNGQYLCNRAITISYAFKKDSKGERHGSAAERLLAAQSPLSQAERPHQLFADA 214          
BLAST of Splicing factor 3b subunit 4 vs. TrEMBL
Match: G7YT13 (Splicing factor 3B subunit 4 OS=Clonorchis sinensis OX=79923 GN=CLF_109894 PE=4 SV=1)

HSP 1 Score: 411.379 bits (1056), Expect = 1.496e-138
Identity = 190/214 (88.79%), Postives = 206/214 (96.26%), Query Frame = 3
Query:   99 MTVGAIEERNQDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADG 740
            MTVG +EERNQDA+IYVGGLD K TE+ILWELFLQAGPVVNVHMPKDR+T  HQGYGFVEF+ EEDADYAM+IMNMIKL+GKPIRVNKAS+++KNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMR+ E+GNSKGYAFIN+ASFEASDAAIEAMNGQYLCNRAIT+SYAFKKDSKGERHGSAAERLLAAQ+PLSQA+RPHQLFAD 
Sbjct:    1 MTVGGVEERNQDATIYVGGLDEKTTESILWELFLQAGPVVNVHMPKDRITMQHQGYGFVEFMTEEDADYAMRIMNMIKLFGKPIRVNKASANQKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRDPETGNSKGYAFINFASFEASDAAIEAMNGQYLCNRAITISYAFKKDSKGERHGSAAERLLAAQSPLSQAERPHQLFADA 214          
BLAST of Splicing factor 3b subunit 4 vs. TrEMBL
Match: A0A0R3U1G4 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS201 PE=4 SV=1)

HSP 1 Score: 410.223 bits (1053), Expect = 1.680e-138
Identity = 193/213 (90.61%), Postives = 203/213 (95.31%), Query Frame = 3
Query:   99 MTVGAIEERNQDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFAD 737
            M  G +EERNQDA+IYVGGLD K TEAILWELFLQAGPVVNVHMPKDR+T  HQGYGFVEFL EEDADYAM+IMNMIKLY KPIRVNKAS+H+KNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMR+ E+GNSKGYAFINYASFEASDAAIEAMNGQYLCNRAIT+SYAFKKDSKGERHGSAAERLLAAQ+PLSQADRPHQLFAD
Sbjct:    1 MATGPVEERNQDATIYVGGLDEKTTEAILWELFLQAGPVVNVHMPKDRITSQHQGYGFVEFLSEEDADYAMRIMNMIKLYNKPIRVNKASAHQKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRDPETGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITISYAFKKDSKGERHGSAAERLLAAQSPLSQADRPHQLFAD 213          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Cavefish
Match: sf3b4 (splicing factor 3b subunit 4 [Source:NCBI gene;Acc:103043530])

HSP 1 Score: 405.216 bits (1040), Expect = 5.550e-139
Identity = 188/213 (88.26%), Postives = 201/213 (94.37%), Query Frame = 3
Query:   99 MTVGAIEERNQDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFAD 737
            M  G I ERNQDA++YVGGLD KV+E +LWELFLQAGPVVN HMPKDRVTG HQGYGFVEFL EEDADYA+KIMNMIKLYGKPIRVNKAS+H KNLD+GANIFIGNLDPE+DEKLLYDTFSAFGVILQTPKIMR+ ++GNSKGYAFIN+ASF+ASDAAIEAMNGQYLCNR ITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFAD
Sbjct:    1 MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFAD 213          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Cavefish
Match: pabpc4 (poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:ZFIN;Acc:ZDB-GENE-030131-9663])

HSP 1 Score: 129.413 bits (324), Expect = 4.488e-32
Identity = 77/184 (41.85%), Postives = 110/184 (59.78%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRV---NKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITV-SYAFKKDSKGERHGSAAE 674
            AS+YVG L   +TEA+L+E F  AGPV+++ + +D +T    GY +V F    DA+ A+  MN   + GKPIR+    +  S RK+  +G N+FI NLD  +D K LYDTFSAFG IL    +  E     SKGYAF+++ + +A+D AIE MNG  L +R + V  +  +K+ + E    A E
Sbjct:   12 ASLYVGDLHPDITEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVVKGKPIRIMWSQRDPSLRKS-GVG-NVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDEN---GSKGYAFVHFETQDAADRAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKE 190          

HSP 2 Score: 66.2402 bits (160), Expect = 3.329e-11
Identity = 46/170 (27.06%), Postives = 81/170 (47.65%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSK 647
            ++Y+      + +  L E+F + G  ++V +  D  TG  +G+GFV +   EDA+                              G N++I NLD  +D++ L   FS FG I    K+M   E G SKG+ F+ ++S E +  A+  MNG+ + ++ + V+ A +K+ +
Sbjct:  193 NVYIKNFGEDMDDEKLKEIFDKYGKTLSVKVMTD-PTGKSRGFGFVSYEKHEDANK-----------------------------GVNLYIKNLDDTIDDEKLRKEFSPFGSITSA-KVM--LEEGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEER 329          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Cavefish
Match: pabpc4 (poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:ZFIN;Acc:ZDB-GENE-030131-9663])

HSP 1 Score: 129.413 bits (324), Expect = 4.585e-32
Identity = 77/184 (41.85%), Postives = 110/184 (59.78%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRV---NKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITV-SYAFKKDSKGERHGSAAE 674
            AS+YVG L   +TEA+L+E F  AGPV+++ + +D +T    GY +V F    DA+ A+  MN   + GKPIR+    +  S RK+  +G N+FI NLD  +D K LYDTFSAFG IL    +  E     SKGYAF+++ + +A+D AIE MNG  L +R + V  +  +K+ + E    A E
Sbjct:   12 ASLYVGDLHPDITEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVVKGKPIRIMWSQRDPSLRKS-GVG-NVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDEN---GSKGYAFVHFETQDAADRAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKE 190          

HSP 2 Score: 73.9442 bits (180), Expect = 9.593e-14
Identity = 50/170 (29.41%), Postives = 90/170 (52.94%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSK 647
            ++Y+      + +  L E+F + G  ++V +  D  TG  +G+GFV +   EDA+       + K  G P+   K+    + +  G N++I NLD  +D++ L   FS FG I    K+M   E G SKG+ F+ ++S E +  A+  MNG+ + ++ + V+ A +K+ +
Sbjct:  193 NVYIKNFGEDMDDEKLKEIFDKYGKTLSVKVMTD-PTGKSRGFGFVSYEKHEDAN------KVKKREGNPV---KSLLQSEIVKKGVNLYIKNLDDTIDDEKLRKEFSPFGSITSA-KVM--LEEGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEER 349          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Cavefish
Match: ENSAMXT00000018970.2 (polyadenylate-binding protein 1-like [Source:NCBI gene;Acc:103030422])

HSP 1 Score: 127.102 bits (318), Expect = 2.629e-31
Identity = 75/184 (40.76%), Postives = 109/184 (59.24%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRV---NKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITV-SYAFKKDSKGERHGSAAE 674
            AS+YVG L   VTEA+L+E F  AGP++++ + +D +T    GY +V F    DA+ A+  MN   + G+P+R+    +  S RK+  +G NIFI NLD  +D K LYDTFSAFG IL    +  E     SKGY F+++ + EA++ AIE MNG  L +R + V  +  +K+ + E    A E
Sbjct:   11 ASLYVGDLHQDVTEAMLYEKFSPAGPILSIRVCRDMMTRRSLGYAYVNFQQPADAERALDTMNFDVIKGRPVRIMWSQRDPSLRKS-GVG-NIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDEN---GSKGYGFVHFETHEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAEMGARAKE 189          

HSP 2 Score: 80.8777 bits (198), Expect = 6.572e-16
Identity = 52/187 (27.81%), Postives = 92/187 (49.20%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSH-----------------RKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSK 647
            ++Y+      + +  L ++F + GP +++ +  D  +G  +G+GFV F   EDA  A+  MN  +L GK + V +A                    R     G N+++ NLD  +D++ L   FS FG I     +M   E G SKG+ F+ ++S E +  A+  MNG+ +  + + V+ A +K+ +
Sbjct:  192 NVYIKNFGEDMDDEKLKDVFGKYGPALSIRVMTDE-SGKSKGFGFVSFERHEDAQRAVDEMNGKELNGKQVYVGRAQKKGERQTELKRKFEQMKQDRMTRYQGVNLYVKNLDDGLDDERLRKEFSPFGTITSAKVMM---EGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEER 374          

