Rho guanine nucleotide exchange factor 12

Overview
NameRho guanine nucleotide exchange factor 12
Smed IDSMED30022776
Length (bp)5052
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Rho guanine nucleotide exchange factor 12 (SMED30022776) t-SNE clustered cells

Violin plots show distribution of expression levels for Rho guanine nucleotide exchange factor 12 (SMED30022776) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Rho guanine nucleotide exchange factor 12 (SMED30022776) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Rho guanine nucleotide exchange factor 12 (SMED30022776) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022776

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30022776h1SMcG0022176 Contig40929newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022776h1SMcG0022176 Contig40929uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
cephalic gangliaSMED30022776h1SMcG0022176 dd_Smed_v4_6070_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30022776h1SMcG0022176 dd_Smed_v4_6070_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022776h1SMcG0022176 dd_Smed_v4_6070_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30022776h1SMcG0022176 dd_Smed_v4_6070_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022776h1SMcG0022176 dd_Smed_v6_6070_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022776h1SMcG0022176 dd_Smed_v4_6070_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Human
Match: ARHGEF12 (Rho guanine nucleotide exchange factor 12 [Source:HGNC Symbol;Acc:HGNC:14193])

HSP 1 Score: 71.633 bits (174), Expect = 1.582e-11
Identity = 39/99 (39.39%), Postives = 60/99 (60.61%), Query Frame = 2
Query:  257 CVFV-RDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDPIPSPNFASFPTRTSQISPPVI 550
            CV + +D  G+G  ++G+ PV VQ+V+ +G+A ++G++  D I+KVNG  V H  H +VV LI+  + V L V+ G P  SP     P   S++ P VI
Sbjct:   53 CVIIQKDDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGTLVTHSNHLEVVKLIKSGSYVALTVQ-GRPPGSPQ---IPLADSEVEPSVI 147          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Human
Match: ARHGEF12 (Rho guanine nucleotide exchange factor 12 [Source:HGNC Symbol;Acc:HGNC:14193])

HSP 1 Score: 71.633 bits (174), Expect = 1.613e-11
Identity = 39/99 (39.39%), Postives = 60/99 (60.61%), Query Frame = 2
Query:  257 CVFV-RDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDPIPSPNFASFPTRTSQISPPVI 550
            CV + +D  G+G  ++G+ PV VQ+V+ +G+A ++G++  D I+KVNG  V H  H +VV LI+  + V L V+ G P  SP     P   S++ P VI
Sbjct:   72 CVIIQKDDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGTLVTHSNHLEVVKLIKSGSYVALTVQ-GRPPGSPQ---IPLADSEVEPSVI 166          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Human
Match: ARHGEF11 (Rho guanine nucleotide exchange factor 11 [Source:HGNC Symbol;Acc:HGNC:14580])

HSP 1 Score: 70.0922 bits (170), Expect = 4.090e-11
Identity = 41/105 (39.05%), Postives = 62/105 (59.05%), Query Frame = 2
Query:  176 KSNSYH-QDSDSSAKSPNSTSLTSDERDCVFVRDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDP 487
            KS S+H Q SD+S     +T L   +R  +  +D +G+GF ++G+  V VQ+VR  G+A K+G++E D I+KVNG  V +  H +VV LI+    V L +    P
Sbjct:   26 KSPSHHRQPSDAS----ETTGLV--QRCVIIQKDQHGFGFTVSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLLGSSP 124          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Human
Match: ARHGEF11 (Rho guanine nucleotide exchange factor 11 [Source:HGNC Symbol;Acc:HGNC:14580])

HSP 1 Score: 70.0922 bits (170), Expect = 4.205e-11
Identity = 41/105 (39.05%), Postives = 62/105 (59.05%), Query Frame = 2
Query:  176 KSNSYH-QDSDSSAKSPNSTSLTSDERDCVFVRDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDP 487
            KS S+H Q SD+S     +T L   +R  +  +D +G+GF ++G+  V VQ+VR  G+A K+G++E D I+KVNG  V +  H +VV LI+    V L +    P
Sbjct:   26 KSPSHHRQPSDAS----ETTGLV--QRCVIIQKDQHGFGFTVSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLLGSSP 124          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Human
Match: SHANK2 (SH3 and multiple ankyrin repeat domains 2 [Source:HGNC Symbol;Acc:HGNC:14295])

HSP 1 Score: 54.6842 bits (130), Expect = 1.964e-6
Identity = 40/146 (27.40%), Postives = 71/146 (48.63%), Query Frame = 2
Query:  116 NNKNTKPVNYDKTRLRTNRTKSNSYHQDSDSSAKSPNSTSLTSDERDCVFVR-DSYGYGFKITG---NAPVK-------------VQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQ-----TKVELFVKNGDP 487
            N++  K V++ +TR   +R+K    H    S      S+    +E+  V  + D+ G+GF + G   + P++             +++V   G AW++GLR  D +++VN E+V+   H  VV++IR+       KV    +N DP
Sbjct:   12 NSRFKKKVHFGETR--ADRSKKLFRHYTVGSYDSFDTSSDCIIEEKTVVLQKKDNEGFGFVLRGAKADTPIEEFTPTPAFPALQYLESVDEGGVAWQAGLRTGDFLIEVNNENVVKVGHRQVVNMIRQGGNHLVLKVVTVTRNLDP 155          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Celegans
Match: rhgf-1 (RHo Guanine nucleotide exchange Factor [Source:UniProtKB/TrEMBL;Acc:G5EFE1])

HSP 1 Score: 55.8398 bits (133), Expect = 2.934e-7
Identity = 38/115 (33.04%), Postives = 58/115 (50.43%), Query Frame = 2
Query:  218 SPNSTSLTSDERDCVFVRDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDPIPSPNFASFPTRTSQ----ISPPVI 550
            S  S+S    ER  V  R   G+G  +    PV V  ++ +G+A+ +G+R+ D I+KVNG SV    H +V+ +I     V L +    P P  N  SFP +  +    I+ PV+
Sbjct:   40 STASSSYNMIERCVVVQRQPDGFGLTVNSEFPVYVHTLKQDGAAYCAGVRQGDRIVKVNGMSVSPNNHKEVLQMISNGHNVALTLLGKPPDPISNI-SFPNQQVEQKIHIADPVL 153          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Fly
Match: RhoGEF2 (gene:FBgn0023172 transcript:FBtr0340124)

HSP 1 Score: 72.4034 bits (176), Expect = 4.710e-12
Identity = 44/114 (38.60%), Postives = 64/114 (56.14%), Query Frame = 2
Query:  269 RDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDPIPSPNFASFPT----------RTSQIS--PPVIKKPRKEIE 574
            +DS GYG K++G+ PV V++V+  G+A  +GL   D+IL+VNG  V  ++H  VV LI+  T VEL VK    +  P+  S  T          RT+ I+   PV    R+E+E
Sbjct:  265 KDSNGYGMKVSGDNPVFVESVKPGGAAEIAGLVAGDMILRVNGHEVRLEKHPTVVGLIKASTTVELAVKRSQKLTRPSSVSVVTPSTPILSGRDRTASITGPQPVDSIKRREME 378          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Fly
Match: RhoGEF2 (gene:FBgn0023172 transcript:FBtr0086969)

HSP 1 Score: 72.4034 bits (176), Expect = 4.793e-12
Identity = 44/114 (38.60%), Postives = 64/114 (56.14%), Query Frame = 2
Query:  269 RDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDPIPSPNFASFPT----------RTSQIS--PPVIKKPRKEIE 574
            +DS GYG K++G+ PV V++V+  G+A  +GL   D+IL+VNG  V  ++H  VV LI+  T VEL VK    +  P+  S  T          RT+ I+   PV    R+E+E
Sbjct:  265 KDSNGYGMKVSGDNPVFVESVKPGGAAEIAGLVAGDMILRVNGHEVRLEKHPTVVGLIKASTTVELAVKRSQKLTRPSSVSVVTPSTPILSGRDRTASITGPQPVDSIKRREME 378          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Fly
Match: RhoGEF2 (gene:FBgn0023172 transcript:FBtr0086971)

HSP 1 Score: 71.633 bits (174), Expect = 6.743e-12
Identity = 44/114 (38.60%), Postives = 64/114 (56.14%), Query Frame = 2
Query:  269 RDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDPIPSPNFASFPT----------RTSQIS--PPVIKKPRKEIE 574
            +DS GYG K++G+ PV V++V+  G+A  +GL   D+IL+VNG  V  ++H  VV LI+  T VEL VK    +  P+  S  T          RT+ I+   PV    R+E+E
Sbjct:  265 KDSNGYGMKVSGDNPVFVESVKPGGAAEIAGLVAGDMILRVNGHEVRLEKHPTVVGLIKASTTVELAVKRSQKLTRPSSVSVVTPSTPILSGRDRTASITGPQPVDSIKRREME 378          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Fly
Match: RhoGEF2 (gene:FBgn0023172 transcript:FBtr0086970)

HSP 1 Score: 71.633 bits (174), Expect = 6.743e-12
Identity = 44/114 (38.60%), Postives = 64/114 (56.14%), Query Frame = 2
Query:  269 RDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDPIPSPNFASFPT----------RTSQIS--PPVIKKPRKEIE 574
            +DS GYG K++G+ PV V++V+  G+A  +GL   D+IL+VNG  V  ++H  VV LI+  T VEL VK    +  P+  S  T          RT+ I+   PV    R+E+E
Sbjct:  265 KDSNGYGMKVSGDNPVFVESVKPGGAAEIAGLVAGDMILRVNGHEVRLEKHPTVVGLIKASTTVELAVKRSQKLTRPSSVSVVTPSTPILSGRDRTASITGPQPVDSIKRREME 378          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Fly
Match: RhoGEF2 (gene:FBgn0023172 transcript:FBtr0305083)

HSP 1 Score: 71.633 bits (174), Expect = 7.152e-12
Identity = 44/114 (38.60%), Postives = 64/114 (56.14%), Query Frame = 2
Query:  269 RDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDPIPSPNFASFPT----------RTSQIS--PPVIKKPRKEIE 574
            +DS GYG K++G+ PV V++V+  G+A  +GL   D+IL+VNG  V  ++H  VV LI+  T VEL VK    +  P+  S  T          RT+ I+   PV    R+E+E
Sbjct:  265 KDSNGYGMKVSGDNPVFVESVKPGGAAEIAGLVAGDMILRVNGHEVRLEKHPTVVGLIKASTTVELAVKRSQKLTRPSSVSVVTPSTPILSGRDRTASITGPQPVDSIKRREME 378          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Zebrafish
Match: arhgef11 (Rho guanine nucleotide exchange factor (GEF) 11 [Source:ZFIN;Acc:ZDB-GENE-070604-1])

HSP 1 Score: 66.6254 bits (161), Expect = 1.775e-10
Identity = 37/90 (41.11%), Postives = 52/90 (57.78%), Query Frame = 2
Query:  257 CVFV-RDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDPIPSPNFASFPTR 523
            CV V RD+ G+GF + G     VQ VR  G+A K+G++E D I+KVNG  V    H +VV +I+  T V L ++     P P+ AS P +
Sbjct:   50 CVVVQRDNLGFGFTVCGERIKLVQNVRPGGAAVKAGVQEGDRIIKVNGSMVSSMSHQEVVKMIKSGTYVALTLQG----PPPSVASTPLQ 135          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Zebrafish
Match: arhgef12b (Rho guanine nucleotide exchange factor (GEF) 12b [Source:ZFIN;Acc:ZDB-GENE-070705-36])

HSP 1 Score: 65.4698 bits (158), Expect = 6.218e-10
Identity = 30/73 (41.10%), Postives = 47/73 (64.38%), Query Frame = 2
Query:  257 CVFV-RDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFV 472
            CV + +D  G+G  ++G+ PV VQ V+ +G+A ++G++  D I+KVNG  V H  H +VV LI+  + V L V
Sbjct:   48 CVIIQKDENGFGLTVSGDNPVFVQLVKEDGAAMRAGVQTGDRIIKVNGTLVTHSNHVEVVKLIKSGSYVALTV 120          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Zebrafish
Match: arhgef12b (Rho guanine nucleotide exchange factor (GEF) 12b [Source:ZFIN;Acc:ZDB-GENE-070705-36])

HSP 1 Score: 65.4698 bits (158), Expect = 7.002e-10
Identity = 30/73 (41.10%), Postives = 47/73 (64.38%), Query Frame = 2
Query:  257 CVFV-RDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFV 472
            CV + +D  G+G  ++G+ PV VQ V+ +G+A ++G++  D I+KVNG  V H  H +VV LI+  + V L V
Sbjct:   52 CVIIQKDENGFGLTVSGDNPVFVQLVKEDGAAMRAGVQTGDRIIKVNGTLVTHSNHVEVVKLIKSGSYVALTV 124          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Zebrafish
Match: arhgef12a (Rho guanine nucleotide exchange factor (GEF) 12a [Source:ZFIN;Acc:ZDB-GENE-121017-3])

HSP 1 Score: 62.3882 bits (150), Expect = 5.162e-9
Identity = 31/86 (36.05%), Postives = 50/86 (58.14%), Query Frame = 2
Query:  215 KSPNSTSLTSDERDCVFVRDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFV 472
            + P S  L   +R  +  +D  G+G  ++G+ PV VQ V+ +G+A ++G++  D I+KVNG  V    H +VV LI+  + V L V
Sbjct:   56 RRPESCGLV--QRCVIIQKDENGFGLTVSGDNPVFVQLVKQDGAAMRAGVQTGDRIIKVNGTLVTQSNHVEVVKLIKSGSYVALTV 139          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Zebrafish
Match: arhgef12a (Rho guanine nucleotide exchange factor (GEF) 12a [Source:ZFIN;Acc:ZDB-GENE-121017-3])

HSP 1 Score: 62.003 bits (149), Expect = 7.845e-9
Identity = 29/73 (39.73%), Postives = 46/73 (63.01%), Query Frame = 2
Query:  257 CVFV-RDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFV 472
            CV + +D  G+G  ++G+ PV VQ V+ +G+A ++G++  D I+KVNG  V    H +VV LI+  + V L V
Sbjct:   48 CVIIQKDENGFGLTVSGDNPVFVQLVKQDGAAMRAGVQTGDRIIKVNGTLVTQSNHVEVVKLIKSGSYVALTV 120          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Xenopus
Match: ARHGEF11 (Rho guanine nucleotide exchange factor 11 [Source:NCBI gene;Acc:100489979])

HSP 1 Score: 70.8626 bits (172), Expect = 2.273e-11
Identity = 37/88 (42.05%), Postives = 54/88 (61.36%), Query Frame = 2
Query:  257 CVFV-RDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDPIPSPNFASFP 517
            CV V RD  G+GF ++G+  V VQ+VR  G+A ++G++E D I+KVNG  V +  H +VV LI+    V L +  G P PS   + +P
Sbjct:   48 CVIVQRDQNGFGFTVSGDRIVLVQSVRPGGAAMRAGVQEGDRIVKVNGTLVANSSHIEVVKLIKSGAYVALTLL-GSPPPSMGISGYP 134          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Xenopus
Match: ARHGEF11 (Rho guanine nucleotide exchange factor 11 [Source:NCBI gene;Acc:100489979])