HSP 3 Score: 75.0998 bits (183), Expect = 4.779e-14
Identity = 53/181 (29.28%), Postives = 95/181 (52.49%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHR-KNLDIGA------NIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERH 659
            +I++  LD  +    L++ F   G +++  +  D      +GYGFV F   E A+ A++ MN + L  + + V +  S + +  ++GA      N++I N   ++D++ L D F  +G  L   ++M + ESG SKG+ F+++   E +  A++ MNG+ L  + + V  A K   KGER 
Sbjct:  100 NIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGS--KGYGFVHFETHEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAEMGARAKEFTNVYIKNFGEDMDDEKLKDVFGKYGPALSI-RVMTD-ESGKSKGFGFVSFERHEDAQRAVDEMNGKELNGKQVYVGRAQK---KGERQ 273          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Cavefish
Match: ENSAMXT00000035946.1 (polyadenylate-binding protein 1-like [Source:NCBI gene;Acc:103030422])

HSP 1 Score: 127.102 bits (318), Expect = 3.534e-31
Identity = 75/184 (40.76%), Postives = 109/184 (59.24%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRV---NKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITV-SYAFKKDSKGERHGSAAE 674
            AS+YVG L   VTEA+L+E F  AGP++++ + +D +T    GY +V F    DA+ A+  MN   + G+P+R+    +  S RK+  +G NIFI NLD  +D K LYDTFSAFG IL    +  E     SKGY F+++ + EA++ AIE MNG  L +R + V  +  +K+ + E    A E
Sbjct:   11 ASLYVGDLHQDVTEAMLYEKFSPAGPILSIRVCRDMMTRRSLGYAYVNFQQPADAERALDTMNFDVIKGRPVRIMWSQRDPSLRKS-GVG-NIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDEN---GSKGYGFVHFETHEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAEMGARAKE 189          

HSP 2 Score: 80.4925 bits (197), Expect = 8.853e-16
Identity = 53/187 (28.34%), Postives = 93/187 (49.73%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSH-----------------RKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSK 647
            ++Y+      + +  L ++F + GP +++ +  D  +G  +G+GFV F   EDA  A+  MN  +L GK + V +A                    R     G N+++ NLD  +D++ L   FS FG I    K+M   E G SKG+ F+ ++S E +  A+  MNG+ +  + + V+ A +K+ +
Sbjct:  192 NVYIKNFGEDMDDEKLKDVFGKYGPALSIRVMTDE-SGKSKGFGFVSFERHEDAQRAVDEMNGKELNGKQVYVGRAQKKGERQTELKRKFEQMKQDRMTRYQGVNLYVKNLDDGLDDERLRKEFSPFGTITSA-KVM--MEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEER 374          

HSP 3 Score: 74.3294 bits (181), Expect = 7.691e-14
Identity = 53/181 (29.28%), Postives = 95/181 (52.49%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHR-KNLDIGA------NIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERH 659
            +I++  LD  +    L++ F   G +++  +  D      +GYGFV F   E A+ A++ MN + L  + + V +  S + +  ++GA      N++I N   ++D++ L D F  +G  L   ++M + ESG SKG+ F+++   E +  A++ MNG+ L  + + V  A K   KGER 
Sbjct:  100 NIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDE--NGSKGYGFVHFETHEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAEMGARAKEFTNVYIKNFGEDMDDEKLKDVFGKYGPALSI-RVMTD-ESGKSKGFGFVSFERHEDAQRAVDEMNGKELNGKQVYVGRAQK---KGERQ 273          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Sea Lamprey
Match: sf3b4 (splicing factor 3b, subunit 4 [Source:ZFIN;Acc:ZDB-GENE-020419-22])

HSP 1 Score: 404.445 bits (1038), Expect = 4.687e-139
Identity = 187/213 (87.79%), Postives = 200/213 (93.90%), Query Frame = 3
Query:   99 MTVGAIEERNQDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFAD 737
            M  G I ERNQDA++YVGGLD KV+EA+LWELFLQAGPVVN HMPKDR+T  HQGYGFVEFLGEEDADYA+KIMNMIKLYGKPIRVNKAS+H KNLD+GANIFIGNLD E+DEKLLYDTFSAFGVILQTPK MR+ E+GNSKGYAFIN+ASFEASDAAIEAMNGQYLCNR I+VSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFAD
Sbjct:    1 MAAGPISERNQDATVYVGGLDDKVSEALLWELFLQAGPVVNTHMPKDRITQQHQGYGFVEFLGEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDTEIDEKLLYDTFSAFGVILQTPKTMRDPETGNSKGYAFINFASFEASDAAIEAMNGQYLCNRPISVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFAD 213          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Sea Lamprey
Match: pabpc4 (poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:ZFIN;Acc:ZDB-GENE-030131-9663])

HSP 1 Score: 127.872 bits (320), Expect = 2.844e-32
Identity = 75/184 (40.76%), Postives = 106/184 (57.61%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRV---NKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAER 677
            AS+YVG L   VTEA+L+E F  AGPV+++ + +D +T    GY +V F    DA+ A+  MN   + GKPIR+    +  S RK+  +G N+FI NLD  +D K +YDTFSAFG IL    +  E     S+GY F+++ + EA+D AIE MNG  L +R     +  +  S+ ER      R
Sbjct:   11 ASLYVGDLHPDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKS-GVG-NVFIKNLDKSIDNKAMYDTFSAFGNILSCKVVCDEN---GSRGYGFVHFETQEAADRAIEKMNGMLLNDRLARRRFVGRFKSRKEREQEMGAR 189          

HSP 2 Score: 80.1073 bits (196), Expect = 2.488e-16
Identity = 52/188 (27.66%), Postives = 96/188 (51.06%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSH-------RKNLDI----------GANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSK 647
             ++Y+      + E  L E F + G  ++V +  D   G  +G+GFV F   EDA  A+  MN  +L G+ + V +A          ++  ++          G N+++ NLD  +D++ L   F+ +G I  T K+M  +E G SKG+ F+ ++S E +  A+  MNG+ + ++ + V+ A +K+ +
Sbjct:  194 TNVYIKNFGDDMDEDKLREFFGKFGKALSVCVMSDEC-GKSRGFGFVSFEQHEDAQRAVNEMNGKELNGRTVFVGRAQKKGERQAELKRKFEMLKQERISRYQGVNLYVKNLDDNIDDEQLRKEFAPYGTITST-KVM--SEEGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEER 377          

HSP 3 Score: 68.9366 bits (167), Expect = 7.628e-13
Identity = 52/184 (28.26%), Postives = 90/184 (48.91%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIR---VNKASSHR-KNLDIGA------NIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERH 659
            ++++  LD  +    +++ F   G +++  +  D      +GYGFV F  +E AD A++ MN + L  +  R   V +  S + +  ++GA      N++I N   ++DE  L + F  FG  L     +   E G S+G+ F+++   E +  A+  MNG+ L  R + V  A K   KGER 
Sbjct:  100 NVFIKNLDKSIDNKAMYDTFSAFGNILSCKVVCD--ENGSRGYGFVHFETQEAADRAIEKMNGMLLNDRLARRRFVGRFKSRKEREQEMGARAKEFTNVYIKNFGDDMDEDKLREFFGKFGKALSV--CVMSDECGKSRGFGFVSFEQHEDAQRAVNEMNGKELNGRTVFVGRAQK---KGERQ 276          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001683.1 (pep scaffold:Pmarinus_7.0:GL479187:63988:67530:1 gene:ENSPMAG00000001518.1 transcript:ENSPMAT00000001683.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.633 bits (174), Expect = 5.539e-16
Identity = 35/76 (46.05%), Postives = 51/76 (67.11%), Query Frame = 3
Query:  132 DASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVN 359
            D  ++VG LD + TE +L+ELFLQAGP+V V + KD+   L Q + FV F  EE   YAM +MN I+L+G+ +++ 
Sbjct:   10 DRCLFVGNLDPRSTEEVLFELFLQAGPLVKVWIAKDKDGKLKQ-FAFVTFKHEESVPYAMGLMNGIRLFGRALKLQ 84          

HSP 2 Score: 46.595 bits (109), Expect = 4.361e-7
Identity = 24/80 (30.00%), Postives = 44/80 (55.00%), Query Frame = 3
Query:  387 DIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSY 626
            D+   +F+GNLDP   E++L++ F   G +++    + + + G  K +AF+ +   E+   A+  MNG  L  RA+ + Y
Sbjct:    8 DVDRCLFVGNLDPRSTEEVLFELFLQAGPLVKV--WIAKDKDGKLKQFAFVTFKHEESVPYAMGLMNGIRLFGRALKLQY 85          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Sea Lamprey
Match: HNRNPA0 (heterogeneous nuclear ribonucleoprotein A0 [Source:HGNC Symbol;Acc:HGNC:5030])

HSP 1 Score: 76.6406 bits (187), Expect = 1.502e-15
Identity = 43/154 (27.92%), Postives = 82/154 (53.25%), Query Frame = 3
Query:  129 QDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIGAN-----IFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAI 575
            Q   +++GGL  + TE  + + F Q G + +  + +D  T   +G+GFV ++  E+ D AM++     L G+ +   +A S   +L  GA+     IF+G +    DE  L D FS +G++ ++  +M + +SG  +G+ F+ ++  +A D  +
Sbjct:   31 QQRKLFIGGLSFETTEESMQKHFEQWGTLTDCVVMRDPHTKRSRGFGFVTYMSAEEVDAAMEVRPH-HLDGRVVEAKRAISREDSLKPGAHLKVKKIFVGGIKDNTDEDHLRDYFSEYGMV-ESVDVMEDRQSGKKRGFGFVTFSDHDAVDKVV 182          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Sea Lamprey
Match: pabpc4 (poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:ZFIN;Acc:ZDB-GENE-030131-9663])

HSP 1 Score: 75.485 bits (184), Expect = 5.186e-15
Identity = 52/188 (27.66%), Postives = 95/188 (50.53%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQ-AGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSH-------RKNLDI----------GANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSK 647
            ++Y+      + +  L E F Q  G  ++V +  D   G  +G+GFV F   EDA  A+  MN  +L G+ I V +A          ++  ++          G N+++ NLD  ++++ L+  FS FG I    K+M   E G S+G+ F+ ++S E +  A+  MNG+ + ++ + V+ A +K+ +
Sbjct:   52 NVYIKNFGDDMDDERLREYFEQYVGKTLSVKVMMDE-GGKSKGFGFVSFERHEDAQKAVDEMNTKELNGRAIYVGRAQKKAERQTELKRKFEMLKQERMSKYQGVNLYVKNLDDNINDERLWKEFSPFGTITSA-KVM--MEEGRSRGFGFVCFSSPEEATKAVTEMNGRIIGSKPLYVALAQRKEER 235          

HSP 2 Score: 59.3066 bits (142), Expect = 8.037e-10
Identity = 41/134 (30.60%), Postives = 71/134 (52.99%), Query Frame = 3
Query:  267 GFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHR-KNLDIGA------NIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSK 647
            GFV F  +E AD A++ MN + L  + + V +  S + +  + GA      N++I N   ++D++ L + F  +     + K+M + E G SKG+ F+++   E +  A++ MN + L  RAI V  A KK  +
Sbjct:    1 GFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAEFGAKAREFTNVYIKNFGDDMDDERLREYFEQYVGKTLSVKVMMD-EGGKSKGFGFVSFERHEDAQKAVDEMNTKELNGRAIYVGRAQKKAER 133          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Yeast
Match: HSH49 (U2-snRNP associated splicing factor; similar to the mammalian splicing factor SAP49; proposed to function as a U2-snRNP assembly factor along with Hsh155p and binding partner Cus1p; contains two RNA recognition motifs (RRM) [Source:SGD;Acc:S000005846])

HSP 1 Score: 132.494 bits (332), Expect = 9.407e-37
Identity = 71/195 (36.41%), Postives = 116/195 (59.49%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIM-NMIKLYGKPIRVNKASSHRKNLDIGANI-----------FIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGE-RHGSAAERLL 683
            ++YVG +D ++T+  L+ELF+Q  PV+ +  PKD+V   +QGY F+EF  + DA YA+KIM N ++LY + I+V + ++     ++ +NI           FI NL   +D   L   F+ FG +++ P+I     +G  K  A++ +  FE +D AI+++N Q + N  ITV YAFK++ KG  ++G   +RLL
Sbjct:   10 TVYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYAIKIMNNTVRLYDRLIKVRQVTNSTGTTNLPSNISKDMILPIAKLFIKNLADSIDSDQLVKIFNKFGKLIREPEIFY-LSNGKLKC-AYVYFEDFEKADLAIKSLNNQLVANNRITVDYAFKENGKGNAKYGDDVDRLL 202          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Yeast
Match: PAB1 (Poly(A) binding protein; part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G; stimulates, but is not required for the deadenylation activity of the Pan2p-Pan3p poly(A)-ribonuclease complex [Source:SGD;Acc:S000000967])

HSP 1 Score: 103.219 bits (256), Expect = 4.223e-24
Identity = 64/169 (37.87%), Postives = 97/169 (57.40%), Query Frame = 3
Query:  126 NQDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRV---NKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVS 623
            N  AS+YVG L+  V+EA L+++F   G V ++ + +D +T    GY +V F   E    A++ +N   + G+  R+    +  S RK      NIFI NL P++D K LYDTFS FG IL + KI  + E+G SKG+ F+++    A+  AI+A+NG  L  + I V+
Sbjct:   35 NSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPSLRKKG--SGNIFIKNLHPDIDNKALYDTFSVFGDILSS-KIATD-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVA 199          

HSP 2 Score: 92.8189 bits (229), Expect = 1.042e-20
Identity = 56/188 (29.79%), Postives = 101/188 (53.72%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDI-----------------GANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSK 647
             ++YV  ++ + T+    ELF + GP+V+  + KD   G  +G+GFV +   EDA  A++ +N  +L G+ + V +A    + + +                 G N+F+ NLD  VD++ L + F+ +G I  + K+MR TE+G SKG+ F+ +++ E +  AI   N Q +  + + V+ A +KD +
Sbjct:  219 TNLYVKNINSETTDEQFQELFAKFGPIVSASLEKD-ADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTIT-SAKVMR-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVR 403          

HSP 3 Score: 60.077 bits (144), Expect = 3.427e-10
Identity = 47/178 (26.40%), Postives = 83/178 (46.63%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIG--------ANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSK 647
            +I++  L   +    L++ F   G +++  +  D   G  +G+GFV F  E  A  A+  +N + L G+ I V    S RK  D           N+++ N++ E  ++   + F+ FG I+     + +   G  KG+ F+NY   E +  A+EA+N   L    + V  A KK+ +
Sbjct:  127 NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDE-NGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLS-RKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSAS--LEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNER 300          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Yeast
Match: PUB1 (Poly (A)+ RNA-binding protein; abundant mRNP-component protein that binds mRNA and is required for stability of many mRNAs; component of glucose deprivation induced stress granules, involved in P-body-dependent granule assembly; implicated in regulation of translation; carries Q/N-rich domain at C- terminus, identified as candidate prion; human homolog Tia1 is critical for normal synaptic plasticity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004961])

HSP 1 Score: 96.2857 bits (238), Expect = 5.169e-22
Identity = 53/171 (30.99%), Postives = 100/171 (58.48%), Query Frame = 3
Query:  132 DASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKA-SSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKD 641
            D  +YVG LD  +TE IL + F   GP+ N+ +  D+    +  Y FVE+    DA+ A++ +N  ++    +++N A  S + + D   N+F+G+L+  VD++ L + F  F   L +  +M + ++G+S+GY F+++ S + +  A+++M GQ L  R + +++A K+D
Sbjct:   74 DRVLYVGNLDKAITEDILKQYFQVGGPIANIKIMIDK-NNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSSSDDTFNLFVGDLNVNVDDETLRNAFKDFPSYL-SGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWAAKRD 242          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Yeast
Match: HRP1 (Subunit of cleavage factor I; cleavage factor I is a five-subunit complex required for the cleavage and polyadenylation of pre-mRNA 3' ends; RRM-containing heteronuclear RNA binding protein and hnRNPA/B family member that binds to poly (A) signal sequences; required for genome stability [Source:SGD;Acc:S000005483])