HSP 1 Score: 70.8626 bits (172), Expect = 2.313e-11
Identity = 41/103 (39.81%), Postives = 60/103 (58.25%), Query Frame = 2
Query:  212 AKSPNSTSLTSDERDCVFV-RDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDPIPSPNFASFP 517
             +S  ST L    + CV V RD  G+GF ++G+  V VQ+VR  G+A ++G++E D I+KVNG  V +  H +VV LI+    V L +  G P PS   + +P
Sbjct:   52 CESNESTGLV---QRCVIVQRDQNGFGFTVSGDRIVLVQSVRPGGAAMRAGVQEGDRIVKVNGTLVANSSHIEVVKLIKSGAYVALTLL-GSPPPSMGISGYP 150          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Xenopus
Match: ARHGEF11 (Rho guanine nucleotide exchange factor 11 [Source:NCBI gene;Acc:100489979])

HSP 1 Score: 70.4774 bits (171), Expect = 2.563e-11
Identity = 41/103 (39.81%), Postives = 60/103 (58.25%), Query Frame = 2
Query:  212 AKSPNSTSLTSDERDCVFV-RDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDPIPSPNFASFP 517
             +S  ST L    + CV V RD  G+GF ++G+  V VQ+VR  G+A ++G++E D I+KVNG  V +  H +VV LI+    V L +  G P PS   + +P
Sbjct:   52 CESNESTGLV---QRCVIVQRDQNGFGFTVSGDRIVLVQSVRPGGAAMRAGVQEGDRIVKVNGTLVANSSHIEVVKLIKSGAYVALTLL-GSPPPSMGISGYP 150          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Xenopus
Match: rai2 (retinoic acid induced 2 [Source:Xenbase;Acc:XB-GENE-965588])

HSP 1 Score: 70.4774 bits (171), Expect = 3.138e-11
Identity = 44/125 (35.20%), Postives = 68/125 (54.40%), Query Frame = 2
Query:  131 KPVNYDKTRLRTNRTKSNSYHQDSDSSAKSPNSTSLTSDERDCVFVRDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDPIPSPNF 505
            KP  +     R + T      + S SS+   ++T L   +R  V  RD  G+G  ++G+ PV VQ+V+ +G+A ++G++  D I+KVNG  V H  H +VV LI+  + V L V+ G P  SP  
Sbjct:   16 KPTRHGSILYRESSTDKKQKVERSVSSSHDFDATGLV--QRCVVIQRDENGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGTLVTHSNHIEVVKLIKSGSYVALTVQ-GRPPGSPTI 137          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Xenopus
Match: rai2 (retinoic acid induced 2 [Source:Xenbase;Acc:XB-GENE-965588])

HSP 1 Score: 69.707 bits (169), Expect = 5.001e-11
Identity = 45/125 (36.00%), Postives = 70/125 (56.00%), Query Frame = 2
Query:  161 RTNRTKSNSYHQDSDSSAKSPNSTSLTSDE---------RDCVFV-RDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDPIPSPNF 505
            +  R+ S+S+  D D++  S   T  T DE         + CV + RD  G+G  ++G+ PV VQ+V+ +G+A ++G++  D I+KVNG  V H  H +VV LI+  + V L V+ G P  SP  
Sbjct:   27 KVERSVSSSH--DFDATESSSRKTKSTWDESRQETYGLVQRCVVIQRDENGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGTLVTHSNHIEVVKLIKSGSYVALTVQ-GRPPGSPTI 148          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Mouse
Match: Arhgef11 (Rho guanine nucleotide exchange factor (GEF) 11 [Source:MGI Symbol;Acc:MGI:2441869])

HSP 1 Score: 68.9366 bits (167), Expect = 2.150e-12
Identity = 38/106 (35.85%), Postives = 61/106 (57.55%), Query Frame = 2
Query:  170 RTKSNSYHQDSDSSAKSPNSTSLTSDERDCVFVRDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDP 487
            RT  + + Q SD+S     +T L   +R  +  +D +G+GF ++G+  V VQ+VR  G+A ++G++E D I+KVNG  V +  H +VV LI+    V L +    P
Sbjct:   36 RTSPSHHRQPSDTS----ETTGLV--QRCVIIQKDQHGFGFTVSGDRIVLVQSVRPGGAAMRAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLLGSSP 135          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Mouse
Match: Arhgef12 (Rho guanine nucleotide exchange factor (GEF) 12 [Source:MGI Symbol;Acc:MGI:1916882])

HSP 1 Score: 70.8626 bits (172), Expect = 1.717e-11
Identity = 39/98 (39.80%), Postives = 59/98 (60.20%), Query Frame = 2
Query:  257 CVFV-RDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDPIPSPNFASFPTRTSQISPPV 547
            CV + +D  G+G  ++G+ PV VQ+V+ +G+A ++G++  D I+KVNG  V H  H +VV LIR  + V L V+ G P  SP     P   S++ P V
Sbjct:   72 CVIIQKDDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGTLVTHSNHLEVVKLIRSGSYVALTVQ-GRPPGSPQ---IPLADSEVEPSV 165          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Mouse
Match: Arhgef12 (Rho guanine nucleotide exchange factor (GEF) 12 [Source:MGI Symbol;Acc:MGI:1916882])

HSP 1 Score: 70.8626 bits (172), Expect = 1.761e-11
Identity = 39/98 (39.80%), Postives = 59/98 (60.20%), Query Frame = 2
Query:  257 CVFV-RDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDPIPSPNFASFPTRTSQISPPV 547
            CV + +D  G+G  ++G+ PV VQ+V+ +G+A ++G++  D I+KVNG  V H  H +VV LIR  + V L V+ G P  SP     P   S++ P V
Sbjct:   72 CVIIQKDDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGTLVTHSNHLEVVKLIRSGSYVALTVQ-GRPPGSPQ---IPLADSEVEPSV 165          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Mouse
Match: Arhgef11 (Rho guanine nucleotide exchange factor (GEF) 11 [Source:MGI Symbol;Acc:MGI:2441869])

HSP 1 Score: 69.707 bits (169), Expect = 3.996e-11
Identity = 38/106 (35.85%), Postives = 61/106 (57.55%), Query Frame = 2
Query:  170 RTKSNSYHQDSDSSAKSPNSTSLTSDERDCVFVRDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDP 487
            RT  + + Q SD+S     +T L   +R  +  +D +G+GF ++G+  V VQ+VR  G+A ++G++E D I+KVNG  V +  H +VV LI+    V L +    P
Sbjct:   25 RTSPSHHRQPSDTS----ETTGLV--QRCVIIQKDQHGFGFTVSGDRIVLVQSVRPGGAAMRAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLLGSSP 124          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Mouse
Match: Arhgef11 (Rho guanine nucleotide exchange factor (GEF) 11 [Source:MGI Symbol;Acc:MGI:2441869])

HSP 1 Score: 69.707 bits (169), Expect = 4.153e-11
Identity = 38/106 (35.85%), Postives = 61/106 (57.55%), Query Frame = 2
Query:  170 RTKSNSYHQDSDSSAKSPNSTSLTSDERDCVFVRDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDP 487
            RT  + + Q SD+S     +T L   +R  +  +D +G+GF ++G+  V VQ+VR  G+A ++G++E D I+KVNG  V +  H +VV LI+    V L +    P
Sbjct:   25 RTSPSHHRQPSDTS----ETTGLV--QRCVIIQKDQHGFGFTVSGDRIVLVQSVRPGGAAMRAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLLGSSP 124          
BLAST of Rho guanine nucleotide exchange factor 12 vs. UniProt/SwissProt
Match: sp|Q9NZN5|ARHGC_HUMAN (Rho guanine nucleotide exchange factor 12 OS=Homo sapiens OX=9606 GN=ARHGEF12 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 7.747e-11
Identity = 39/99 (39.39%), Postives = 60/99 (60.61%), Query Frame = 2
Query:  257 CVFV-RDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDPIPSPNFASFPTRTSQISPPVI 550
            CV + +D  G+G  ++G+ PV VQ+V+ +G+A ++G++  D I+KVNG  V H  H +VV LI+  + V L V+ G P  SP     P   S++ P VI
Sbjct:   72 CVIIQKDDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGTLVTHSNHLEVVKLIKSGSYVALTVQ-GRPPGSPQ---IPLADSEVEPSVI 166          
BLAST of Rho guanine nucleotide exchange factor 12 vs. UniProt/SwissProt
Match: sp|Q8R4H2|ARHGC_MOUSE (Rho guanine nucleotide exchange factor 12 OS=Mus musculus OX=10090 GN=Arhgef12 PE=1 SV=2)

HSP 1 Score: 70.8626 bits (172), Expect = 1.232e-10
Identity = 39/98 (39.80%), Postives = 59/98 (60.20%), Query Frame = 2
Query:  257 CVFV-RDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDPIPSPNFASFPTRTSQISPPV 547
            CV + +D  G+G  ++G+ PV VQ+V+ +G+A ++G++  D I+KVNG  V H  H +VV LIR  + V L V+ G P  SP     P   S++ P V
Sbjct:   72 CVIIQKDDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGTLVTHSNHLEVVKLIRSGSYVALTVQ-GRPPGSPQ---IPLADSEVEPSV 165          
BLAST of Rho guanine nucleotide exchange factor 12 vs. UniProt/SwissProt
Match: sp|O15085|ARHGB_HUMAN (Rho guanine nucleotide exchange factor 11 OS=Homo sapiens OX=9606 GN=ARHGEF11 PE=1 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 2.019e-10
Identity = 41/105 (39.05%), Postives = 62/105 (59.05%), Query Frame = 2
Query:  176 KSNSYH-QDSDSSAKSPNSTSLTSDERDCVFVRDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDP 487
            KS S+H Q SD+S     +T L   +R  +  +D +G+GF ++G+  V VQ+VR  G+A K+G++E D I+KVNG  V +  H +VV LI+    V L +    P
Sbjct:   26 KSPSHHRQPSDAS----ETTGLV--QRCVIIQKDQHGFGFTVSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLLGSSP 124          
BLAST of Rho guanine nucleotide exchange factor 12 vs. UniProt/SwissProt
Match: sp|Q9ES67|ARHGB_RAT (Rho guanine nucleotide exchange factor 11 OS=Rattus norvegicus OX=10116 GN=Arhgef11 PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 9.222e-10
Identity = 37/107 (34.58%), Postives = 59/107 (55.14%), Query Frame = 2
Query:  167 NRTKSNSYHQDSDSSAKSPNSTSLTSDERDCVFVRDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDP 487
             RT  + + Q SD+S      T+    +R  +  +D +G+GF ++G+  V VQ+VR  G+A K+G++E D I+KVNG  V +  H +VV LI+      L +    P
Sbjct:   40 ERTSPSHHRQPSDTS-----ETTAGLVQRCVIIQKDQHGFGFTVSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYAALTLLGSSP 141          
BLAST of Rho guanine nucleotide exchange factor 12 vs. TrEMBL
Match: A0A158R8I9 (PDZ domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS5534 PE=4 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 3.886e-56
Identity = 141/430 (32.79%), Postives = 218/430 (50.70%), Query Frame = 2
Query: 2747 DPDMKVDESFDAGGEINTHFPNLD-PN-----ADKKRLIVLLEFYHKTRYILMNLKRFLYKLVNKWPLSQNYYFKALSLDCIQPFVNLIKSLVTAIEGCIKEQDFVDLETAVLNWLSENKDHNLQEWINLSSNLCCTNSLYIVKQLKQTTMRTIPELNSLLNVKMHKMVIVEELTQIRPLLISLPLIVKNIIKCLTKSEPLYTDQLMIWCKVSIKMDYLCEYIDRCCVPLVDWINNGSIGKRIDRSEWYLRPKETECVDQDIISYCTDFPRTLFHFPIFDFQMAKIFSWSRNQRSKLA-NTDSRIN--YFKKGAEVLLIFYKTLIVVLQKENDHYILKPIKPFKNV-----------------------------TERIFPIIEKNAFMATNGGQEDDCYILNIINKKQEDASLIRVGFTRKEFVENWLD 3922
            DP+M + ESF+A  E+  HFPN + P       D  R +VLLEF+ K RY++  LK+F Y L+ +WP         ++LD I   + L +SLV AIE  ++ Q + ++  AVL WLS++ + NL+ W+     L CTN L  VK + +   R  P++  +L  + +K V++E L+Q+R L  +LPLI  NI+K L K    Y  +  IW ++  K+  +   ID+ C+PLV  IN+G+    +D+ E   R  + +            FPRTLF F + D  +  +         KL   +D+++N  Y K+  EVL +   T +++L K+   Y L+P KPFK                               T ++ PI   ++  A+ G Q    Y+LN+I KKQ  A L+R+ F+ KE  E WL+
Sbjct: 1387 DPEMDISESFEAATELRIHFPNYEIPTKGPRIQDHVRTLVLLEFHQKVRYMVCYLKQFEYLLLRRWPREHQNLADLMALDRIPRLIRLFRSLVYAIEQTVEPQGYGNMAEAVLTWLSKDDEANLKAWVRDCQALSCTNMLDSVKAMVREYARKHPDIQVVLETRFNKFVLIESLSQVRILYFNLPLISSNIMKDLEKKASNYKAEAKIWKEIHSKLASIPHSIDKICMPLVKLINDGNFFSTVDKGEQLTR-HQAQGGYLPFADLLLHFPRTLFRFWVIDHAVIAV--------DKLTFTSDNKVNYDYVKERTEVLAVLLNTALMLLVKDGGRYGLRPFKPFKEPGMENLPTSTSNTASLSSTQFVVAPNLLGNTMKLSPIFSTDSVFASLGEQIGQEYMLNMIFKKQ--AMLLRLSFSSKETREKWLN 1805          
BLAST of Rho guanine nucleotide exchange factor 12 vs. TrEMBL
Match: A0A3P6S0S2 (RGS-like domain-containing protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS2143 PE=4 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 3.583e-54
Identity = 183/663 (27.60%), Postives = 289/663 (43.59%), Query Frame = 2
Query: 2108 KKPKSISGHAVIDAVCLQPEDCGVCESVLWGIAPQGCFCTVCQTFFHMNCKKKIKVQCXXXXXXXXXXXGNKEEKPSTTLFGRLXXXXXXXXXXXXXXXXXIEVNSNVGK----NIFNNNSLVLDEKTRKFRITYRRRNTILVSIYSQGHNTYDENTGVSKAKSEDQLHRINSSMEPNNYIVNGSSVNISMENNNAGSFQITSTV--QIQELVTDESMEDPDMKVDESFDAGGEINTHFPNLD-----PNA-DKKRLIVLLEFYHKTRYILMNLKRFLYKLVNKWPLSQNYYFKALSLDCIQPFVNLIKSLVTAIEGCIKEQDFVDLETAVLNWLSENKDHNLQEWINLSSNLCCTNSLYIVKQLKQTTMRTIPELNSLLNVKMHKMVIVEELTQIRPLLISLPLIVKNIIKCLTKSEPLYTDQLMIWCKVSIKMDYLCEYIDRCCVPLVDWINNGSIGKRIDRSEWYLRPKETECVDQDIISYCTDFPRTLFHFPIFDFQMAKIFSWSRNQRSKLANTDSRINYFKKGAEVLLIFYKTLIVVLQKENDHYILKPIKPFK-------------------------------------NVTER-----------IFPIIEKNAFMATNGGQEDDCYILNIINKKQEDASLIRVGFTRKEFVENW 3916
            K   S+ GH + +    +  +C VC  +LWG+APQG     CQT      K  +       S       G   + PS       +  +    +      + +  +   G+    NI  + S           I+YRR + +    ++  H  + +    S + S+ +L +         +  +  S+    E    G   ITS V   +Q+L   +  +D DMK  ESFDA  E+ THFPN +     P   D  R +VLLEF+ K RY++  LK+F Y L+  WP    Y  + L LD I   + L +SLV  IE  ++ Q + DL  AVL WL+ N   NL+ W      L CTN L  VK  ++   R  P +  LL  + +K V+++ LTQ+R L  +LPLIVKNI K L K    Y ++  +W ++  K+  L   ID  C+PLV  INN      +D+ E   R  + +       +   +FPRTLF + + D     +  ++    +K+       +Y ++  +VL I  +  +++L KE D Y+++P KP K                                     N+++R           + P+   ++   + G      Y+LN+I KK   A L+R+ FT+K+  E W
Sbjct:  287 KSTTSVKGHNLQERCFERIAECAVCGELLWGLAPQG---YSCQTGPCDEEKSALAASTEEISHCRNHSWGEVFQAPSVLPASGSTSVNDPAPIPEATPSADLTASGPNGRSNRVNIGYSQS-----------ISYRRSDGLKSPDFATRHIRHSKPPYESYSGSDIRLSK---------HATSTLSLLSPSEQEKQG---ITSPVGDNMQKLCPFDWSDDQDMKEQESFDALIELRTHFPNYEVPTKGPRVQDHVRTLVLLEFHQKVRYMVSYLKQFDYLLIRPWPAEHKYLREMLCLDHIPLLIGLFQSLVAVIESTVEPQGYGDLANAVLEWLTVNNGENLKAWSRHCQALSCTNMLDCVKAARREYARKNPRIQPLLETRFNKFVLIDGLTQMRVLYFNLPLIVKNITKDLEKKTTKYKEEAKVWQEIYTKLSSLPYTIDTVCMPLVKLINNNQFYSTVDKKEQLTR-HQAQGGTVPFSTLLLEFPRTLFQYYVVDHAEVTVDKFTFTSETKI-----NYDYLREKTDVLAILLEDALLLLIKEGDRYVMRPFKPTKEQGMGADTPAPPSAGPNSSGASGAAHPLNSSLAASNANLSDRPSGNTLGNTMKLLPVFPLDSVFTSRGENIGGEYMLNMIFKKL--AVLLRIYFTKKDLRERW 915          
BLAST of Rho guanine nucleotide exchange factor 12 vs. TrEMBL
Match: A0A5K3F140 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 1.071e-52
Identity = 135/427 (31.62%), Postives = 213/427 (49.88%), Query Frame = 2
Query: 2747 DPDMKVDESFDAGGEINTHFPNLD-----PNA-DKKRLIVLLEFYHKTRYILMNLKRFLYKLVNKWPLSQNYYFKALSLDCIQPFVNLIKSLVTAIEGCIKEQDFVDLETAVLNWLSENKDHNLQEWINLSSNLCCTNSLYIVKQLKQTTMRTIPELNSLLNVKMHKMVIVEELTQIRPLLISLPLIVKNIIKCLTKSEPLYTDQLMIWCKVSIKMDYLCEYIDRCCVPLVDWINNGSIGKRIDRSEWYLRPKETECVDQDIISYCTDFPRTLFHFPIFDFQMAKIFSWSRNQRSKLA-NTDSRIN--YFKKGAEVLLIFYKTLIVVLQKENDHYILKPIKPFKNV--------------------------TERIFPIIEKNAFMATNGGQEDDCYILNIINKKQEDASLIRVGFTRKEFVENWLD 3922
            DP+M   E+F+A  E+  HFPN +     P   D  R +VLLEF+ K RY++  LK+F Y L+  WP         ++LD I   + L +SLV  IEG ++ Q +  +  AVL WLSE+ + NL+ W+     L CTN L  VK   +   R  P++  LL  + +K V++E L+Q+R L  +LPLI  NI+K L K    Y ++  +W ++  K+  +   ID+ C+PLV  IN+G     +D+ E   R  + +  +        +FPRT+F + + D+    +         KL   +D+R+N  Y K+  +VL I     +V+L K+   Y L+P KP K                            T ++ P+   ++   + G +    Y+LN+I K+Q  A L+R+ F+ KE  E WL+
Sbjct: 1436 DPEMNALETFEAATELRIHFPNYEIPTKGPRVEDHVRTLVLLEFHQKVRYMVCYLKQFDYLLLQCWPKEHQRLADIMALDRIPRLIRLFRSLVHTIEGTLEPQGYGKMAEAVLAWLSEDDEANLKAWLRDCQALSCTNMLDSVKATVREYGRKHPDIQPLLETRFNKFVLIEGLSQVRVLYFNLPLISNNIMKDLEKKTSSYKNEAKLWKEIHTKLASIPHSIDKICMPLVKLINDGHFFSTVDKGEQLTR-HQAQGGNVPFADILLEFPRTIFRYWVIDYAEIAV--------DKLTFTSDNRVNYDYVKERTDVLAILLNCALVLLVKDGGRYGLRPFKPSKEASVENANAGVSATSLGTTQSTPNMLGNTMKLSPVFSTDSVFTSRGEKIGHEYMLNMIFKEQ--AVLLRLSFSSKETREKWLN 1851          
BLAST of Rho guanine nucleotide exchange factor 12 vs. TrEMBL
Match: A0A5K3EYF4 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 1.303e-52
Identity = 135/427 (31.62%), Postives = 213/427 (49.88%), Query Frame = 2
Query: 2747 DPDMKVDESFDAGGEINTHFPNLD-----PNA-DKKRLIVLLEFYHKTRYILMNLKRFLYKLVNKWPLSQNYYFKALSLDCIQPFVNLIKSLVTAIEGCIKEQDFVDLETAVLNWLSENKDHNLQEWINLSSNLCCTNSLYIVKQLKQTTMRTIPELNSLLNVKMHKMVIVEELTQIRPLLISLPLIVKNIIKCLTKSEPLYTDQLMIWCKVSIKMDYLCEYIDRCCVPLVDWINNGSIGKRIDRSEWYLRPKETECVDQDIISYCTDFPRTLFHFPIFDFQMAKIFSWSRNQRSKLA-NTDSRIN--YFKKGAEVLLIFYKTLIVVLQKENDHYILKPIKPFKNV--------------------------TERIFPIIEKNAFMATNGGQEDDCYILNIINKKQEDASLIRVGFTRKEFVENWLD 3922
            DP+M   E+F+A  E+  HFPN +     P   D  R +VLLEF+ K RY++  LK+F Y L+  WP         ++LD I   + L +SLV  IEG ++ Q +  +  AVL WLSE+ + NL+ W+     L CTN L  VK   +   R  P++  LL  + +K V++E L+Q+R L  +LPLI  NI+K L K    Y ++  +W ++  K+  +   ID+ C+PLV  IN+G     +D+ E   R  + +  +        +FPRT+F + + D+    +         KL   +D+R+N  Y K+  +VL I     +V+L K+   Y L+P KP K                            T ++ P+   ++   + G +    Y+LN+I K+Q  A L+R+ F+ KE  E WL+
Sbjct:  795 DPEMNALETFEAATELRIHFPNYEIPTKGPRVEDHVRTLVLLEFHQKVRYMVCYLKQFDYLLLQCWPKEHQRLADIMALDRIPRLIRLFRSLVHTIEGTLEPQGYGKMAEAVLAWLSEDDEANLKAWLRDCQALSCTNMLDSVKATVREYGRKHPDIQPLLETRFNKFVLIEGLSQVRVLYFNLPLISNNIMKDLEKKTSSYKNEAKLWKEIHTKLASIPHSIDKICMPLVKLINDGHFFSTVDKGEQLTR-HQAQGGNVPFADILLEFPRTIFRYWVIDYAEIAV--------DKLTFTSDNRVNYDYVKERTDVLAILLNCALVLLVKDGGRYGLRPFKPSKEASVENANAGVSATSLGTTQSTPNMLGNTMKLSPVFSTDSVFTSRGEKIGHEYMLNMIFKEQ--AVLLRLSFSSKETREKWLN 1210          
BLAST of Rho guanine nucleotide exchange factor 12 vs. TrEMBL
Match: A0A5K3EZ07 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 1.383e-52
Identity = 135/427 (31.62%), Postives = 213/427 (49.88%), Query Frame = 2
Query: 2747 DPDMKVDESFDAGGEINTHFPNLD-----PNA-DKKRLIVLLEFYHKTRYILMNLKRFLYKLVNKWPLSQNYYFKALSLDCIQPFVNLIKSLVTAIEGCIKEQDFVDLETAVLNWLSENKDHNLQEWINLSSNLCCTNSLYIVKQLKQTTMRTIPELNSLLNVKMHKMVIVEELTQIRPLLISLPLIVKNIIKCLTKSEPLYTDQLMIWCKVSIKMDYLCEYIDRCCVPLVDWINNGSIGKRIDRSEWYLRPKETECVDQDIISYCTDFPRTLFHFPIFDFQMAKIFSWSRNQRSKLA-NTDSRIN--YFKKGAEVLLIFYKTLIVVLQKENDHYILKPIKPFKNV--------------------------TERIFPIIEKNAFMATNGGQEDDCYILNIINKKQEDASLIRVGFTRKEFVENWLD 3922
            DP+M   E+F+A  E+  HFPN +     P   D  R +VLLEF+ K RY++  LK+F Y L+  WP         ++LD I   + L +SLV  IEG ++ Q +  +  AVL WLSE+ + NL+ W+     L CTN L  VK   +   R  P++  LL  + +K V++E L+Q+R L  +LPLI  NI+K L K    Y ++  +W ++  K+  +   ID+ C+PLV  IN+G     +D+ E   R  + +  +        +FPRT+F + + D+    +         KL   +D+R+N  Y K+  +VL I     +V+L K+   Y L+P KP K                            T ++ P+   ++   + G +    Y+LN+I K+Q  A L+R+ F+ KE  E WL+
Sbjct:  833 DPEMNALETFEAATELRIHFPNYEIPTKGPRVEDHVRTLVLLEFHQKVRYMVCYLKQFDYLLLQCWPKEHQRLADIMALDRIPRLIRLFRSLVHTIEGTLEPQGYGKMAEAVLAWLSEDDEANLKAWLRDCQALSCTNMLDSVKATVREYGRKHPDIQPLLETRFNKFVLIEGLSQVRVLYFNLPLISNNIMKDLEKKTSSYKNEAKLWKEIHTKLASIPHSIDKICMPLVKLINDGHFFSTVDKGEQLTR-HQAQGGNVPFADILLEFPRTIFRYWVIDYAEIAV--------DKLTFTSDNRVNYDYVKERTDVLAILLNCALVLLVKDGGRYGLRPFKPSKEASVENANAGVSATSLGTTQSTPNMLGNTMKLSPVFSTDSVFTSRGEKIGHEYMLNMIFKEQ--AVLLRLSFSSKETREKWLN 1248          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Cavefish
Match: arhgef11 (Rho guanine nucleotide exchange factor (GEF) 11 [Source:ZFIN;Acc:ZDB-GENE-070604-1])

HSP 1 Score: 67.781 bits (164), Expect = 1.109e-10
Identity = 40/104 (38.46%), Postives = 58/104 (55.77%), Query Frame = 2
Query:  212 AKSPNSTSLTSDERDCVFVRDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDPIPSPNFASFPTR 523
            A+S  +T L   +R  V  RD+ G+GF + G     VQ VR  G+A K+G++E D I+KVNG  V    H +VV +I+  T V L ++     P P+ AS P +
Sbjct:   38 AESAGNTRLV--QRCVVVQRDNLGFGFTVCGERIKLVQNVRPGGAAVKAGVQEGDRIIKVNGSLVSSMSHQEVVKMIKSGTYVALTLQG----PPPSVASVPLQ 135          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Cavefish
Match: arhgef12a (Rho guanine nucleotide exchange factor (GEF) 12a [Source:ZFIN;Acc:ZDB-GENE-121017-3])

HSP 1 Score: 63.5438 bits (153), Expect = 2.056e-9
Identity = 30/73 (41.10%), Postives = 47/73 (64.38%), Query Frame = 2
Query:  257 CVFV-RDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFV 472
            CV + +D  G+G  ++G+ PV VQ V+ +G+A ++G++  D I+KVNG  V H  H +VV LI+  + V L V
Sbjct:   57 CVIIQKDENGFGLTVSGDNPVFVQLVKEDGAAMRAGVQTGDRIIKVNGTLVTHSNHVEVVKLIKSGSYVALTV 129          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Cavefish
Match: arhgef12a (Rho guanine nucleotide exchange factor (GEF) 12a [Source:ZFIN;Acc:ZDB-GENE-121017-3])

HSP 1 Score: 63.5438 bits (153), Expect = 2.066e-9
Identity = 30/73 (41.10%), Postives = 47/73 (64.38%), Query Frame = 2
Query:  257 CVFV-RDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFV 472
            CV + +D  G+G  ++G+ PV VQ V+ +G+A ++G++  D I+KVNG  V H  H +VV LI+  + V L V
Sbjct:   48 CVIIQKDENGFGLTVSGDNPVFVQLVKEDGAAMRAGVQTGDRIIKVNGTLVTHSNHVEVVKLIKSGSYVALTV 120          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Cavefish
Match: shank3b (SH3 and multiple ankyrin repeat domains protein 3-like [Source:NCBI gene;Acc:103038576])

HSP 1 Score: 57.7658 bits (138), Expect = 1.369e-7
Identity = 40/130 (30.77%), Postives = 61/130 (46.92%), Query Frame = 2
Query:  140 NYD-KTRLRTNRTKSNSYHQDSDSSAKSPNSTSLTSDERDCVFV-RDSYGYGFKITG---NAPVK-------------VQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVK 475
             YD +   R +RTK    H    S     + +    +E+      RDS G+GF + G     P++             +++V + G AW++GLR  D +++VNG SV+   H  VVSLIR Q    L +K
Sbjct:  559 QYDPRLETREDRTKRLFRHYTVGSYDNYTSYSDYVIEEKSATLQKRDSEGFGFVLRGAKAETPIEEFTPTPAFPALQYLESVDLEGVAWRAGLRTGDFLIEVNGVSVVKVGHRQVVSLIR-QGGSRLLMK 687          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Cavefish
Match: shank3b (SH3 and multiple ankyrin repeat domains protein 3-like [Source:NCBI gene;Acc:103038576])

HSP 1 Score: 57.7658 bits (138), Expect = 1.369e-7
Identity = 40/130 (30.77%), Postives = 61/130 (46.92%), Query Frame = 2
Query:  140 NYD-KTRLRTNRTKSNSYHQDSDSSAKSPNSTSLTSDERDCVFV-RDSYGYGFKITG---NAPVK-------------VQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVK 475
             YD +   R +RTK    H    S     + +    +E+      RDS G+GF + G     P++             +++V + G AW++GLR  D +++VNG SV+   H  VVSLIR Q    L +K
Sbjct:  559 QYDPRLETREDRTKRLFRHYTVGSYDNYTSYSDYVIEEKSATLQKRDSEGFGFVLRGAKAETPIEEFTPTPAFPALQYLESVDLEGVAWRAGLRTGDFLIEVNGVSVVKVGHRQVVSLIR-QGGSRLLMK 687          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Sea Lamprey
Match: ARHGEF11 (Rho guanine nucleotide exchange factor 11 [Source:HGNC Symbol;Acc:HGNC:14580])

HSP 1 Score: 66.2402 bits (160), Expect = 6.917e-11
Identity = 30/71 (42.25%), Postives = 48/71 (67.61%), Query Frame = 2
Query:  257 CVFV-RDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVEL 466
            CV V +D +G+G  ++G+ PV VQ+VR +G+A ++G+++ D I+KVNG  V    H +VV LI+  + V L
Sbjct:    7 CVIVQKDEFGFGLTVSGDNPVFVQSVRKDGAAMRAGVQQGDRIIKVNGTLVTQSNHLEVVKLIKSGSYVAL 77          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Nematostella
Match: EDO48372 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJG2])