HSP 1 Score: 74.7146 bits (182), Expect = 6.515e-15
Identity = 46/148 (31.08%), Postives = 77/148 (52.03%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIE 578
              +++GGL+   TE  L E F + G V ++ + KD  TG  +G+GF+ F      D  +K  ++  L GK I   +A   R   D    IF+G + P+V  K   + FS +G I+   ++M + ++G S+G+ F+ Y S +A D   +
Sbjct:  159 CKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQHI--LDGKVIDPKRAIP-RDEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDA-QLMLDKDTGQSRGFGFVTYDSADAVDRVCQ 302          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Yeast
Match: NSR1 (Nucleolar protein that binds nuclear localization sequences; required for pre-rRNA processing and ribosome biogenesis; binds to single stranded telomeric DNA and mRNA; methylated by Hmt1p; interaction with Top1p and nucleolar localization are negatively regulated by polyphosphorylation [Source:SGD;Acc:S000003391])

HSP 1 Score: 73.559 bits (179), Expect = 1.102e-14
Identity = 45/183 (24.59%), Postives = 95/183 (51.91%), Query Frame = 3
Query:  117 EERNQDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSH--------RKNLDIGA----NIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYA 629
            EE  + A+I+VG L   + +  L + F   G V+   +  +R T   +GYG+V+F  +  A+ A++ M   ++ G+PI  + ++S         +K  D  +     +F+GNL    D   +++ F+  G ++   +I    E+   KG+ ++ +++ E +  A++A+ G+Y+ NR + + ++
Sbjct:  162 EETEEPATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEMQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFELFAKHGEVVSV-RIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDFS 343          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Nematostella
Match: EDO42417 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1S3])

HSP 1 Score: 397.897 bits (1021), Expect = 7.455e-137
Identity = 183/213 (85.92%), Postives = 204/213 (95.77%), Query Frame = 3
Query:   99 MTVGAIEERNQDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFAD 737
            M  G I ERNQDA+IYVGGLD KV+EA++WELFLQ+GPVVNVHMPKDR+T LHQGYGFVEFLGEEDADYA+K+MNMIK+YGKPIRVNKAS+H KNLD+GAN+FIGNLD EVDEKLLYDTFSAFGVILQTPKIMR++++GNSKG+AFIN+ASF+ASDAAIEAMNGQYLCNR ITVSYAFKK+SKGERHGSAAERLLAAQNPL+QADRPHQLFAD
Sbjct:    1 MAAGPIAERNQDATIYVGGLDEKVSEALIWELFLQSGPVVNVHMPKDRITQLHQGYGFVEFLGEEDADYAIKVMNMIKVYGKPIRVNKASAHNKNLDVGANLFIGNLDTEVDEKLLYDTFSAFGVILQTPKIMRDSDTGNSKGFAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKESKGERHGSAAERLLAAQNPLAQADRPHQLFAD 213          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Nematostella
Match: EDO33206 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSV8])

HSP 1 Score: 114.39 bits (285), Expect = 2.229e-27
Identity = 76/188 (40.43%), Postives = 109/188 (57.98%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRV---NKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAM---NGQYLCNRAITVSYAFKKDSKGERHGSAAERL 680
            AS+YVG L   VTEA+L+E F  AG V+++ + +D VT    GY +V F     A+ A+  MN   + G+P R+    +  S RK+  +G NIFI NLD  +D K LYDTFSAFG IL   KI ++ E GN KGY F++   FE  DAA+EA+   +G  L ++ + V     K  + E+ G+  ++ 
Sbjct:   13 ASLYVGDLAPDVTEAMLYEKFSTAGSVLSIRVCRDLVTRRSLGYAYVNFQQPGHAEKALDTMNFDPIKGRPCRIMWQQRDPSLRKS-GVG-NIFIKNLDKSIDNKSLYDTFSAFGNILSC-KIAQD-ELGNPKGYGFVH---FETEDAALEAIARVDGMLLNDKKVFVGRWMSKKERIEKMGTQPKKF 193          

HSP 2 Score: 82.8037 bits (203), Expect = 4.820e-17
Identity = 50/187 (26.74%), Postives = 100/187 (53.48%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPI-----------------RVNKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSK 647
            ++YV      + +  + E+  +AG +V++ +  D   G  +G+GFV F   E+A+ A+ ++N  ++ G+ +                  + K    R N   G N++I NLD  +D++ L + FS +G I  + K+M++ + GNSKG+ F+ ++S E +  A+  MNG+ L ++ + V+ A +++ +
Sbjct:  195 NVYVKNFGDDMDDEQMKEICAEAGKIVSLKVMTD-PEGKSKGFGFVSFETPEEAEEAVNVLNGKEIGGRRLWAGRAKKRAERAAEVKAEIEKKRQERINRFQGVNLYIKNLDDPIDDERLREEFSPYGTI-SSAKVMKD-DKGNSKGFGFVCFSSPEEATKAVTEMNGRILISKPLYVALAQRREER 378          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Nematostella
Match: EDO35243 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM09])

HSP 1 Score: 87.4261 bits (215), Expect = 2.335e-21
Identity = 39/83 (46.99%), Postives = 57/83 (68.67%), Query Frame = 3
Query:  129 QDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHR 377
            +D S++VG LD +VTE ILWELFLQAGP+ NV +P D+ TG  + +GFVEF       YA ++++ I+LY + I V   S+++
Sbjct:    1 KDCSVFVGNLDSRVTEEILWELFLQAGPLENVRIPTDKNTGQQRSFGFVEFSSPVSVHYASELLDGIRLYDRAINVKPQSNNQ 83          

HSP 2 Score: 44.2838 bits (103), Expect = 4.572e-6
Identity = 23/74 (31.08%), Postives = 43/74 (58.11%), Query Frame = 3
Query:  399 NIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITV 620
            ++F+GNLD  V E++L++ F   G  L+  +I  +  +G  + + F+ ++S  +   A E ++G  L +RAI V
Sbjct:    4 SVFVGNLDSRVTEEILWELFLQAGP-LENVRIPTDKNTGQQRSFGFVEFSSPVSVHYASELLDGIRLYDRAINV 76          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Nematostella
Match: EDO32492 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUY1])

HSP 1 Score: 75.485 bits (184), Expect = 1.326e-15
Identity = 51/184 (27.72%), Postives = 89/184 (48.37%), Query Frame = 3
Query:  144 YVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSH----RKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERLL 683
            YVG LD K T+ ++  +F +   VV   M           Y FVEF    DA  A   M+   +  K ++VN A++H    R + +   +IF+G+L   VD  LL  TF  FG I +  +++++     SKG+ F+++   E +  AI  M+   +  + +  ++A +K++  +      + LL
Sbjct:    1 YVGNLDPKCTQELICSIFNKIAKVVRCKMINS--VSYKGPYCFVEFETHADAQEAKFRMDQRTVMDKKLKVNWATNHPGMKRGDTNNHFHIFVGDLAENVDNALLRKTFEPFGEISEV-RVVKDPAKNKSKGFGFVSFVRREDAAKAIAEMDSVTIGGKQVKTNWAARKNNPTQSKYVCVKNLL 181          

HSP 2 Score: 66.6254 bits (161), Expect = 1.250e-12
Identity = 49/160 (30.63%), Postives = 73/160 (45.62%), Query Frame = 3
Query:  120 ERNQDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHR----------KNL----------DIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFI 539
            + N    I+VG L   V  A+L + F   G +  V + KD      +G+GFV F+  EDA  A+  M+ + + GK ++ N A+             KNL           +   +++GNL P+V +  L   FS +G IL       ET+    KGYAFI
Sbjct:   82 DTNNHFHIFVGDLAENVDNALLRKTFEPFGEISEVRVVKDPAKNKSKGFGFVSFVRREDAAKAIAEMDSVTIGGKQVKTNWAARKNNPTQSKYVCVKNLLWDDVFHQSSQLNTTVYVGNLPPDVKDYELQQMFSQYGSIL-------ETKVFADKGYAFI 234          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Nematostella
Match: EDO46306 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQK4])

HSP 1 Score: 72.7886 bits (177), Expect = 7.491e-14
Identity = 51/175 (29.14%), Postives = 91/175 (52.00%), Query Frame = 3
Query:  141 IYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIG----------ANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMN-----GQYL-CNRAIT 617
            +YVG ++ ++ E  +   F   GP+  + +  D +   H+G+ FVE+   E A  A++ MN + L G+ I+V + S+  +   +           A I+I ++ P++ E  +   F AFG ++    + +E  +G  KGY FI Y + ++++ AI +MN     GQ+L   RAIT
Sbjct:   66 VYVGSINFELREEHIRTAFHPFGPINKIDLSWDPLNMKHKGFAFVEYDLPEAAQLALEQMNGVLLGGRNIKVGRPSNVPQAAPLIEQFEQEAKKYARIYIASVHPDLLEDDIKSVFEAFGKVVHC-SLSKEPMTGKHKGYGFIEYENQQSANDAIASMNLFDLGGQFLRVGRAIT 239          

HSP 2 Score: 52.373 bits (124), Expect = 2.288e-7
Identity = 27/83 (32.53%), Postives = 49/83 (59.04%), Query Frame = 3
Query:  117 EERNQDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKA 365
            +E  + A IY+  +   + E  +  +F   G VV+  + K+ +TG H+GYGF+E+  ++ A+ A+  MN+  L G+ +RV +A
Sbjct:  155 QEAKKYARIYIASVHPDLLEDDIKSVFEAFGKVVHCSLSKEPMTGKHKGYGFIEYENQQSANDAIASMNLFDLGGQFLRVGRA 237          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Medaka
Match: sf3b4 (splicing factor 3b subunit 4 [Source:NCBI gene;Acc:101159759])

HSP 1 Score: 404.831 bits (1039), Expect = 6.622e-139
Identity = 188/213 (88.26%), Postives = 201/213 (94.37%), Query Frame = 3
Query:   99 MTVGAIEERNQDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFAD 737
            M  G I ERNQDA++YVGGLD KV+E +LWELFLQAGPVVN HMPKDRVTG HQGYGFVEFL EEDADYA+KIMNMIKLYGKPIRVNKAS+H KNLD+GANIFIGNLDPE+DEKLLYDTFSAFGVILQTPKIMR+ ++GNSKGYAFIN+ASF+ASDAAIEAMNGQYLCNR ITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFAD
Sbjct:    1 MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFAD 213          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Medaka
Match: sf3b4 (splicing factor 3b subunit 4 [Source:NCBI gene;Acc:101159759])

HSP 1 Score: 403.675 bits (1036), Expect = 1.326e-138
Identity = 188/213 (88.26%), Postives = 201/213 (94.37%), Query Frame = 3
Query:   99 MTVGAIEERNQDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFAD 737
            M  G I ERNQDA++YVGGLD KV+E +LWELFLQAGPVVN HMPKDRVTG HQGYGFVEFL EEDADYA+KIMNMIKLYGKPIRVNKAS+H KNLD+GANIFIGNLDPE+DEKLLYDTFSAFGVILQTPKIMR+ ++GNSKGYAFIN+ASF+ASDAAIEAMNGQYLCNR ITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFAD
Sbjct:    1 MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFAD 213          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Medaka
Match: pabpc4 (poly(A) binding protein cytoplasmic 4 [Source:NCBI gene;Acc:101159058])

HSP 1 Score: 129.798 bits (325), Expect = 2.545e-32
Identity = 77/184 (41.85%), Postives = 110/184 (59.78%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRV---NKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITV-SYAFKKDSKGERHGSAAE 674
            AS+YVG L   +TEA+L+E F  AGPV+++ + +D +T    GY +V F    DA+ A+  MN   + GKPIR+    +  S RK+  +G N+FI NLD  +D K LYDTFSAFG IL    +  E     SKGYAF+++ + +A+D AIE MNG  L +R + V  +  +K+ + E    A E
Sbjct:   11 ASLYVGDLHPDITEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFSQPADAERALDTMNFDVVKGKPIRIMWSQRDPSLRKS-GVG-NVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDEN---GSKGYAFVHFETQDAADRAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKE 189          

HSP 2 Score: 69.3218 bits (168), Expect = 2.704e-12
Identity = 46/174 (26.44%), Postives = 92/174 (52.87%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHR-KNLDIGA------NIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKK 638
            ++++  LD  +    L++ F   G +++  +  D      +GY FV F  ++ AD A++ MN + L  + + V +  S + +  ++GA      N++I N   E++++ L + F  +G  L   K+M ++ SG S+G+ F+++   E ++ A+E +NG  L  + + V  A KK
Sbjct:  100 NVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGS--KGYAFVHFETQDAADRAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGDEMEDEQLKEMFEKYGKTLSV-KVMTDS-SGKSRGFGFVSFEKHEDANKAVEEINGTELNGKTVFVGRAQKK 269          

HSP 3 Score: 55.0694 bits (131), Expect = 1.015e-7
Identity = 36/130 (27.69%), Postives = 66/130 (50.77%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSH-------RKNLDI----------GANIFIGNLDPEVDEKLLYDTFSAFGVI 476
            ++Y+     ++ +  L E+F + G  ++V +  D  +G  +G+GFV F   EDA+ A++ +N  +L GK + V +A          ++  ++          G N++I NLD  +D++ L   FS FG I
Sbjct:  192 NVYIKNFGDEMEDEQLKEMFEKYGKTLSVKVMTDS-SGKSRGFGFVSFEKHEDANKAVEEINGTELNGKTVFVGRAQKKMERQAELKRKFELLKQERISRYQGVNLYIKNLDDTIDDEKLRKEFSPFGSI 320          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Medaka
Match: pabpc4 (poly(A) binding protein cytoplasmic 4 [Source:NCBI gene;Acc:101159058])

HSP 1 Score: 129.413 bits (324), Expect = 5.330e-32
Identity = 77/184 (41.85%), Postives = 110/184 (59.78%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRV---NKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITV-SYAFKKDSKGERHGSAAE 674
            AS+YVG L   +TEA+L+E F  AGPV+++ + +D +T    GY +V F    DA+ A+  MN   + GKPIR+    +  S RK+  +G N+FI NLD  +D K LYDTFSAFG IL    +  E     SKGYAF+++ + +A+D AIE MNG  L +R + V  +  +K+ + E    A E
Sbjct:   11 ASLYVGDLHPDITEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFSQPADAERALDTMNFDVVKGKPIRIMWSQRDPSLRKS-GVG-NVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDEN---GSKGYAFVHFETQDAADRAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKE 189          

HSP 2 Score: 81.2629 bits (199), Expect = 5.501e-16
Identity = 53/187 (28.34%), Postives = 100/187 (53.48%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSH-------RKNLDI----------GANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSK 647
            ++Y+     ++ +  L E+F + G  ++V +  D  +G  +G+GFV F   EDA+ A++ +N  +L GK + V +A          ++  ++          G N++I NLD  +D++ L   FS FG I  + K+M   E G SKG+ F+ ++S E +  A+  MNG+ + ++ + V+ A +K+ +
Sbjct:  192 NVYIKNFGDEMEDEQLKEMFEKYGKTLSVKVMTDS-SGKSRGFGFVSFEKHEDANKAVEEINGTELNGKTVFVGRAQKKMERQAELKRKFELLKQERISRYQGVNLYIKNLDDTIDDEKLRKEFSPFGSIT-SAKVM--LEDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEER 374          
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Medaka
Match: pabpc1a (poly(A) binding protein cytoplasmic 1 [Source:NCBI gene;Acc:101163762])

HSP 1 Score: 127.487 bits (319), Expect = 3.005e-31
Identity = 75/184 (40.76%), Postives = 109/184 (59.24%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRV---NKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITV-SYAFKKDSKGERHGSAAE 674
            AS+YVG L   VTEA+L+E F  AGP++++ + +D +T    GY +V F    DA+ A+  MN   + G+P+R+    +  S RK+  +G NIFI NLD  +D K LYDTFSAFG IL    +  E     SKGY F+++ + EA++ AIE MNG  L +R + V  +  +K+ + E    A E
Sbjct:   11 ASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGRPLRIMWSQRDPSLRKS-GVG-NIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDEN---GSKGYGFVHFETHEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARARE 189          

HSP 2 Score: 82.8037 bits (203), Expect = 1.405e-16
Identity = 56/187 (29.95%), Postives = 93/187 (49.73%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSH-----------------RKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSK 647
            ++Y+      + +  L ELF   GP ++V +  D  TG  +G+GFV F   EDA  A+  MN  +L G+ + V +A                    R     G N+++ NLD  +D++ L   FS FG I  + K+M   E G SKG+ F+ ++S E +  A+  MNG+ +  + + V+ A +K+ +
Sbjct:  192 NVYIKNFGEDMDDEKLKELFGNYGPALSVRVMTDD-TGKSKGFGFVSFERHEDAQKAVDDMNGKELNGRQVYVGRAQKKGERQNELKRKFEQMKQDRMTRYQGVNLYVKNLDDGLDDERLRKEFSPFGTIT-SAKVM--MEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEER 374          