HSP 1 Score: 52.373 bits (124), Expect = 1.892e-6
Identity = 25/60 (41.67%), Postives = 38/60 (63.33%), Query Frame = 2
Query:  281 GYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKV 460
             +GFKI G APV + +V+ N  A ++GL+  D IL++NGE+V       +V L R+ T+V
Sbjct:   11 AFGFKIGGKAPVVIISVQDNSIAERAGLQAGDQILELNGENVQALTKDQIVLLARRSTRV 70          

HSP 2 Score: 51.2174 bits (121), Expect = 5.415e-6
Identity = 24/55 (43.64%), Postives = 37/55 (67.27%), Query Frame = 2
Query:  281 GYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIR 445
            G+GF +TGNAPV V+ V     A ++ L+  D IL++NG +V +K H+ VV L++
Sbjct:  330 GFGFTLTGNAPVCVRLVDKGSPAAQARLKPGDHILEINGLNVRNKTHAHVVELLK 384          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Nematostella
Match: EDO42539 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S157])

HSP 1 Score: 51.6026 bits (122), Expect = 2.906e-6
Identity = 48/162 (29.63%), Postives = 83/162 (51.23%), Query Frame = 2
Query:  281 GYGFKITGN----APVKVQAVRINGSAWKSG-LRENDIILKVNGESVIHKQHSDVVSLIRKQ---TKVELFVKNGDPIP----SPNFASFPTRTSQISPPVIKKPRKEIEXXXXXXXXXXXXXXSISDLSSSKNNLSPPTTSQG-NTLDRIRRSTESIGKSS 727
            G+GF I G       ++++++  +G+A K G LR  D ++KVNG SV++K H +VVS+ +       +EL +  G P+P     PN  +  + T      V++ P+ + +  L +       P + SD S S +N   P  ++G NT    R ST ++ +S+
Sbjct:  353 GFGFTIIGGDQSGELLQIKSIVPDGAAAKDGKLRTGDALIKVNGRSVVNKTHQEVVSMFQSMPTNEPIELDMIRGYPLPFDPDDPNVETIGSYT------VVRSPQGDNQSGLLQPANKYGLPNAHSDQSISSSNTDSPAGNRGYNTASFPRHSTSTLQRST 508          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Nematostella
Match: EDO36140 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJL5])

HSP 1 Score: 49.6766 bits (117), Expect = 7.783e-6
Identity = 26/68 (38.24%), Postives = 40/68 (58.82%), Query Frame = 2
Query:  272 DSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVV-SLIRKQTKVELFV 472
            D+ G+GF + G+ PV VQ V  +G A  +GL+    I  VNG+ V+H  H +V   ++R Q  ++L V
Sbjct:  324 DAVGFGFVVRGSEPVFVQTVDPSGPAAAAGLKVRMFIHSVNGKEVLHWTHKEVAKEILRGQNVLDLVV 391          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Medaka
Match: ENSORLT00000040351.1 (rho guanine nucleotide exchange factor 12-like [Source:NCBI gene;Acc:101168230])

HSP 1 Score: 66.2402 bits (160), Expect = 3.143e-10
Identity = 31/73 (42.47%), Postives = 47/73 (64.38%), Query Frame = 2
Query:  257 CVFV-RDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFV 472
            CV + RD  G+G  ++G+ PV VQ V+ +G+A ++G++  D I+KVNG  V H  H +VV LI+  + V L V
Sbjct:   47 CVIIQRDENGFGLTVSGDNPVFVQLVKEDGAAMRAGVQTGDRIIKVNGTLVTHSNHIEVVKLIKSGSYVALTV 119          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Medaka
Match: arhgef12a (Rho guanine nucleotide exchange factor 12 [Source:NCBI gene;Acc:101169798])

HSP 1 Score: 65.0846 bits (157), Expect = 7.335e-10
Identity = 30/73 (41.10%), Postives = 47/73 (64.38%), Query Frame = 2
Query:  257 CVFV-RDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFV 472
            CV + +D  G+G  ++G+ PV VQ V+ +G+A ++G++  D I+KVNG  V H  H +VV LI+  + V L V
Sbjct:   54 CVIIQKDENGFGLTVSGDNPVFVQLVKEDGAAMRAGVQTGDRIIKVNGTLVTHSNHIEVVKLIKSGSYVALTV 126          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Medaka
Match: arhgef12a (Rho guanine nucleotide exchange factor 12 [Source:NCBI gene;Acc:101169798])

HSP 1 Score: 65.0846 bits (157), Expect = 7.550e-10
Identity = 30/73 (41.10%), Postives = 47/73 (64.38%), Query Frame = 2
Query:  257 CVFV-RDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFV 472
            CV + +D  G+G  ++G+ PV VQ V+ +G+A ++G++  D I+KVNG  V H  H +VV LI+  + V L V
Sbjct:   76 CVIIQKDENGFGLTVSGDNPVFVQLVKEDGAAMRAGVQTGDRIIKVNGTLVTHSNHIEVVKLIKSGSYVALTV 148          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Medaka
Match: ENSORLT00000009961.2 (SH3 and multiple ankyrin repeat domains protein 1-like [Source:NCBI gene;Acc:101167744])

HSP 1 Score: 53.9138 bits (128), Expect = 1.992e-6
Identity = 32/115 (27.83%), Postives = 59/115 (51.30%), Query Frame = 2
Query:  269 RDSYGYGFKITG---NAPVK-------------VQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRK-----QTKVELFVKNGDPIPSPNFASFPTRTSQISPPVI 550
            +D+ G+GF + G     P++             +++V   G AW++GLR  D +++VNG++V+   H  VV++IR+       KV +  +N D +        P +T +++PP I
Sbjct:  608 KDNEGFGFVLRGAKAQTPIEEFTPTPAFPALQYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNSLMVKVVMVARNPD-LEDTARKRAPQQTKRLTPPAI 721          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Medaka
Match: shank1 (SH3 and multiple ankyrin repeat domains protein 1 [Source:NCBI gene;Acc:101165307])

HSP 1 Score: 51.9878 bits (123), Expect = 7.100e-6
Identity = 45/181 (24.86%), Postives = 83/181 (45.86%), Query Frame = 2
Query:  269 RDSYGYGFKITG---NAPVK-------------VQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRK-----QTKVELFVKNGDPIPSPNFASFPTRTSQISPPVI----KKPRKEIEXXXXXXXXXXXXXXSISDLSSSK-------------NNLSPPTTSQGNTLDRIR 697
            +DS G+GF + G     P++             +++V   G AW++GLR  D +++VNG++V+   H  VV++IR+       KV +  +N D +   +    P ++ +++ P I    K    E+E+   +  +   K  ++  ++ +K             NN +P T  QG   DR R
Sbjct:  707 KDSEGFGFVLRGAKAQTPIEEFTPTPAFPALQYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNSLMVKVVMVTRNPD-MEEGSRKKIPQQSKRLNTPAIALRSKSMTSELEEMEFESSQAVEKKRTVYQMALNKLDEILAAAQQTISNNEAPGTRGQGPKRDRGR 886          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Planmine SMEST
Match: SMESG000022871.1 (SMESG000022871.1)

HSP 1 Score: 2945.61 bits (7635), Expect = 0.000e+0
Identity = 1568/1596 (98.25%), Postives = 1574/1596 (98.62%), Query Frame = 2
Query:  113 MNNKNTKPVNYDKTRLRTNRTKSNSYHQDSDSSAKSPNSTSLTSDERDCVFVRDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDPIPSPNFASFPTRTSQISPPVIKKPRKEIEXXXXXXXXXXXXXXSISDLSSSKNNLSPPTTSQGNTLDRIRRSTESIGKSSDSHSDCSIGTSSTETDLHSHNYNYNKPKSNLRDMPESDTPPPKSKIVASNIPDLVEPNIPPSKQKIPKPFVLPKPNFHGSDYMPHKNTPEQLQLSKLDDSFEKDSPVKXXXXXXXXXXXXKLFHDPKLRFEDSRNKTIPTDKMKSNNMLGSDRDNNEFMGPPNMYSTLPKKLAPNRPNPIQKSKSISNNGLILGREFDDNQEDEDSDGSITIIELLSDTKDAISRPGIVAVLLNNVNDQPTDLNAMMLYYACKFYRSIDLKKDSESNACRMANEIITSFLLEKSPMFVDVGLETVEDILKNLKSGENMKNIFDRXXXXXXXXXDIIVERLKGRIQLGILDQTELPKLGNEVNKDMEIGQLHRTVCNILNKHSKEAKSFRGSSIDTNVDPSDYIVGKFIGLATIFQYFHKPTFSQGSAMRSRSTDGINTLGNQAKLLPIIDLYKCSMFCSAYTPKIFSSIRKKPKSISGHAVIDAVCLQPEDCGVCESVLWGIAPQGCFCTVCQTFFHMNCKKKIKVQCXXXXXXXXXXXGNKEEKPSTTLFGRLXXXXXXXXXXXXXXXXXIEVNSNVGKNIFNNNSLVLDEKTRKFRITYRRRNTILVSIYSQGHNTYDENTGVSKAKSEDQLHRINSSMEPNNYIVNGSSVNISMENNNAGSFQITSTVQIQELVTDESMEDPDMKVDESFDAGGEINTHFPNLDPNADKKRLIVLLEFYHKTRYILMNLKRFLYKLVNKWPLSQNYYFKALSLDCIQPFVNLIKSLVTAIEGCIKEQDFVDLETAVLNWLSENKDHNLQEWINLSSNLCCTNSLYIVKQLKQTTMRTIPELNSLLNVKMHKMVIVEELTQIRPLLISLPLIVKNIIKCLTKSEPLYTDQLMIWCKVSIKMDYLCEYIDRCCVPLVDWINNGSIGKRIDRSEWYLRPKETECVDQDIISYCTDFPRTLFHFPIFDFQMAKIFSWSRNQRSKLANTDSRINYFKKGAEVLLIFYKTLIVVLQKENDHYILKPIKPFKNVTERIFPIIEKNAFMATNGGQEDDCYILNIINKKQEDASLIRVGFTRKEFVENWLDYFSSDKHDLARSISLYKLNDIKDIXXXXXXXXXXXXXXXXXIKLKATDSTYSGHSTISTTPSLTDTKMXXXXXXXXXXXXXXXXXXXSAPVELIEGLTKASEIFAGTNVHLCKFLNINEDHSDLLEAVKNQGPKSLEEITLMFYSICGPMIDLTRHLIVSGSIQNPENANINKEDLKKTLFHISDQLKNIDFMKYTDKVDFTDESPNSITTNDGKAPEYCPTFCPREALNGNLSESETNSXXXXXXXXXXXXXXXXKSIDQIQQEPAVDKSYKYMPGKSLVSAMRENLERSSFNLTPSYHHLTNPIEETITTTRAQIVLNRSHNNN 4900
            MNNKNTKPVNYDKTRLRTNRTKSNSYHQDSDSSAKSPNSTSLTSDERDCVFVRDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDPIPSPNFASFPTRTSQISPPVIKKPRKEIEKPLTKLIKPPLKPLSISDLSSSKNNLSPP TSQGNTLD IRRSTESIGKSSDSHSD SIGTSSTETDLHSHNYNYNKPKSNLRDMPESDTPPPKSKIVASNIPDLVEPNIPPSKQKIPKPFVLPKPNFHGSDYMPHKNTPEQLQLSKLDDS EKDSPVKSHSYNASSNNSSKLFHDPKLRFEDSRNKTIPTDKMKSNNMLGSDRDNNEFMGPPNMYSTLPKKLAPNRPNPIQKSKSISNNGLILGREFDDNQEDEDSDGSITIIELLSDTKDAISRPGIVAVLLNNVNDQPTDLNAMMLYYACKFYRSIDLKKDS+SNACRMANEIITSFLLEKSPMF+DVGLETVEDILKNLKSGENMKNIFDRLLKVLLKLLDIIVERL  RIQLGILDQTELPKLG EVNKDMEIGQLHRTVCNILNKHSK            NVDPSDYIVGKFIGLATIFQYFHKPTFSQGSAMRSRSTDGINTLGNQAKLLPIIDLYKCSMFCSAYTPKIFSSIRKKPKSISGHAVIDAVCLQPEDCGVCESVLWGIAPQGCFCTVCQTFFHMNCKKKIKVQCSRKSRKSIIISGNKEEKPSTTLFGRLSRKSSTVSVKNVNSQSSIEVNSNVGK+IFNNNSLVLDEKTRKFRITYRRRNTILVSIYSQGHNTYDENTGVSKAKS+DQLHRINSSMEPNNYIVNGSSVNISMENNNAGSFQITSTVQIQELVTDESMEDPDMKVDESFDAGGEINTHFPNLDPNADKKRLIVLLEFYHKTRYILMNLKRFLYKLVNKWP SQNYYFKALSLDCIQPFVNLIKSLVTAIEGCIKEQDFVDLETAVLNWLSENKDHNLQEWINLSSNLCCTNSLYIVKQLKQTTMRT+PELNSLLNVKMHKMVIVEELTQIRPLLISLPLIVKNIIKCLTKSEPLYTDQLMIWCKVSIKMDYLCEYIDRCCVPLVDWINNGSIGKRIDRSEWYLRPKETECVDQDIISYCTDFPRTLFHFPIFDFQMAKIFSWSRNQRSKLANTDSRINYFKKGAEVLLIFYKTLIVVLQKENDHYILKPIKPFKNVTERIFPIIEKNAFMATNGGQEDDCYILNIINKKQEDASLIRVGFTRKEFVENWLDYFSSDKHDLARSISLYKLNDIKDISNPNMSVENNNFNSNTNIKLKATDSTYSGHSTISTTPSLTDTKMEDSIPDPEPEPEPA KEKISAP+ELIEGLTKASEIFAGTNVHLCKFLNINEDHSDLLEAVKNQGPKSLEEITLMFYSICGPMIDLTRHLIVSGSIQNPENANINKEDLKKTLFHISDQLKNIDFMKYTDKVDFTDESPNSITTNDGKAPEYCPTFCP EALNGNLSESETNSIEIVQEVKEIINEIVEKSIDQIQQEPAVDKSYKYMPGKSLVSAMRENLERSSFNLTPSYHHLTNPIEETITTTRAQIVLNRSHNNN
Sbjct:    1 MNNKNTKPVNYDKTRLRTNRTKSNSYHQDSDSSAKSPNSTSLTSDERDCVFVRDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDPIPSPNFASFPTRTSQISPPVIKKPRKEIEKPLTKLIKPPLKPLSISDLSSSKNNLSPPKTSQGNTLDCIRRSTESIGKSSDSHSDYSIGTSSTETDLHSHNYNYNKPKSNLRDMPESDTPPPKSKIVASNIPDLVEPNIPPSKQKIPKPFVLPKPNFHGSDYMPHKNTPEQLQLSKLDDSSEKDSPVKSHSYNASSNNSSKLFHDPKLRFEDSRNKTIPTDKMKSNNMLGSDRDNNEFMGPPNMYSTLPKKLAPNRPNPIQKSKSISNNGLILGREFDDNQEDEDSDGSITIIELLSDTKDAISRPGIVAVLLNNVNDQPTDLNAMMLYYACKFYRSIDLKKDSDSNACRMANEIITSFLLEKSPMFIDVGLETVEDILKNLKSGENMKNIFDRLLKVLLKLLDIIVERLIKRIQLGILDQTELPKLGKEVNKDMEIGQLHRTVCNILNKHSK------------NVDPSDYIVGKFIGLATIFQYFHKPTFSQGSAMRSRSTDGINTLGNQAKLLPIIDLYKCSMFCSAYTPKIFSSIRKKPKSISGHAVIDAVCLQPEDCGVCESVLWGIAPQGCFCTVCQTFFHMNCKKKIKVQCSRKSRKSIIISGNKEEKPSTTLFGRLSRKSSTVSVKNVNSQSSIEVNSNVGKHIFNNNSLVLDEKTRKFRITYRRRNTILVSIYSQGHNTYDENTGVSKAKSDDQLHRINSSMEPNNYIVNGSSVNISMENNNAGSFQITSTVQIQELVTDESMEDPDMKVDESFDAGGEINTHFPNLDPNADKKRLIVLLEFYHKTRYILMNLKRFLYKLVNKWPPSQNYYFKALSLDCIQPFVNLIKSLVTAIEGCIKEQDFVDLETAVLNWLSENKDHNLQEWINLSSNLCCTNSLYIVKQLKQTTMRTLPELNSLLNVKMHKMVIVEELTQIRPLLISLPLIVKNIIKCLTKSEPLYTDQLMIWCKVSIKMDYLCEYIDRCCVPLVDWINNGSIGKRIDRSEWYLRPKETECVDQDIISYCTDFPRTLFHFPIFDFQMAKIFSWSRNQRSKLANTDSRINYFKKGAEVLLIFYKTLIVVLQKENDHYILKPIKPFKNVTERIFPIIEKNAFMATNGGQEDDCYILNIINKKQEDASLIRVGFTRKEFVENWLDYFSSDKHDLARSISLYKLNDIKDISNPNMSVENNNFNSNTNIKLKATDSTYSGHSTISTTPSLTDTKMEDSIPDPEPEPEPAPKEKISAPIELIEGLTKASEIFAGTNVHLCKFLNINEDHSDLLEAVKNQGPKSLEEITLMFYSICGPMIDLTRHLIVSGSIQNPENANINKEDLKKTLFHISDQLKNIDFMKYTDKVDFTDESPNSITTNDGKAPEYCPTFCPGEALNGNLSESETNSIEIVQEVKEIINEIVEKSIDQIQQEPAVDKSYKYMPGKSLVSAMRENLERSSFNLTPSYHHLTNPIEETITTTRAQIVLNRSHNNN 1584          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Planmine SMEST
Match: SMESG000022871.1 (SMESG000022871.1)