HSP 3 Score: 71.2478 bits (173), Expect = 6.910e-13
Identity = 51/181 (28.18%), Postives = 95/181 (52.49%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHR-KNLDIGA------NIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERH 659
            +I++  LD  +    L++ F   G +++  +  D      +GYGFV F   E A+ A++ MN + L  + + V +  S + +  ++GA      N++I N   ++D++ L + F  +G  L   ++M + ++G SKG+ F+++   E +  A++ MNG+ L  R + V  A K   KGER 
Sbjct:  100 NIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDE--NGSKGYGFVHFETHEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAREFTNVYIKNFGEDMDDEKLKELFGNYGPALSV-RVMTD-DTGKSKGFGFVSFERHEDAQKAVDDMNGKELNGRQVYVGRAQK---KGERQ 273          
BLAST of Splicing factor 3b subunit 4 vs. Planmine SMEST
Match: SMESG000005564.1 (SMESG000005564.1)

HSP 1 Score: 493.426 bits (1269), Expect = 3.173e-175
Identity = 311/311 (100.00%), Postives = 311/311 (100.00%), Query Frame = 3
Query:   99 MTVGAIEERNQDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADGXXXXXXXXXXXXXXXXXXXXXXXFLEGMMXXXXXXXXXXXXXXXXXIHVWTTSGXXXXXXXXXXXXXXXXXXXXSSFATAPVNLPPPPSIETITNGE 1031
            MTVGAIEERNQDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADGPPAPPMMMIPPPPPNAMPHHLPPFLEGMMPPPAPQFIGLPPPPPPPIHVWTTSGPGPVIPPPPFRPMPPPPPPPSSFATAPVNLPPPPSIETITNGE
Sbjct:    1 MTVGAIEERNQDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADGPPAPPMMMIPPPPPNAMPHHLPPFLEGMMPPPAPQFIGLPPPPPPPIHVWTTSGPGPVIPPPPFRPMPPPPPPPSSFATAPVNLPPPPSIETITNGE 311          
BLAST of Splicing factor 3b subunit 4 vs. Planmine SMEST
Match: SMESG000004978.1 (SMESG000004978.1)

HSP 1 Score: 110.153 bits (274), Expect = 1.574e-25
Identity = 67/165 (40.61%), Postives = 100/165 (60.61%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRV---NKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITV 620
            AS+YVG L  +VTEA+++E F   GPV+++ + +D +T    GY +V F    DA+ A+  MN   + G+ IR+    +  S RK+  IG NIFI NLD  + +K L+DTF AFG IL   KI  + E   SKGY F+++ +  A+  AI+A+NG  + N+ + V
Sbjct:   15 ASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKS-GIG-NIFIKNLDKSITQKELHDTFVAFGNILSC-KIAAD-ERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFV 175          

HSP 2 Score: 74.3294 bits (181), Expect = 6.960e-14
Identity = 50/175 (28.57%), Postives = 95/175 (54.29%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNK--ASSHRKNLDIG---ANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSK 647
            +I++  LD  +T+  L + F+  G +++  +  D  +   +GYGFV F  E  A  A+  +N + +  K + V +    ++R N D      N +I N   ++D++ L + F  FG I  + K+M + E+G SKG+ F+ +   E +++A++A+NG+   +R + V  A KK+ +
Sbjct:  104 NIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSK-SKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEIT-SAKVMID-ENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNER 275          

HSP 3 Score: 69.3218 bits (168), Expect = 2.630e-12
Identity = 56/217 (25.81%), Postives = 103/217 (47.47%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLD------------------IGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGN-SKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQL 728
             + Y+      + +  L E+FL+ G + +  +  D   G  +G+GFV F   E A+ A+K +N      + + V +A    + LD                   G N+++ NLD  +D+  L   F  FG I  + K+M  T+S N SKG+ F+ +++ E +  A+  MNG+   ++ + V+ A +K+   +R    A + +   NP  + + P+Q+
Sbjct:  194 TNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDE-NGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNIT-SAKVM--TDSNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKE---DRKAHLASQYMQRVNP-HRNNYPNQV 402          

HSP 4 Score: 53.1434 bits (126), Expect = 2.942e-7
Identity = 24/83 (28.92%), Postives = 53/83 (63.86%), Query Frame = 3
Query:  396 ANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDS 644
            A++++G+L PEV E ++Y+ FS+ G +L   ++ R+  +  S GYA++N+ +   +++A++ MN   +  R+I + ++ +  S
Sbjct:   15 ASLYVGDLHPEVTEAMIYEKFSSCGPVLSI-RVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPS 96          
BLAST of Splicing factor 3b subunit 4 vs. Planmine SMEST
Match: SMESG000062663.1 (SMESG000062663.1)

HSP 1 Score: 101.293 bits (251), Expect = 3.001e-23
Identity = 64/180 (35.56%), Postives = 103/180 (57.22%), Query Frame = 3
Query:  114 IEERNQDA-SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVN---KASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKD 641
            +E +N +A S+YVG L+  VTE+ L+++F   G ++++H+ +D +  +  GY ++ F    DA  A+  +N+  + G P RV    + SS RK+ ++G NI I NL   V  K L + F  FG I  T   M+  E+G SKG AF+N++    +D AIE++NGQ + +  + V     KD
Sbjct:    1 MENKNLNAASLYVGDLNKDVTESNLFDVFKNFGKIISIHVCRDLIKNVSLGYAYINFTNSSDAKAAIDKVNLENIKGTPCRVTWSQRDSSVRKS-NVG-NIIIKNLPQTVTVKELREKFECFGEI--TSCSMKTDENGLSKGCAFVNFSEAGYADKAIESINGQKIQDEVVYVGKFIPKD 176          

HSP 2 Score: 70.8626 bits (172), Expect = 4.008e-13
Identity = 51/188 (27.13%), Postives = 93/188 (49.47%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVH-MPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKA-----------------SSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDS 644
             ++YV      +    L ELF   G +++V  M  ++  G+ +G+GFV F    DA  +++ +N   +  K I V  A                 S  +  L    N+F+ NLD  ++++ L   FS FG +  + K+M +  +G SKG+ F+ +++   +  AI  MN + LC++ I V+ A+K+++
Sbjct:  183 TNVYVKNFGIHLNNQSLEELFSPFGEIISVKVMATEK--GISKGFGFVCFKNHSDALKSIEKLNETTIIDKVIYVGLAVEKPKSVEEKLRTVESKSKDKPQLVESVNVFVKNLDESINDEKLKAEFSVFGNV-TSAKVMVDKSNGVSKGFGFVCFSNSNEAAQAILEMNYKVLCDKQIYVAVAYKREN 367          
BLAST of Splicing factor 3b subunit 4 vs. Planmine SMEST
Match: SMESG000058745.1 (SMESG000058745.1)

HSP 1 Score: 98.2117 bits (243), Expect = 1.180e-21
Identity = 59/165 (35.76%), Postives = 96/165 (58.18%), Query Frame = 3
Query:  135 ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRV--NKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVS 623
            AS+YVG L   VTEAIL+E F   G V+++ + +D VT    GY +V +    +A  AM  +N   ++G+P R+  ++     +   +G NIFI NLDP +  K + DTF+ FG I      ++  E+G SKG+AF+N+     ++ AI+A+NG+ +  + + V+
Sbjct:    9 ASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVG-NIFIKNLDPSITVKEINDTFANFGEISSCK--VQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVA 170          

HSP 2 Score: 69.3218 bits (168), Expect = 2.597e-12
Identity = 52/193 (26.94%), Postives = 96/193 (49.74%), Query Frame = 3
Query:  126 NQD-ASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPI---RVNKASSHRKNLDI---------------GANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSK 647
            N+D  + Y+      + +  L +LF Q G +V+  +  D+  G  +G+GFV F   EDA  A+  +N   +  K I   R  K +  ++ L                 G N++I NL  E++++ L + F+ FG I  + K+M   E+  SKG+ F+ +++ + +  A+  MNG+ +  + + V+ A KK+ +
Sbjct:  182 NKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDK-EGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRARYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNIT-SAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDR 372          