HSP 1 Score: 2924.04 bits (7579), Expect = 0.000e+0
Identity = 1559/1596 (97.68%), Postives = 1565/1596 (98.06%), Query Frame = 2
Query:  113 MNNKNTKPVNYDKTRLRTNRTKSNSYHQDSDSSAKSPNSTSLTSDERDCVFVRDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDPIPSPNFASFPTRTSQISPPVIKKPRKEIEXXXXXXXXXXXXXXSISDLSSSKNNLSPPTTSQGNTLDRIRRSTESIGKSSDSHSDCSIGTSSTETDLHSHNYNYNKPKSNLRDMPESDTPPPKSKIVASNIPDLVEPNIPPSKQKIPKPFVLPKPNFHGSDYMPHKNTPEQLQLSKLDDSFEKDSPVKXXXXXXXXXXXXKLFHDPKLRFEDSRNKTIPTDKMKSNNMLGSDRDNNEFMGPPNMYSTLPKKLAPNRPNPIQKSKSISNNGLILGREFDDNQEDEDSDGSITIIELLSDTKDAISRPGIVAVLLNNVNDQPTDLNAMMLYYACKFYRSIDLKKDSESNACRMANEIITSFLLEKSPMFVDVGLETVEDILKNLKSGENMKNIFDRXXXXXXXXXDIIVERLKGRIQLGILDQTELPKLGNEVNKDMEIGQLHRTVCNILNKHSKEAKSFRGSSIDTNVDPSDYIVGKFIGLATIFQYFHKPTFSQGSAMRSRSTDGINTLGNQAKLLPIIDLYKCSMFCSAYTPKIFSSIRKKPKSISGHAVIDAVCLQPEDCGVCESVLWGIAPQGCFCTVCQTFFHMNCKKKIKVQCXXXXXXXXXXXGNKEEKPSTTLFGRLXXXXXXXXXXXXXXXXXIEVNSNVGKNIFNNNSLVLDEKTRKFRITYRRRNTILVSIYSQGHNTYDENTGVSKAKSEDQLHRINSSMEPNNYIVNGSSVNISMENNNAGSFQITSTVQIQELVTDESMEDPDMKVDESFDAGGEINTHFPNLDPNADKKRLIVLLEFYHKTRYILMNLKRFLYKLVNKWPLSQNYYFKALSLDCIQPFVNLIKSLVTAIEGCIKEQDFVDLETAVLNWLSENKDHNLQEWINLSSNLCCTNSLYIVKQLKQTTMRTIPELNSLLNVKMHKMVIVEELTQIRPLLISLPLIVKNIIKCLTKSEPLYTDQLMIWCKVSIKMDYLCEYIDRCCVPLVDWINNGSIGKRIDRSEWYLRPKETECVDQDIISYCTDFPRTLFHFPIFDFQMAKIFSWSRNQRSKLANTDSRINYFKKGAEVLLIFYKTLIVVLQKENDHYILKPIKPFKNVTERIFPIIEKNAFMATNGGQEDDCYILNIINKKQEDASLIRVGFTRKEFVENWLDYFSSDKHDLARSISLYKLNDIKDIXXXXXXXXXXXXXXXXXIKLKATDSTYSGHSTISTTPSLTDTKMXXXXXXXXXXXXXXXXXXXSAPVELIEGLTKASEIFAGTNVHLCKFLNINEDHSDLLEAVKNQGPKSLEEITLMFYSICGPMIDLTRHLIVSGSIQNPENANINKEDLKKTLFHISDQLKNIDFMKYTDKVDFTDESPNSITTNDGKAPEYCPTFCPREALNGNLSESETNSXXXXXXXXXXXXXXXXKSIDQIQQEPAVDKSYKYMPGKSLVSAMRENLERSSFNLTPSYHHLTNPIEETITTTRAQIVLNRSHNNN 4900
            MNNKNTKPVNYDKTRLRTNRTKSNSYHQDSDSSAKSPNSTSLTSDERDCVFVRDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDPIPSPNFASFPTRTSQISPPVIKKPRKEIEKPLTKLIKPPLKPLSISDLSSSKNNLSPP TSQGNTLD IRRSTESIGKSSDSHSD SIGTSSTETDLHSHNYNYNKPKSNLRDMPESDTPPPKSKIVASNIPDLVEPNIPPSKQKIPKPFVLPKPNFHGSDYMPHKNTPEQLQLSKLDDS EKDSPVKSHSYNASSNNSSKLFHDPKLRFEDSRNKTIPTDKMKSNNMLGSDRDNNEFMGPPNMYSTLPKKLAPNRPNPIQKSKSISNNGLILGREFDDNQEDEDSDGSITIIELLSDTKDAISRPGIVAVLLNNVNDQPTDLNAMMLYYACKFYRSIDLKKDS+SNACRMANEIITSFLLEKSPMF+DVGLETVEDILKNLKSGENMKNIFDRLLKVLLKLLDIIVERL  RIQLGILDQTELPKLG EVNKDMEIGQLHRTVCNILNKHSKEAKSFRGSSIDTNVDPSDYIVGKFIGLATIFQYFHKPTFSQGSAMRSRSTDGINTLGNQAKLLPIIDLYKCSMFCSAYTPKIFSSIRKKPKSISGHAVIDAVCLQPEDCGVCESVLWGIAPQGCFCTVCQTFFHMNCKKKIKVQCSRKSRKSIIISGNKEEKPSTTLFGRLSRKSSTVSVKNVNSQSSIEVNSNVGK+IFNNNSLVLDEKT                     HNTYDENTGVSKAKS+DQLHRINSSMEPNNYIVNGSSVNISMENNNAGSFQITSTVQIQELVTDESMEDPDMKVDESFDAGGEINTHFPNLDPNADKKRLIVLLEFYHKTRYILMNLKRFLYKLVNKWP SQNYYFKALSLDCIQPFVNLIKSLVTAIEGCIKEQDFVDLETAVLNWLSENKDHNLQEWINLSSNLCCTNSLYIVKQLKQTTMRT+PELNSLLNVKMHKMVIVEELTQIRPLLISLPLIVKNIIKCLTKSEPLYTDQLMIWCKVSIKMDYLCEYIDRCCVPLVDWINNGSIGKRIDRSEWYLRPKETECVDQDIISYCTDFPRTLFHFPIFDFQMAKIFSWSRNQRSKLANTDSRINYFKKGAEVLLIFYKTLIVVLQKENDHYILKPIKPFKNVTERIFPIIEKNAFMATNGGQEDDCYILNIINKKQEDASLIRVGFTRKEFVENWLDYFSSDKHDLARSISLYKLNDIKDISNPNMSVENNNFNSNTNIKLKATDSTYSGHSTISTTPSLTDTKMEDSIPDPEPEPEPA KEKISAP+ELIEGLTKASEIFAGTNVHLCKFLNINEDHSDLLEAVKNQGPKSLEEITLMFYSICGPMIDLTRHLIVSGSIQNPENANINKEDLKKTLFHISDQLKNIDFMKYTDKVDFTDESPNSITTNDGKAPEYCPTFCP EALNGNLSESETNSIEIVQEVKEIINEIVEKSIDQIQQEPAVDKSYKYMPGKSLVSAMRENLERSSFNLTPSYHHLTNPIEETITTTRAQIVLNRSHNNN
Sbjct:    1 MNNKNTKPVNYDKTRLRTNRTKSNSYHQDSDSSAKSPNSTSLTSDERDCVFVRDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDPIPSPNFASFPTRTSQISPPVIKKPRKEIEKPLTKLIKPPLKPLSISDLSSSKNNLSPPKTSQGNTLDCIRRSTESIGKSSDSHSDYSIGTSSTETDLHSHNYNYNKPKSNLRDMPESDTPPPKSKIVASNIPDLVEPNIPPSKQKIPKPFVLPKPNFHGSDYMPHKNTPEQLQLSKLDDSSEKDSPVKSHSYNASSNNSSKLFHDPKLRFEDSRNKTIPTDKMKSNNMLGSDRDNNEFMGPPNMYSTLPKKLAPNRPNPIQKSKSISNNGLILGREFDDNQEDEDSDGSITIIELLSDTKDAISRPGIVAVLLNNVNDQPTDLNAMMLYYACKFYRSIDLKKDSDSNACRMANEIITSFLLEKSPMFIDVGLETVEDILKNLKSGENMKNIFDRLLKVLLKLLDIIVERLIKRIQLGILDQTELPKLGKEVNKDMEIGQLHRTVCNILNKHSKEAKSFRGSSIDTNVDPSDYIVGKFIGLATIFQYFHKPTFSQGSAMRSRSTDGINTLGNQAKLLPIIDLYKCSMFCSAYTPKIFSSIRKKPKSISGHAVIDAVCLQPEDCGVCESVLWGIAPQGCFCTVCQTFFHMNCKKKIKVQCSRKSRKSIIISGNKEEKPSTTLFGRLSRKSSTVSVKNVNSQSSIEVNSNVGKHIFNNNSLVLDEKT--------------------SHNTYDENTGVSKAKSDDQLHRINSSMEPNNYIVNGSSVNISMENNNAGSFQITSTVQIQELVTDESMEDPDMKVDESFDAGGEINTHFPNLDPNADKKRLIVLLEFYHKTRYILMNLKRFLYKLVNKWPPSQNYYFKALSLDCIQPFVNLIKSLVTAIEGCIKEQDFVDLETAVLNWLSENKDHNLQEWINLSSNLCCTNSLYIVKQLKQTTMRTLPELNSLLNVKMHKMVIVEELTQIRPLLISLPLIVKNIIKCLTKSEPLYTDQLMIWCKVSIKMDYLCEYIDRCCVPLVDWINNGSIGKRIDRSEWYLRPKETECVDQDIISYCTDFPRTLFHFPIFDFQMAKIFSWSRNQRSKLANTDSRINYFKKGAEVLLIFYKTLIVVLQKENDHYILKPIKPFKNVTERIFPIIEKNAFMATNGGQEDDCYILNIINKKQEDASLIRVGFTRKEFVENWLDYFSSDKHDLARSISLYKLNDIKDISNPNMSVENNNFNSNTNIKLKATDSTYSGHSTISTTPSLTDTKMEDSIPDPEPEPEPAPKEKISAPIELIEGLTKASEIFAGTNVHLCKFLNINEDHSDLLEAVKNQGPKSLEEITLMFYSICGPMIDLTRHLIVSGSIQNPENANINKEDLKKTLFHISDQLKNIDFMKYTDKVDFTDESPNSITTNDGKAPEYCPTFCPGEALNGNLSESETNSIEIVQEVKEIINEIVEKSIDQIQQEPAVDKSYKYMPGKSLVSAMRENLERSSFNLTPSYHHLTNPIEETITTTRAQIVLNRSHNNN 1576          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Planmine SMEST
Match: SMESG000022871.1 (SMESG000022871.1)