HSP 3 Score: 65.4698 bits (158), Expect = 3.772e-11
Identity = 50/176 (28.41%), Postives = 86/176 (48.86%), Query Frame = 3
Query:  138 SIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIR---------VNKASSHRKNLDIGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKK 638
            +I++  LD  +T   + + F   G + +  +  D   G+ +G+ FV F  E DA+ A++ +N     GK IR         + +      N D   N +I N    + +K L D F   G I+ + K+M + E GNSKG+ F+++   E +  A+  +NG+ + ++ I V  A KK
Sbjct:   98 NIFIKNLDPSITVKEINDTFANFGEISSCKVQTDE-NGVSKGFAFVNFNHEGDAEKAIQAIN-----GKMIREKIVYVAKFIPRTQRSTPNKDF-TNCYIKNFGIHLHDKSLRDLFEQCGEIV-SAKVMVDKE-GNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKK 264          

HSP 4 Score: 48.9062 bits (115), Expect = 6.110e-6
Identity = 24/89 (26.97%), Postives = 51/89 (57.30%), Query Frame = 3
Query:  396 ANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHG 662
            A++++G+L P+V E +LY+ F   G +L   ++ R+  +  S GYA++NY     + +A++ +N + +  R   + ++ ++D    R G
Sbjct:    9 ASLYVGDLHPDVTEAILYEKFQTHGNVLSI-RVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWS-QRDPAARRSG 95          
BLAST of Splicing factor 3b subunit 4 vs. Planmine SMEST
Match: SMESG000055085.1 (SMESG000055085.1)

HSP 1 Score: 94.3597 bits (233), Expect = 4.371e-21
Identity = 63/207 (30.43%), Postives = 112/207 (54.11%), Query Frame = 3
Query:  132 DASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKAS------SHRKNLDI----GANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAER---LLAAQNPLSQAD 713
            +  IYVG L  ++T+ +L  +F   G  V  H+ +D  +G    Y F+EF   + A  A+  MN I L+G  ++VN AS      S+  N+ +       IF+G++  +V+E++L D FS FG I+   K++R  + G SKG+AF+++ + + ++ AI +M+  +L NR I  ++A +  +  E+      R   L+  + PL+  +
Sbjct:    6 NKCIYVGNLPHEITDQLLLTVFGHFGQCVGCHIMRD-FSGQINPYAFIEFNEHQAASLAVAGMNNISLWGHQLKVNWASGSQNPASNITNVKVDYSKAIQIFVGDIGLDVNEQMLKDAFSQFGSIIDV-KVVRYPD-GQSKGFAFLSFTNRQDAENAITSMHKTWLHNRTIKCNWATRNGTDEEQFKQYTPRPYELVYKEAPLTNTN 209          