HSP 1 Score: 2891.68 bits (7495), Expect = 0.000e+0
Identity = 1547/1596 (96.93%), Postives = 1553/1596 (97.31%), Query Frame = 2
Query:  113 MNNKNTKPVNYDKTRLRTNRTKSNSYHQDSDSSAKSPNSTSLTSDERDCVFVRDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDPIPSPNFASFPTRTSQISPPVIKKPRKEIEXXXXXXXXXXXXXXSISDLSSSKNNLSPPTTSQGNTLDRIRRSTESIGKSSDSHSDCSIGTSSTETDLHSHNYNYNKPKSNLRDMPESDTPPPKSKIVASNIPDLVEPNIPPSKQKIPKPFVLPKPNFHGSDYMPHKNTPEQLQLSKLDDSFEKDSPVKXXXXXXXXXXXXKLFHDPKLRFEDSRNKTIPTDKMKSNNMLGSDRDNNEFMGPPNMYSTLPKKLAPNRPNPIQKSKSISNNGLILGREFDDNQEDEDSDGSITIIELLSDTKDAISRPGIVAVLLNNVNDQPTDLNAMMLYYACKFYRSIDLKKDSESNACRMANEIITSFLLEKSPMFVDVGLETVEDILKNLKSGENMKNIFDRXXXXXXXXXDIIVERLKGRIQLGILDQTELPKLGNEVNKDMEIGQLHRTVCNILNKHSKEAKSFRGSSIDTNVDPSDYIVGKFIGLATIFQYFHKPTFSQGSAMRSRSTDGINTLGNQAKLLPIIDLYKCSMFCSAYTPKIFSSIRKKPKSISGHAVIDAVCLQPEDCGVCESVLWGIAPQGCFCTVCQTFFHMNCKKKIKVQCXXXXXXXXXXXGNKEEKPSTTLFGRLXXXXXXXXXXXXXXXXXIEVNSNVGKNIFNNNSLVLDEKTRKFRITYRRRNTILVSIYSQGHNTYDENTGVSKAKSEDQLHRINSSMEPNNYIVNGSSVNISMENNNAGSFQITSTVQIQELVTDESMEDPDMKVDESFDAGGEINTHFPNLDPNADKKRLIVLLEFYHKTRYILMNLKRFLYKLVNKWPLSQNYYFKALSLDCIQPFVNLIKSLVTAIEGCIKEQDFVDLETAVLNWLSENKDHNLQEWINLSSNLCCTNSLYIVKQLKQTTMRTIPELNSLLNVKMHKMVIVEELTQIRPLLISLPLIVKNIIKCLTKSEPLYTDQLMIWCKVSIKMDYLCEYIDRCCVPLVDWINNGSIGKRIDRSEWYLRPKETECVDQDIISYCTDFPRTLFHFPIFDFQMAKIFSWSRNQRSKLANTDSRINYFKKGAEVLLIFYKTLIVVLQKENDHYILKPIKPFKNVTERIFPIIEKNAFMATNGGQEDDCYILNIINKKQEDASLIRVGFTRKEFVENWLDYFSSDKHDLARSISLYKLNDIKDIXXXXXXXXXXXXXXXXXIKLKATDSTYSGHSTISTTPSLTDTKMXXXXXXXXXXXXXXXXXXXSAPVELIEGLTKASEIFAGTNVHLCKFLNINEDHSDLLEAVKNQGPKSLEEITLMFYSICGPMIDLTRHLIVSGSIQNPENANINKEDLKKTLFHISDQLKNIDFMKYTDKVDFTDESPNSITTNDGKAPEYCPTFCPREALNGNLSESETNSXXXXXXXXXXXXXXXXKSIDQIQQEPAVDKSYKYMPGKSLVSAMRENLERSSFNLTPSYHHLTNPIEETITTTRAQIVLNRSHNNN 4900
            MNNKNTKPVNYDKTRLRTNRTKSNSYHQDSDSSAKSPNSTSLTSDERDCVFVRDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDPIPSPNFASFPTRTSQISPPVIKKPRKEIEKPLTKLIKPPLKPLSISDLSSSKNNLSPP TSQGNTLD IRRSTESIGKSSDSHSD SIGTSSTETDLHSHNYNYNKPKSNLRDMPESDTPPPKSKIVASNIPDLVEPNIPPSKQKIPKPFVLPKPNFHGSDYMPHKNTPEQLQLSKLDDS EKDSPVKSHSYNASSNNSSKLFHDPKLRFEDSRNKTIPTDKMKSNNMLGSDRDNNEFMGPPNMYSTLPKKLAPNRPNPIQKSKSISNNGLILGREFDDNQEDEDSDGSITIIELLSDTKDAISRPGIVAVLLNNVNDQPTDLNAMMLYYACKFYRSIDLKKDS+SNACRMANEIITSFLLEKSPMF+DVGLETVEDILKNLKSGENMKNIFDRLLKVLLKLLDIIVERL  RIQLGILDQTELPKLG EVNKDMEIGQLHRTVCNILNKHSK            NVDPSDYIVGKFIGLATIFQYFHKPTFSQGSAMRSRSTDGINTLGNQAKLLPIIDLYKCSMFCSAYTPKIFSSIRKKPKSISGHAVIDAVCLQPEDCGVCESVLWGIAPQGCFCTVCQTFFHMNCKKKIKVQCSRKSRKSIIISGNKEEKPSTTLFGRLSRKSSTVSVKNVNSQSSIEVNSNVGK+IFNNNSLVLDEKT                     HNTYDENTGVSKAKS+DQLHRINSSMEPNNYIVNGSSVNISMENNNAGSFQITSTVQIQELVTDESMEDPDMKVDESFDAGGEINTHFPNLDPNADKKRLIVLLEFYHKTRYILMNLKRFLYKLVNKWP SQNYYFKALSLDCIQPFVNLIKSLVTAIEGCIKEQDFVDLETAVLNWLSENKDHNLQEWINLSSNLCCTNSLYIVKQLKQTTMRT+PELNSLLNVKMHKMVIVEELTQIRPLLISLPLIVKNIIKCLTKSEPLYTDQLMIWCKVSIKMDYLCEYIDRCCVPLVDWINNGSIGKRIDRSEWYLRPKETECVDQDIISYCTDFPRTLFHFPIFDFQMAKIFSWSRNQRSKLANTDSRINYFKKGAEVLLIFYKTLIVVLQKENDHYILKPIKPFKNVTERIFPIIEKNAFMATNGGQEDDCYILNIINKKQEDASLIRVGFTRKEFVENWLDYFSSDKHDLARSISLYKLNDIKDISNPNMSVENNNFNSNTNIKLKATDSTYSGHSTISTTPSLTDTKMEDSIPDPEPEPEPA KEKISAP+ELIEGLTKASEIFAGTNVHLCKFLNINEDHSDLLEAVKNQGPKSLEEITLMFYSICGPMIDLTRHLIVSGSIQNPENANINKEDLKKTLFHISDQLKNIDFMKYTDKVDFTDESPNSITTNDGKAPEYCPTFCP EALNGNLSESETNSIEIVQEVKEIINEIVEKSIDQIQQEPAVDKSYKYMPGKSLVSAMRENLERSSFNLTPSYHHLTNPIEETITTTRAQIVLNRSHNNN
Sbjct:    1 MNNKNTKPVNYDKTRLRTNRTKSNSYHQDSDSSAKSPNSTSLTSDERDCVFVRDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDPIPSPNFASFPTRTSQISPPVIKKPRKEIEKPLTKLIKPPLKPLSISDLSSSKNNLSPPKTSQGNTLDCIRRSTESIGKSSDSHSDYSIGTSSTETDLHSHNYNYNKPKSNLRDMPESDTPPPKSKIVASNIPDLVEPNIPPSKQKIPKPFVLPKPNFHGSDYMPHKNTPEQLQLSKLDDSSEKDSPVKSHSYNASSNNSSKLFHDPKLRFEDSRNKTIPTDKMKSNNMLGSDRDNNEFMGPPNMYSTLPKKLAPNRPNPIQKSKSISNNGLILGREFDDNQEDEDSDGSITIIELLSDTKDAISRPGIVAVLLNNVNDQPTDLNAMMLYYACKFYRSIDLKKDSDSNACRMANEIITSFLLEKSPMFIDVGLETVEDILKNLKSGENMKNIFDRLLKVLLKLLDIIVERLIKRIQLGILDQTELPKLGKEVNKDMEIGQLHRTVCNILNKHSK------------NVDPSDYIVGKFIGLATIFQYFHKPTFSQGSAMRSRSTDGINTLGNQAKLLPIIDLYKCSMFCSAYTPKIFSSIRKKPKSISGHAVIDAVCLQPEDCGVCESVLWGIAPQGCFCTVCQTFFHMNCKKKIKVQCSRKSRKSIIISGNKEEKPSTTLFGRLSRKSSTVSVKNVNSQSSIEVNSNVGKHIFNNNSLVLDEKT--------------------SHNTYDENTGVSKAKSDDQLHRINSSMEPNNYIVNGSSVNISMENNNAGSFQITSTVQIQELVTDESMEDPDMKVDESFDAGGEINTHFPNLDPNADKKRLIVLLEFYHKTRYILMNLKRFLYKLVNKWPPSQNYYFKALSLDCIQPFVNLIKSLVTAIEGCIKEQDFVDLETAVLNWLSENKDHNLQEWINLSSNLCCTNSLYIVKQLKQTTMRTLPELNSLLNVKMHKMVIVEELTQIRPLLISLPLIVKNIIKCLTKSEPLYTDQLMIWCKVSIKMDYLCEYIDRCCVPLVDWINNGSIGKRIDRSEWYLRPKETECVDQDIISYCTDFPRTLFHFPIFDFQMAKIFSWSRNQRSKLANTDSRINYFKKGAEVLLIFYKTLIVVLQKENDHYILKPIKPFKNVTERIFPIIEKNAFMATNGGQEDDCYILNIINKKQEDASLIRVGFTRKEFVENWLDYFSSDKHDLARSISLYKLNDIKDISNPNMSVENNNFNSNTNIKLKATDSTYSGHSTISTTPSLTDTKMEDSIPDPEPEPEPAPKEKISAPIELIEGLTKASEIFAGTNVHLCKFLNINEDHSDLLEAVKNQGPKSLEEITLMFYSICGPMIDLTRHLIVSGSIQNPENANINKEDLKKTLFHISDQLKNIDFMKYTDKVDFTDESPNSITTNDGKAPEYCPTFCPGEALNGNLSESETNSIEIVQEVKEIINEIVEKSIDQIQQEPAVDKSYKYMPGKSLVSAMRENLERSSFNLTPSYHHLTNPIEETITTTRAQIVLNRSHNNN 1564          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Planmine SMEST
Match: SMESG000022871.1 (SMESG000022871.1)

HSP 1 Score: 2830.82 bits (7337), Expect = 0.000e+0
Identity = 1524/1596 (95.49%), Postives = 1530/1596 (95.86%), Query Frame = 2
Query:  113 MNNKNTKPVNYDKTRLRTNRTKSNSYHQDSDSSAKSPNSTSLTSDERDCVFVRDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDPIPSPNFASFPTRTSQISPPVIKKPRKEIEXXXXXXXXXXXXXXSISDLSSSKNNLSPPTTSQGNTLDRIRRSTESIGKSSDSHSDCSIGTSSTETDLHSHNYNYNKPKSNLRDMPESDTPPPKSKIVASNIPDLVEPNIPPSKQKIPKPFVLPKPNFHGSDYMPHKNTPEQLQLSKLDDSFEKDSPVKXXXXXXXXXXXXKLFHDPKLRFEDSRNKTIPTDKMKSNNMLGSDRDNNEFMGPPNMYSTLPKKLAPNRPNPIQKSKSISNNGLILGREFDDNQEDEDSDGSITIIELLSDTKDAISRPGIVAVLLNNVNDQPTDLNAMMLYYACKFYRSIDLKKDSESNACRMANEIITSFLLEKSPMFVDVGLETVEDILKNLKSGENMKNIFDRXXXXXXXXXDIIVERLKGRIQLGILDQTELPKLGNEVNKDMEIGQLHRTVCNILNKHSKEAKSFRGSSIDTNVDPSDYIVGKFIGLATIFQYFHKPTFSQGSAMRSRSTDGINTLGNQAKLLPIIDLYKCSMFCSAYTPKIFSSIRKKPKSISGHAVIDAVCLQPEDCGVCESVLWGIAPQGCFCTVCQTFFHMNCKKKIKVQCXXXXXXXXXXXGNKEEKPSTTLFGRLXXXXXXXXXXXXXXXXXIEVNSNVGKNIFNNNSLVLDEKTRKFRITYRRRNTILVSIYSQGHNTYDENTGVSKAKSEDQLHRINSSMEPNNYIVNGSSVNISMENNNAGSFQITSTVQIQELVTDESMEDPDMKVDESFDAGGEINTHFPNLDPNADKKRLIVLLEFYHKTRYILMNLKRFLYKLVNKWPLSQNYYFKALSLDCIQPFVNLIKSLVTAIEGCIKEQDFVDLETAVLNWLSENKDHNLQEWINLSSNLCCTNSLYIVKQLKQTTMRTIPELNSLLNVKMHKMVIVEELTQIRPLLISLPLIVKNIIKCLTKSEPLYTDQLMIWCKVSIKMDYLCEYIDRCCVPLVDWINNGSIGKRIDRSEWYLRPKETECVDQDIISYCTDFPRTLFHFPIFDFQMAKIFSWSRNQRSKLANTDSRINYFKKGAEVLLIFYKTLIVVLQKENDHYILKPIKPFKNVTERIFPIIEKNAFMATNGGQEDDCYILNIINKKQEDASLIRVGFTRKEFVENWLDYFSSDKHDLARSISLYKLNDIKDIXXXXXXXXXXXXXXXXXIKLKATDSTYSGHSTISTTPSLTDTKMXXXXXXXXXXXXXXXXXXXSAPVELIEGLTKASEIFAGTNVHLCKFLNINEDHSDLLEAVKNQGPKSLEEITLMFYSICGPMIDLTRHLIVSGSIQNPENANINKEDLKKTLFHISDQLKNIDFMKYTDKVDFTDESPNSITTNDGKAPEYCPTFCPREALNGNLSESETNSXXXXXXXXXXXXXXXXKSIDQIQQEPAVDKSYKYMPGKSLVSAMRENLERSSFNLTPSYHHLTNPIEETITTTRAQIVLNRSHNNN 4900
            MNNKNTKPVNYDKTRLRTNRTKSNSYHQDSDSSAKSPNSTSLTSDERDCVFVRDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDPIPSPNFASFPTRTSQISPPVIKKPRKEIEKPLTKLIKPPLKPLSISDLSSSKNNLSPP TSQGNTLD IRRSTESIGKSSDSHSD SIGTSSTETDLHSHNYNYNKPKSNLRDMPESDTPPPKSKIVASNIPDLVEPNIPPSKQKIPKPFVLPKPNFHGSDYMPHKNTPEQLQLSKLDDS EKDSPVKSHSYNASSNNSSKLFHDPKLRFEDSRNKTIPTDKMKSNNML                       APNRPNPIQKSKSISNNGLILGREFDDNQEDEDSDGSITIIELLSDTKDAISRPGIVAVLLNNVNDQPTDLNAMMLYYACKFYRSIDLKKDS+SNACRMANEIITSFLLEKSPMF+DVGLETVEDILKNLKSGENMKNIFDRLLKVLLKLLDIIVERL  RIQLGILDQTELPKLG EVNKDMEIGQLHRTVCNILNKHSK            NVDPSDYIVGKFIGLATIFQYFHKPTFSQGSAMRSRSTDGINTLGNQAKLLPIIDLYKCSMFCSAYTPKIFSSIRKKPKSISGHAVIDAVCLQPEDCGVCESVLWGIAPQGCFCTVCQTFFHMNCKKKIKVQCSRKSRKSIIISGNKEEKPSTTLFGRLSRKSSTVSVKNVNSQSSIEVNSNVGK+IFNNNSLVLDEKT                     HNTYDENTGVSKAKS+DQLHRINSSMEPNNYIVNGSSVNISMENNNAGSFQITSTVQIQELVTDESMEDPDMKVDESFDAGGEINTHFPNLDPNADKKRLIVLLEFYHKTRYILMNLKRFLYKLVNKWP SQNYYFKALSLDCIQPFVNLIKSLVTAIEGCIKEQDFVDLETAVLNWLSENKDHNLQEWINLSSNLCCTNSLYIVKQLKQTTMRT+PELNSLLNVKMHKMVIVEELTQIRPLLISLPLIVKNIIKCLTKSEPLYTDQLMIWCKVSIKMDYLCEYIDRCCVPLVDWINNGSIGKRIDRSEWYLRPKETECVDQDIISYCTDFPRTLFHFPIFDFQMAKIFSWSRNQRSKLANTDSRINYFKKGAEVLLIFYKTLIVVLQKENDHYILKPIKPFKNVTERIFPIIEKNAFMATNGGQEDDCYILNIINKKQEDASLIRVGFTRKEFVENWLDYFSSDKHDLARSISLYKLNDIKDISNPNMSVENNNFNSNTNIKLKATDSTYSGHSTISTTPSLTDTKMEDSIPDPEPEPEPA KEKISAP+ELIEGLTKASEIFAGTNVHLCKFLNINEDHSDLLEAVKNQGPKSLEEITLMFYSICGPMIDLTRHLIVSGSIQNPENANINKEDLKKTLFHISDQLKNIDFMKYTDKVDFTDESPNSITTNDGKAPEYCPTFCP EALNGNLSESETNSIEIVQEVKEIINEIVEKSIDQIQQEPAVDKSYKYMPGKSLVSAMRENLERSSFNLTPSYHHLTNPIEETITTTRAQIVLNRSHNNN
Sbjct:    1 MNNKNTKPVNYDKTRLRTNRTKSNSYHQDSDSSAKSPNSTSLTSDERDCVFVRDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDPIPSPNFASFPTRTSQISPPVIKKPRKEIEKPLTKLIKPPLKPLSISDLSSSKNNLSPPKTSQGNTLDCIRRSTESIGKSSDSHSDYSIGTSSTETDLHSHNYNYNKPKSNLRDMPESDTPPPKSKIVASNIPDLVEPNIPPSKQKIPKPFVLPKPNFHGSDYMPHKNTPEQLQLSKLDDSSEKDSPVKSHSYNASSNNSSKLFHDPKLRFEDSRNKTIPTDKMKSNNML-----------------------APNRPNPIQKSKSISNNGLILGREFDDNQEDEDSDGSITIIELLSDTKDAISRPGIVAVLLNNVNDQPTDLNAMMLYYACKFYRSIDLKKDSDSNACRMANEIITSFLLEKSPMFIDVGLETVEDILKNLKSGENMKNIFDRLLKVLLKLLDIIVERLIKRIQLGILDQTELPKLGKEVNKDMEIGQLHRTVCNILNKHSK------------NVDPSDYIVGKFIGLATIFQYFHKPTFSQGSAMRSRSTDGINTLGNQAKLLPIIDLYKCSMFCSAYTPKIFSSIRKKPKSISGHAVIDAVCLQPEDCGVCESVLWGIAPQGCFCTVCQTFFHMNCKKKIKVQCSRKSRKSIIISGNKEEKPSTTLFGRLSRKSSTVSVKNVNSQSSIEVNSNVGKHIFNNNSLVLDEKT--------------------SHNTYDENTGVSKAKSDDQLHRINSSMEPNNYIVNGSSVNISMENNNAGSFQITSTVQIQELVTDESMEDPDMKVDESFDAGGEINTHFPNLDPNADKKRLIVLLEFYHKTRYILMNLKRFLYKLVNKWPPSQNYYFKALSLDCIQPFVNLIKSLVTAIEGCIKEQDFVDLETAVLNWLSENKDHNLQEWINLSSNLCCTNSLYIVKQLKQTTMRTLPELNSLLNVKMHKMVIVEELTQIRPLLISLPLIVKNIIKCLTKSEPLYTDQLMIWCKVSIKMDYLCEYIDRCCVPLVDWINNGSIGKRIDRSEWYLRPKETECVDQDIISYCTDFPRTLFHFPIFDFQMAKIFSWSRNQRSKLANTDSRINYFKKGAEVLLIFYKTLIVVLQKENDHYILKPIKPFKNVTERIFPIIEKNAFMATNGGQEDDCYILNIINKKQEDASLIRVGFTRKEFVENWLDYFSSDKHDLARSISLYKLNDIKDISNPNMSVENNNFNSNTNIKLKATDSTYSGHSTISTTPSLTDTKMEDSIPDPEPEPEPAPKEKISAPIELIEGLTKASEIFAGTNVHLCKFLNINEDHSDLLEAVKNQGPKSLEEITLMFYSICGPMIDLTRHLIVSGSIQNPENANINKEDLKKTLFHISDQLKNIDFMKYTDKVDFTDESPNSITTNDGKAPEYCPTFCPGEALNGNLSESETNSIEIVQEVKEIINEIVEKSIDQIQQEPAVDKSYKYMPGKSLVSAMRENLERSSFNLTPSYHHLTNPIEETITTTRAQIVLNRSHNNN 1541          
BLAST of Rho guanine nucleotide exchange factor 12 vs. Planmine SMEST
Match: SMESG000056465.1 (SMESG000056465.1)