HSP 2 Score: 57.7658 bits (138), Expect = 6.944e-9
Identity = 43/181 (23.76%), Postives = 84/181 (46.41%), Query Frame = 3
Query:  141 IYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVTGLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLD-------------------IGANIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYASFEASDAAIEAMNGQYLCNRAITVSY 626
            I+VG +   V E +L + F Q G +++V + +    G  +G+ F+ F   +DA+ A+  M+   L+ + I+ N A+ +  + +                      N+++  +   + E+L+   F  FG I  + K+  +      K YAFINY++ EA+  AI   +G  + N  +  ++
Sbjct:  105 IFVGDIGLDVNEQMLKDAFSQFGSIIDVKVVR-YPDGQSKGFAFLSFTNRQDAENAITSMHKTWLHNRTIKCNWATRNGTDEEQFKQYTPRPYELVYKEAPLTNTNVYVAGITENLTEELVRCHFEEFGRI-DSVKVFPD------KAYAFINYSTHEAAARAISQRHGYKINNNVVKCNW 277          
The following BLAST results are available for this feature:
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SF3B41.889e-13688.15splicing factor 3b subunit 4 [Source:HGNC Symbol;A... [more]
SF3B44.396e-11291.67splicing factor 3b subunit 4 [Source:HGNC Symbol;A... [more]
PABPC47.852e-3342.93poly(A) binding protein cytoplasmic 4 [Source:HGNC... [more]
PABPC48.755e-3342.93poly(A) binding protein cytoplasmic 4 [Source:HGNC... [more]
PABPC49.089e-3342.93poly(A) binding protein cytoplasmic 4 [Source:HGNC... [more]
back to top
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sap-491.564e-12780.28Splicing factor 3B subunit 4 [Source:UniProtKB/Sw... [more]
pab-11.638e-2838.80Polyadenylate-binding protein [Source:UniProtKB/T... [more]
pab-11.638e-2838.80Polyadenylate-binding protein [Source:UniProtKB/T... [more]
pab-11.638e-2838.80Polyadenylate-binding protein [Source:UniProtKB/T... [more]
pab-11.638e-2838.80Polyadenylate-binding protein [Source:UniProtKB/T... [more]
back to top
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Spx5.346e-13183.18gene:FBgn0015818 transcript:FBtr0070894[more]
pAbp9.331e-2737.16gene:FBgn0265297 transcript:FBtr0086738[more]
pAbp9.331e-2737.16gene:FBgn0265297 transcript:FBtr0086736[more]
pAbp9.331e-2737.16gene:FBgn0265297 transcript:FBtr0086740[more]
Rox81.631e-2233.90gene:FBgn0005649 transcript:FBtr0084592[more]
back to top
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sf3b45.556e-13987.85splicing factor 3b, subunit 4 [Source:ZFIN;Acc:ZDB... [more]
pabpc44.388e-3241.85poly(A) binding protein, cytoplasmic 4 (inducible ... [more]
pabpc44.502e-3241.85poly(A) binding protein, cytoplasmic 4 (inducible ... [more]
pabpc44.502e-3241.85poly(A) binding protein, cytoplasmic 4 (inducible ... [more]
pabpc1a3.654e-3140.76poly(A) binding protein, cytoplasmic 1a [Source:ZF... [more]
back to top
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoxa32.405e-13988.26homeobox A3 [Source:Xenbase;Acc:XB-GENE-482267][more]
hoxa34.567e-13289.55homeobox A3 [Source:Xenbase;Acc:XB-GENE-482267][more]
pabpc41.814e-3441.85poly(A) binding protein cytoplasmic 4 [Source:NCBI... [more]
pabpc47.790e-3341.85poly(A) binding protein cytoplasmic 4 [Source:NCBI... [more]
pabpc43.426e-3241.85poly(A) binding protein cytoplasmic 4 [Source:NCBI... [more]
back to top
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sf3b41.215e-13688.15splicing factor 3b, subunit 4 [Source:MGI Symbol;A... [more]
Pabpc42.587e-3545.40poly(A) binding protein, cytoplasmic 4 [Source:MGI... [more]
Pabpc44.165e-3342.93poly(A) binding protein, cytoplasmic 4 [Source:MGI... [more]
Pabpc44.738e-3342.93poly(A) binding protein, cytoplasmic 4 [Source:MGI... [more]
Pabpc44.875e-3342.93poly(A) binding protein, cytoplasmic 4 [Source:MGI... [more]
back to top
BLAST of Splicing factor 3b subunit 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6AYL5|SF3B4_RAT8.499e-13688.15Splicing factor 3B subunit 4 OS=Rattus norvegicus ... [more]
sp|Q8QZY9|SF3B4_MOUSE8.499e-13688.15Splicing factor 3B subunit 4 OS=Mus musculus OX=10... [more]
sp|Q15427|SF3B4_HUMAN9.072e-13688.15Splicing factor 3B subunit 4 OS=Homo sapiens OX=96... [more]
sp|Q09442|SF3B4_CAEEL1.989e-12680.28Splicing factor 3B subunit 4 OS=Caenorhabditis ele... [more]
sp|O14102|SAP49_SCHPO2.405e-8063.39Spliceosome-associated protein 49 OS=Schizosacchar... [more]
back to top
BLAST of Splicing factor 3b subunit 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3NQF59.688e-13989.77Uncharacterized protein (Fragment) OS=Schistocepha... [more]
A0A4S2LJ901.091e-13888.79Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A075A2831.327e-13888.79Uncharacterized protein OS=Opisthorchis viverrini ... [more]
G7YT131.496e-13888.79Splicing factor 3B subunit 4 OS=Clonorchis sinensi... [more]
A0A0R3U1G41.680e-13890.61Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sf3b45.550e-13988.26splicing factor 3b subunit 4 [Source:NCBI gene;Acc... [more]
pabpc44.488e-3241.85poly(A) binding protein, cytoplasmic 4 (inducible ... [more]
pabpc44.585e-3241.85poly(A) binding protein, cytoplasmic 4 (inducible ... [more]
ENSAMXT00000018970.22.629e-3140.76polyadenylate-binding protein 1-like [Source:NCBI ... [more]
ENSAMXT00000035946.13.534e-3140.76polyadenylate-binding protein 1-like [Source:NCBI ... [more]
back to top
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sf3b44.687e-13987.79splicing factor 3b, subunit 4 [Source:ZFIN;Acc:ZDB... [more]
pabpc42.844e-3240.76poly(A) binding protein, cytoplasmic 4 (inducible ... [more]
ENSPMAT00000001683.15.539e-1646.05pep scaffold:Pmarinus_7.0:GL479187:63988:67530:1 g... [more]
HNRNPA01.502e-1527.92heterogeneous nuclear ribonucleoprotein A0 [Source... [more]
pabpc45.186e-1527.66poly(A) binding protein, cytoplasmic 4 (inducible ... [more]
back to top
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HSH499.407e-3736.41U2-snRNP associated splicing factor; similar to th... [more]
PAB14.223e-2437.87Poly(A) binding protein; part of the 3'-end RNA-pr... [more]
PUB15.169e-2230.99Poly (A)+ RNA-binding protein; abundant mRNP-compo... [more]
HRP16.515e-1531.08Subunit of cleavage factor I; cleavage factor I is... [more]
NSR11.102e-1424.59Nucleolar protein that binds nuclear localization ... [more]
back to top
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO424177.455e-13785.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332062.229e-2740.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352432.335e-2146.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO324921.326e-1527.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463067.491e-1429.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Splicing factor 3b subunit 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sf3b46.622e-13988.26splicing factor 3b subunit 4 [Source:NCBI gene;Acc... [more]
sf3b41.326e-13888.26splicing factor 3b subunit 4 [Source:NCBI gene;Acc... [more]
pabpc42.545e-3241.85poly(A) binding protein cytoplasmic 4 [Source:NCBI... [more]
pabpc45.330e-3241.85poly(A) binding protein cytoplasmic 4 [Source:NCBI... [more]
pabpc1a3.005e-3140.76poly(A) binding protein cytoplasmic 1 [Source:NCBI... [more]
back to top
BLAST of Splicing factor 3b subunit 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005564.13.173e-175100.00SMESG000005564.1[more]
SMESG000004978.11.574e-2540.61SMESG000004978.1[more]
SMESG000062663.13.001e-2335.56SMESG000062663.1[more]
SMESG000058745.11.180e-2135.76SMESG000058745.1[more]
SMESG000055085.14.371e-2130.43SMESG000055085.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022786 ID=SMED30022786|Name=Splicing factor 3b subunit 4|organism=Schmidtea mediterranea sexual|type=transcript|length=1352bp
TTTCAGATTAAATTTAAGATAGTGTTTAATAATTTTTCATTGTTAGATAT
CTAAAAATAACTTGTTTTAATAGTAATTTAAATATATTTTTTTAAAAAAT
GACTGTTGGGGCGATTGAAGAAAGAAATCAGGATGCCTCAATTTATGTTG
GTGGTTTAGATGGAAAAGTAACTGAAGCAATTTTATGGGAGTTATTTTTA
CAAGCTGGTCCAGTAGTTAATGTCCATATGCCTAAAGATCGAGTTACAGG
ATTGCATCAAGGGTATGGATTTGTAGAATTTCTTGGAGAGGAGGATGCTG
ATTATGCTATGAAAATAATGAATATGATAAAATTATATGGTAAACCAATA
AGAGTTAACAAAGCTTCTTCTCATCGTAAAAATCTTGATATTGGTGCTAA
TATTTTCATTGGGAATCTTGACCCAGAAGTTGATGAAAAATTACTCTATG
ACACTTTCAGTGCTTTTGGTGTAATTTTACAAACTCCAAAAATTATGAGA
GAAACTGAAAGTGGAAATTCTAAAGGTTATGCTTTTATTAATTATGCAAG
TTTCGAAGCTAGTGATGCGGCAATTGAAGCAATGAATGGACAGTATTTAT
GTAATAGAGCAATTACGGTTTCATATGCTTTCAAGAAAGACAGTAAAGGT
GAAAGACATGGTAGTGCAGCTGAGCGTTTACTGGCTGCTCAAAATCCATT
GTCTCAGGCTGACAGGCCACATCAATTGTTCGCTGACGGGCCTCCCGCTC
CTCCAATGATGATGATTCCTCCACCACCTCCTAATGCAATGCCACATCAT
TTACCACCGTTCCTTGAAGGAATGATGCCACCGCCTGCTCCTCAGTTTAT
TGGATTGCCTCCCCCACCACCTCCTCCCATTCACGTGTGGACAACTTCAG
GACCTGGGCCAGTAATTCCACCCCCTCCATTTAGACCTATGCCACCTCCA
CCTCCTCCCCCATCGTCATTCGCAACAGCTCCAGTCAACCTACCACCACC
ACCATCAATAGAAACTATAACAAATGGCGAATAATATTTTATATTTGTAA
TATTCGTGATTCATTATAAAATTTGTTTTTTATTGTAAAAATTTCGAGTA
ATTGTAGATGTTATGATTTTTTATAGTTGGGTGAGCATTTCCTTTTATTT
GATCCTTCGATATGTTGCGCGATTTGTAAAATTTAATGTTATCTTTGATA
GATGTTAGTTGGAAAATAGCTTTCTGTTATTGAACAAGTTTATTTGTGTA
GGGTGGTTATGGGTTACCGTGCCTTGATTTCAAAAAATATTGAATATATA
ACATTTGAGTCTCGTATCTTGAAGAGTTCTGGTGTAATTAAGGAACAATG
GT
back to top

protein sequence of SMED30022786-orf-1

>SMED30022786-orf-1 ID=SMED30022786-orf-1|Name=SMED30022786-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=312bp
MTVGAIEERNQDASIYVGGLDGKVTEAILWELFLQAGPVVNVHMPKDRVT
GLHQGYGFVEFLGEEDADYAMKIMNMIKLYGKPIRVNKASSHRKNLDIGA
NIFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRETESGNSKGYAFINYA
SFEASDAAIEAMNGQYLCNRAITVSYAFKKDSKGERHGSAAERLLAAQNP
LSQADRPHQLFADGPPAPPMMMIPPPPPNAMPHHLPPFLEGMMPPPAPQF
IGLPPPPPPPIHVWTTSGPGPVIPPPPFRPMPPPPPPPSSFATAPVNLPP
PPSIETITNGE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000429neoblast
PLANA:0002056medial muscle cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR034158SF3B4_RRM1
IPR034159SF3B4_RRM2
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
GO:0003674molecular_function
GO:0003723RNA binding
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
GO:0005634nucleus
GO:0005681spliceosomal complex
GO:0005689U12-type spliceosomal complex
Vocabulary: biological process
TermDefinition
GO:0006397mRNA processing
GO:0008150biological_process
GO:0008380RNA splicing
GO:0048026positive regulation of mRNA splicing, via spliceosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 101..175
e-value: 6.0E-22
score: 88.9
coord: 14..87
e-value: 4.1E-24
score: 96.1
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 102..172
e-value: 1.2E-18
score: 66.6
coord: 15..85
e-value: 9.1E-16
score: 57.5
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 13..91
score: 17.541
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 100..179
score: 16.927
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 4..99
e-value: 2.4E-27
score: 96.9
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 100..189
e-value: 1.8E-23
score: 84.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 269..311
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 269..302
NoneNo IPR availablePANTHERPTHR15241:SF183SPLICING FACTOR 3B SUBUNIT 4coord: 15..260
NoneNo IPR availablePANTHERPTHR15241TRANSFORMER-2-RELATEDcoord: 15..260
IPR034158SF3B4, RNA recognition motif 1CDDcd12334RRM1_SF3B4coord: 15..88
e-value: 2.08139E-55
score: 172.393
IPR034159SF3B4, RNA recognition motif 2CDDcd12335RRM2_SF3B4coord: 99..181
e-value: 2.94797E-60
score: 185.191
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 12..183