HSP 1 Score: 255.758 bits (652), Expect = 3.430e-68
Identity = 151/415 (36.39%), Postives = 230/415 (55.42%), Query Frame = 2
Query: 2699 TSTVQIQELVTDESM--EDPDMKVDESFDAGGEIN---THFPNLDPNADKKRLIVLLEFYHKTRYILMNLKRFLYKLVNKWPLSQNYYFKALSLDCIQPFVNLIKSLVTAIEGCIKEQDF-VDLETAVLNWLSENKDHNLQEWINLSSNLCCTNSLYIVKQLKQTTMRTIPELNSLLNVKMHKMVIVEELTQIRPLLISLPLIVKNIIKCLTKSEPLYTDQLMIWCKVSIKMDYLCEYIDRCCVPLVDWINNGSIGKRIDRSEWYLRPKETECVDQDIISYCTDFPRTLFHFPIFDFQMAKIFSWSRNQRSKLANTDSRINYFKKGAEVLLIFYKTLIVVLQKENDHYILKPIKPFKNVTERIFPIIEKNAFMATNGGQEDDCYILNIINKKQEDASLIRVGFTRKEFVENWLDY 3925
            + +V IQEL+ ++S    DPDM+V E+F+A  E+     H    D   +  RL+VL+EF+HKT++ +M LKRF Y L+  WP  +   F  LSL+CIQP   LIK L + IE C  E  +  D    VL+WL  N + NLQ+W+  S +LCCTNSL +VK       R I     +L+ + +KM++VE+L+ +RPLL + PLIV  + + L+K    + ++   W  V  K   L  +ID  C+PLV  INNG+I   +DR+ W  R    +       ++  DFP+T FH+ +FDFQ  KI  +S + R   A       + K+  + + I Y+ ++V+LQKEND Y+LK  K  ++   +  PI+  +    + G ++   Y L I+      A L ++ F +KE +E W D+
Sbjct: 1041 SESVHIQELIQEKSAWSNDPDMEVGETFEADKELKYFPQHLSKEDDKGEYTRLLVLMEFHHKTKFTVMTLKRFDYLLIKSWPSDETLLFSTLSLNCIQPLYGLIKMLASTIESCRTESTYNADTARKVLDWLIGNDERNLQDWLKYSIDLCCTNSLSLVKN-SWKDARKIDGRLKILDKRYNKMLMVEQLSNMRPLLFNFPLIVNKLFRDLSKFSK-FKEESKTWKSVFEKFKLLPTFIDEHCMPLVQLINNGTIINSVDRNIWMQRITSND----PHYNFILDFPKTAFHYKLFDFQEIKITKFSESNRKVPA------VFVKETIDAIAICYENMLVLLQKENDKYLLKQFKSPESA--KCTPILTVDNVHTSKGEKKGTFYELTIVFINV--AVLTQLLFPKKEVMEKWYDF 1439          

HSP 2 Score: 108.997 bits (271), Expect = 2.487e-23
Identity = 105/381 (27.56%), Postives = 179/381 (46.98%), Query Frame = 2
Query: 1226 TLPKKLAPNRPNPIQKSKSISNN----GLILGREFDDNQEDED---SDGSITIIELLSDTKDAISR-PGIVAVLLNNVNDQPTDLNAMMLYYACKFYRSIDLKKDSESNACRMANEIITSFLLEKSPMFVD-VGLETVEDILKNLKSGENMKNIFDRXXXXX--XXXXDIIVERLKGRIQLGILD----------QTELPKLGNEVN---KDMEIGQLHRTVCNILNKHSKEAKSFRGSSIDTNVDPSDYIVGKFIGLATIFQYFHKPTFSQGSAMRSRSTDGINTL-GNQAKLLPIID---LYKCSMFCSAYTPKIFS-SIRKKPKSISGHAVIDAVCLQPEDCGVCESVLWGIAPQGCFCTVCQTFFHMNCKKKIKVQC 2281
            T PK ++ +  N    SK I NN      + GR FD + +D +   ++  +T +E L    D + + P ++  LL  +     D  +++ Y+  + Y+S+   K+    A R  NEI T+FL EKS + +D   +++V  ++ +LK+ +++  +FD  + ++    + + IV ++K  I  G+              ++    N +    K++E    H +  N   K +KE + F+          +D I G    LAT++ YF K      S   S  +   N+L G   + LP++    L K  MFCS    +  S S  KK K + GH   + +   P  C +C+ +LWGIAPQG FC+ CQ   H  CK  +++ C
Sbjct:  474 TSPKIVSVSHNN---NSKPIQNNVCSVQRLQGRNFDSDDDDYEIYPNETVVTKMEKLYTYIDKVMKNPALIGELLRYLFTHNIDYYSLLYYFIVQHYKSMMQNKEFAKEATRFINEIYTTFLHEKSVLRIDHYNVKSV--LMDDLKNIKDLSTVFDESINIVFNNSITNAIV-KIKTSIAHGLFSVELNIENYSFDEKMSHFNNIIRYLIKNLEDKFPHESNQNA-TKETKEQEQFQ----------TDVISGVKSALATLYYYFSKKERDDNSDNVSMVSTKFNSLIGKSMENLPVMTNCILDKQPMFCSKIHKRPSSHSFFKKGKVLKGHNFQEKIFDYPATCLLCDKLLWGIAPQGFFCSHCQGASHKGCKDFVRITC 837          

HSP 3 Score: 60.8474 bits (146), Expect = 1.128e-8
Identity = 30/85 (35.29%), Postives = 46/85 (54.12%), Query Frame = 2
Query:  257 CVFVRDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIHKQHSDVVSLIRKQTKVELFVKNGDPIPSPNFAS 511
            C F +     GF + G++PV+V AV+     WKSGL+  DII +VNG  V +     +  LI+  + V ++V+    I + N AS
Sbjct:  241 CQFSKSESKIGFSLIGSSPVRVDAVKYGSLGWKSGLQTGDIIRRVNGFDVRNCSQMLIAKLIKNNSDVNIYVQREKIIRNKNLAS 325          
The following BLAST results are available for this feature:
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARHGEF121.582e-1139.39Rho guanine nucleotide exchange factor 12 [Source:... [more]
ARHGEF121.613e-1139.39Rho guanine nucleotide exchange factor 12 [Source:... [more]
ARHGEF114.090e-1139.05Rho guanine nucleotide exchange factor 11 [Source:... [more]
ARHGEF114.205e-1139.05Rho guanine nucleotide exchange factor 11 [Source:... [more]
SHANK21.964e-627.40SH3 and multiple ankyrin repeat domains 2 [Source:... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rhgf-12.934e-733.04RHo Guanine nucleotide exchange Factor [Source:Un... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RhoGEF24.710e-1238.60gene:FBgn0023172 transcript:FBtr0340124[more]
RhoGEF24.793e-1238.60gene:FBgn0023172 transcript:FBtr0086969[more]
RhoGEF26.743e-1238.60gene:FBgn0023172 transcript:FBtr0086971[more]
RhoGEF26.743e-1238.60gene:FBgn0023172 transcript:FBtr0086970[more]
RhoGEF27.152e-1238.60gene:FBgn0023172 transcript:FBtr0305083[more]
back to top
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arhgef111.775e-1041.11Rho guanine nucleotide exchange factor (GEF) 11 [S... [more]
arhgef12b6.218e-1041.10Rho guanine nucleotide exchange factor (GEF) 12b [... [more]
arhgef12b7.002e-1041.10Rho guanine nucleotide exchange factor (GEF) 12b [... [more]
arhgef12a5.162e-936.05Rho guanine nucleotide exchange factor (GEF) 12a [... [more]
arhgef12a7.845e-939.73Rho guanine nucleotide exchange factor (GEF) 12a [... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARHGEF112.273e-1142.05Rho guanine nucleotide exchange factor 11 [Source:... [more]
ARHGEF112.313e-1139.81Rho guanine nucleotide exchange factor 11 [Source:... [more]
ARHGEF112.563e-1139.81Rho guanine nucleotide exchange factor 11 [Source:... [more]
rai23.138e-1135.20retinoic acid induced 2 [Source:Xenbase;Acc:XB-GEN... [more]
rai25.001e-1136.00retinoic acid induced 2 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arhgef112.150e-1235.85Rho guanine nucleotide exchange factor (GEF) 11 [S... [more]
Arhgef121.717e-1139.80Rho guanine nucleotide exchange factor (GEF) 12 [S... [more]
Arhgef121.761e-1139.80Rho guanine nucleotide exchange factor (GEF) 12 [S... [more]
Arhgef113.996e-1135.85Rho guanine nucleotide exchange factor (GEF) 11 [S... [more]
Arhgef114.153e-1135.85Rho guanine nucleotide exchange factor (GEF) 11 [S... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 12 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q9NZN5|ARHGC_HUMAN7.747e-1139.39Rho guanine nucleotide exchange factor 12 OS=Homo ... [more]
sp|Q8R4H2|ARHGC_MOUSE1.232e-1039.80Rho guanine nucleotide exchange factor 12 OS=Mus m... [more]
sp|O15085|ARHGB_HUMAN2.019e-1039.05Rho guanine nucleotide exchange factor 11 OS=Homo ... [more]
sp|Q9ES67|ARHGB_RAT9.222e-1034.58Rho guanine nucleotide exchange factor 11 OS=Rattu... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 12 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A158R8I93.886e-5632.79PDZ domain-containing protein OS=Taenia asiatica O... [more]
A0A3P6S0S23.583e-5427.60RGS-like domain-containing protein OS=Dibothriocep... [more]
A0A5K3F1401.071e-5231.62Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3EYF41.303e-5231.62Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3EZ071.383e-5231.62Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arhgef111.109e-1038.46Rho guanine nucleotide exchange factor (GEF) 11 [S... [more]
arhgef12a2.056e-941.10Rho guanine nucleotide exchange factor (GEF) 12a [... [more]
arhgef12a2.066e-941.10Rho guanine nucleotide exchange factor (GEF) 12a [... [more]
shank3b1.369e-730.77SH3 and multiple ankyrin repeat domains protein 3-... [more]
shank3b1.369e-730.77SH3 and multiple ankyrin repeat domains protein 3-... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ARHGEF116.917e-1142.25Rho guanine nucleotide exchange factor 11 [Source:... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO483721.892e-641.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO425392.906e-629.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361407.783e-638.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 12 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000040351.13.143e-1042.47rho guanine nucleotide exchange factor 12-like [So... [more]
arhgef12a7.335e-1041.10Rho guanine nucleotide exchange factor 12 [Source:... [more]
arhgef12a7.550e-1041.10Rho guanine nucleotide exchange factor 12 [Source:... [more]
ENSORLT00000009961.21.992e-627.83SH3 and multiple ankyrin repeat domains protein 1-... [more]
shank17.100e-624.86SH3 and multiple ankyrin repeat domains protein 1 ... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 12 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022871.10.000e+098.25SMESG000022871.1[more]
SMESG000022871.10.000e+097.68SMESG000022871.1[more]
SMESG000022871.10.000e+096.93SMESG000022871.1[more]
SMESG000022871.10.000e+095.49SMESG000022871.1[more]
SMESG000056465.13.430e-6836.39SMESG000056465.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022776 ID=SMED30022776|Name=Rho guanine nucleotide exchange factor 12|organism=Schmidtea mediterranea sexual|type=transcript|length=5052bp
AATATTCAAATTTAAATATTAATAGTTTAGATGATATTCAACTTCTAATT
AGAAAATATACTGATTTGTATGTTGTAAATTAATTTACGCCTTTATTTCT
AAGAATAGTTTGATGAATAATAAAAATACAAAACCGGTAAATTATGACAA
AACAAGGCTCCGTACTAATCGAACTAAGTCGAATTCATATCACCAAGACA
GCGATTCGAGTGCTAAATCACCGAATTCTACAAGTTTGACTTCGGATGAG
AGGGATTGCGTTTTCGTTAGAGATTCGTATGGATACGGATTTAAAATCAC
CGGAAATGCTCCGGTTAAGGTTCAAGCAGTCAGAATTAACGGGTCTGCAT
GGAAATCAGGTCTTCGAGAAAACGACATAATATTAAAAGTAAATGGGGAA
AGCGTAATCCACAAACAGCATAGTGATGTCGTTTCACTTATTAGAAAGCA
GACTAAGGTAGAGTTGTTTGTCAAAAACGGTGATCCTATTCCTTCACCCA
ATTTTGCATCTTTTCCTACCAGAACAAGTCAAATATCTCCTCCTGTAATA
AAAAAACCACGCAAAGAAATAGAAAAGCCTTTAACGAAGCTAATAAAACC
TCCACTTAAACCTCTATCTATCTCAGATTTATCCAGTTCAAAGAACAACT
TAAGTCCACCGACAACTTCTCAAGGCAACACTCTCGACCGTATTCGAAGA
TCAACTGAATCAATTGGGAAATCGTCTGATTCTCACTCTGATTGCTCTAT
TGGTACATCTAGCACAGAAACGGATCTGCATTCTCATAATTATAATTATA
ACAAACCTAAGTCCAATTTACGAGATATGCCCGAATCGGATACTCCTCCA
CCAAAGTCGAAAATTGTAGCATCTAACATACCAGATCTAGTTGAACCAAA
TATTCCTCCATCAAAACAGAAAATTCCTAAACCTTTTGTACTTCCAAAAC
CAAACTTCCATGGATCAGATTATATGCCACACAAAAATACTCCTGAACAA
CTGCAATTAAGTAAACTAGATGATTCTTTTGAAAAAGATTCTCCTGTTAA
ATCTCATTCATATAACGCTTCATCGAACAATTCCTCAAAGTTATTTCACG
ATCCTAAATTGAGGTTTGAAGATTCAAGAAATAAAACAATTCCTACTGAT
AAAATGAAATCAAATAATATGCTCGGTAGTGATCGTGATAATAATGAATT
CATGGGTCCTCCCAACATGTACAGTACTCTTCCTAAAAAGTTGGCCCCTA
ATAGACCTAATCCTATTCAAAAATCCAAAAGCATTTCAAATAACGGTCTC
ATTTTGGGGCGGGAATTCGACGACAACCAAGAAGATGAGGACTCCGACGG
CTCAATAACTATAATAGAGTTATTGTCAGACACCAAGGATGCCATTTCGA
GACCCGGAATAGTTGCGGTCCTCCTTAATAATGTAAATGATCAGCCAACT
GACCTCAATGCCATGATGCTATATTATGCCTGCAAATTCTACAGATCTAT
CGATTTGAAAAAGGATTCTGAAAGTAACGCTTGTAGAATGGCAAATGAGA
TAATTACATCATTTTTATTAGAAAAATCTCCAATGTTTGTTGATGTTGGA
TTAGAAACTGTTGAAGATATCCTTAAAAATCTAAAATCTGGAGAAAACAT
GAAAAACATTTTTGATAGACTGCTGAAAGTTTTACTGAAACTATTAGACA
TTATTGTAGAAAGATTGAAAGGAAGAATTCAGCTAGGTATACTTGATCAA
ACAGAACTTCCTAAACTTGGTAATGAAGTTAATAAAGATATGGAAATCGG
TCAACTACATAGAACTGTGTGCAATATTTTAAACAAACATTCTAAGGAGG
CAAAATCTTTCAGAGGATCCTCAATTGATACGAATGTTGATCCATCGGAT
TACATAGTTGGGAAATTTATTGGTCTCGCTACTATTTTCCAATATTTTCA
CAAACCTACATTTTCCCAAGGAAGTGCGATGAGGAGCAGATCCACAGATG
GTATTAATACACTAGGAAATCAAGCGAAATTATTGCCCATTATTGATTTG
TATAAGTGCAGCATGTTTTGCAGTGCTTATACACCAAAAATATTTTCAAG
TATTAGAAAGAAACCGAAATCTATTAGTGGTCATGCCGTTATCGATGCTG
TTTGTCTTCAGCCAGAGGACTGCGGAGTTTGTGAGAGTGTCTTGTGGGGC
ATAGCGCCACAAGGATGCTTTTGTACAGTTTGTCAAACCTTTTTCCACAT
GAACTGTAAAAAGAAAATAAAAGTTCAGTGTTCTCGTAAATCACGCAAGT
CCATTATAATATCTGGAAACAAAGAAGAAAAGCCCTCGACAACACTTTTT
GGACGGTTGAGTCGAAAGTCAAGCACTGTGTCAGTAAAAAATGTTAATTC
TCAATCTTCTATTGAAGTCAATTCGAATGTTGGAAAAAATATTTTCAATA
ACAATTCTTTGGTTCTCGATGAAAAAACAAGAAAATTCCGGATTACGTAT
CGTCGTAGGAATACGATCCTGGTTTCGATTTACAGTCAAGGTCACAATAC
ATATGATGAAAATACAGGAGTGTCTAAGGCTAAGAGTGAAGATCAATTAC
ATCGTATTAATAGCAGTATGGAACCAAATAACTATATTGTCAACGGGTCG
TCTGTAAATATTTCAATGGAAAATAACAATGCAGGAAGTTTTCAAATTAC
AAGTACCGTTCAAATTCAAGAATTGGTAACAGATGAAAGCATGGAAGATC
CAGACATGAAAGTCGATGAAAGTTTTGATGCAGGCGGTGAAATTAATACT
CACTTCCCAAACCTTGATCCAAATGCCGACAAAAAGCGGTTAATTGTGCT
TCTTGAATTTTATCACAAAACCAGATATATTCTAATGAACCTTAAAAGGT
TTTTATACAAACTCGTAAATAAGTGGCCTCTGAGTCAAAATTATTATTTT
AAAGCATTATCATTGGATTGTATTCAACCTTTTGTAAATTTAATAAAATC
ACTTGTTACCGCCATTGAAGGTTGCATTAAAGAACAAGATTTCGTCGATT
TGGAAACAGCCGTTTTAAATTGGTTGTCAGAGAATAAAGATCACAATTTG
CAAGAATGGATCAACTTGAGTAGTAATCTCTGTTGCACAAACAGTTTGTA
TATTGTCAAACAATTGAAACAGACAACAATGCGTACCATACCAGAATTGA
ACAGTCTTTTGAATGTGAAAATGCATAAAATGGTTATTGTAGAAGAATTG
ACTCAAATTCGGCCTCTGCTTATCAGTCTACCTCTTATTGTGAAAAATAT
TATAAAGTGTCTTACAAAATCCGAACCATTATATACAGATCAATTAATGA
TTTGGTGTAAAGTATCGATCAAAATGGATTACCTCTGTGAATATATTGAT
CGTTGTTGTGTGCCTTTAGTTGATTGGATAAATAATGGATCAATTGGGAA
ACGGATCGATCGCTCGGAATGGTATTTAAGGCCCAAAGAAACCGAATGTG
TTGATCAAGATATTATAAGCTACTGTACTGATTTTCCGAGAACTCTTTTT
CATTTCCCTATTTTCGATTTTCAAATGGCGAAAATATTTTCGTGGTCTAG
GAATCAAAGATCCAAGTTAGCAAATACTGATTCTCGAATTAATTATTTCA
AAAAAGGAGCCGAGGTTCTATTGATATTTTACAAAACGCTCATAGTTGTT
CTACAAAAGGAAAATGATCATTACATTTTGAAACCAATAAAGCCTTTTAA
AAATGTTACGGAACGTATATTTCCAATTATTGAAAAAAATGCATTTATGG
CCACGAATGGTGGTCAAGAAGATGATTGTTATATTTTAAATATCATAAAC
AAAAAACAAGAAGACGCATCTCTAATAAGAGTTGGATTTACACGCAAAGA
ATTTGTTGAAAATTGGCTGGATTACTTTAGTAGTGACAAACATGATTTGG
CTAGGTCAATATCTCTCTATAAACTTAATGATATCAAAGATATATCTAAT
CCAAACATGTCAGTAGAAAATAACAATTTCAATAGCAATACTAATATCAA
GTTGAAAGCGACCGATTCGACTTATAGTGGCCATTCAACCATATCAACCA
CACCATCTTTAACGGATACCAAAATGGAAGACAGCATACCAGATCCTGAA
CCGGAACCGGAACCAGCATCCAAAGAGAAAATAAGTGCACCTGTCGAACT
AATAGAAGGATTGACAAAAGCCAGTGAAATCTTTGCCGGTACGAACGTTC
ATTTATGTAAATTTCTGAACATCAACGAGGATCACTCTGATTTGTTAGAA
GCTGTTAAAAATCAGGGTCCCAAATCATTGGAAGAAATAACTTTGATGTT
TTATTCCATTTGTGGCCCAATGATAGATCTCACTCGCCATTTGATCGTCT
CTGGATCAATTCAAAACCCTGAAAACGCGAATATCAACAAAGAAGATTTG
AAAAAAACCCTCTTTCACATATCGGACCAATTAAAGAATATCGACTTCAT
GAAATATACCGACAAAGTAGATTTCACTGATGAAAGTCCAAATAGCATTA
CGACAAATGATGGGAAAGCGCCAGAATATTGCCCCACATTTTGTCCCAGA
GAAGCACTGAACGGAAATCTGTCTGAATCCGAAACGAACTCGATTGAAAT
CGTTCAAGAAGTCAAAGAGATAATCAATGAAATTGTAGAAAAGTCAATTG
ATCAAATCCAACAAGAGCCAGCTGTTGATAAATCGTACAAATATATGCCG
GGAAAATCTCTTGTTTCTGCTATGAGAGAGAATTTAGAGCGCTCTTCCTT
CAACCTGACTCCGAGTTATCATCATTTGACCAACCCGATTGAAGAAACAA
TTACGACAACTCGCGCACAAATCGTGTTGAATAGATCCCACAATAACAAT
TAGTAATTCCTCTCAGGAACTGAATGAGATCAGATTGTAATAATCAGACG
GAAAATGCAATAGAGATTTCATTTCATGTCTTTTTGATGGTTTGTTGAAG
ATTTCTTATCATTTTTACGTTTGTTGCTACTCGAGATGTGATTGGTGAAA
AC
back to top

protein sequence of SMED30022776-orf-1

>SMED30022776-orf-1 ID=SMED30022776-orf-1|Name=SMED30022776-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1597bp
MNNKNTKPVNYDKTRLRTNRTKSNSYHQDSDSSAKSPNSTSLTSDERDCV
FVRDSYGYGFKITGNAPVKVQAVRINGSAWKSGLRENDIILKVNGESVIH
KQHSDVVSLIRKQTKVELFVKNGDPIPSPNFASFPTRTSQISPPVIKKPR
KEIEKPLTKLIKPPLKPLSISDLSSSKNNLSPPTTSQGNTLDRIRRSTES
IGKSSDSHSDCSIGTSSTETDLHSHNYNYNKPKSNLRDMPESDTPPPKSK
IVASNIPDLVEPNIPPSKQKIPKPFVLPKPNFHGSDYMPHKNTPEQLQLS
KLDDSFEKDSPVKSHSYNASSNNSSKLFHDPKLRFEDSRNKTIPTDKMKS
NNMLGSDRDNNEFMGPPNMYSTLPKKLAPNRPNPIQKSKSISNNGLILGR
EFDDNQEDEDSDGSITIIELLSDTKDAISRPGIVAVLLNNVNDQPTDLNA
MMLYYACKFYRSIDLKKDSESNACRMANEIITSFLLEKSPMFVDVGLETV
EDILKNLKSGENMKNIFDRLLKVLLKLLDIIVERLKGRIQLGILDQTELP
KLGNEVNKDMEIGQLHRTVCNILNKHSKEAKSFRGSSIDTNVDPSDYIVG
KFIGLATIFQYFHKPTFSQGSAMRSRSTDGINTLGNQAKLLPIIDLYKCS
MFCSAYTPKIFSSIRKKPKSISGHAVIDAVCLQPEDCGVCESVLWGIAPQ
GCFCTVCQTFFHMNCKKKIKVQCSRKSRKSIIISGNKEEKPSTTLFGRLS
RKSSTVSVKNVNSQSSIEVNSNVGKNIFNNNSLVLDEKTRKFRITYRRRN
TILVSIYSQGHNTYDENTGVSKAKSEDQLHRINSSMEPNNYIVNGSSVNI
SMENNNAGSFQITSTVQIQELVTDESMEDPDMKVDESFDAGGEINTHFPN
LDPNADKKRLIVLLEFYHKTRYILMNLKRFLYKLVNKWPLSQNYYFKALS
LDCIQPFVNLIKSLVTAIEGCIKEQDFVDLETAVLNWLSENKDHNLQEWI
NLSSNLCCTNSLYIVKQLKQTTMRTIPELNSLLNVKMHKMVIVEELTQIR
PLLISLPLIVKNIIKCLTKSEPLYTDQLMIWCKVSIKMDYLCEYIDRCCV
PLVDWINNGSIGKRIDRSEWYLRPKETECVDQDIISYCTDFPRTLFHFPI
FDFQMAKIFSWSRNQRSKLANTDSRINYFKKGAEVLLIFYKTLIVVLQKE
NDHYILKPIKPFKNVTERIFPIIEKNAFMATNGGQEDDCYILNIINKKQE
DASLIRVGFTRKEFVENWLDYFSSDKHDLARSISLYKLNDIKDISNPNMS
VENNNFNSNTNIKLKATDSTYSGHSTISTTPSLTDTKMEDSIPDPEPEPE
PASKEKISAPVELIEGLTKASEIFAGTNVHLCKFLNINEDHSDLLEAVKN
QGPKSLEEITLMFYSICGPMIDLTRHLIVSGSIQNPENANINKEDLKKTL
FHISDQLKNIDFMKYTDKVDFTDESPNSITTNDGKAPEYCPTFCPREALN
GNLSESETNSIEIVQEVKEIINEIVEKSIDQIQQEPAVDKSYKYMPGKSL
VSAMRENLERSSFNLTPSYHHLTNPIEETITTTRAQIVLNRSHNNN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0003104enteric muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036034PDZ_sf
IPR041489PDZ_6
IPR036305RGS_sf
IPR001478PDZ
IPR002219PE/DAG-bd
IPR016137RGS
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005089Rho guanyl-nucleotide exchange factor activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0035556intracellular signal transduction
GO:0007186G-protein coupled receptor signaling pathway
GO:0007266Rho protein signal transduction
GO:0043547positive regulation of GTPase activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001478PDZ domainSMARTSM00228pdz_newcoord: 56..124
e-value: 2.6E-13
score: 60.2
IPR001478PDZ domainPROSITEPS50106PDZcoord: 48..112
score: 11.3
NoneNo IPR availableGENE3DG3DSA:1.20.58.1850coord: 421..593
e-value: 1.0E-7
score: 33.7
NoneNo IPR availableGENE3DG3DSA:3.30.60.20coord: 661..734
e-value: 3.1E-9
score: 38.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 10..24
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 301..343
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 329..343
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 312..328
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1323..1337
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..44
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1339..1354
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 25..44
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1323..1354
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 172..226
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 135..159
NoneNo IPR availablePANTHERPTHR45872FAMILY NOT NAMEDcoord: 46..775
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 46..121
e-value: 1.25293E-15
score: 71.4438
NoneNo IPR availableSUPERFAMILYSSF57889Cysteine-rich domaincoord: 670..726
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 24..123
e-value: 1.0E-19
score: 72.5
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 37..127
IPR041489PDZ domain 6PFAMPF17820PDZ_6coord: 70..117
e-value: 2.2E-9
score: 37.0
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainPROSITEPS00479ZF_DAG_PE_1coord: 674..723
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainPROSITEPS50081ZF_DAG_PE_2coord: 673..723
score: 10.939
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainCDDcd00029C1coord: 687..723
e-value: 9.45164E-7
score: 45.1756
IPR036305RGS domain superfamilySUPERFAMILYSSF48097Regulator of G-protein signaling, RGScoord: 449..528