Glycine receptor subunit alpha-3

Overview
NameGlycine receptor subunit alpha-3
Smed IDSMED30022769
Length (bp)1835
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glycine receptor subunit alpha-3 (SMED30022769) t-SNE clustered cells

Violin plots show distribution of expression levels for Glycine receptor subunit alpha-3 (SMED30022769) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glycine receptor subunit alpha-3 (SMED30022769) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glycine receptor subunit alpha-3 (SMED30022769) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022769

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30022769SMESG000061905.1 SmedASXL_000914SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30022769SMESG000061905.1 dd_Smed_v4_8110_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30022769SMESG000061905.1 dd_Smed_v4_8110_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30022769SMESG000061905.1 dd_Smed_v4_8110_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30022769SMESG000061905.1 dd_Smed_v6_8110_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30022769SMESG000040616.1 SMESG000061905.1 OX_Smed_1.0.10144ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Category 3 cellSMED30022769SMESG000061905.1 dd_Smed_v6_8110_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30022769SMESG000061905.1 dd_Smed_v4_8110_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Human
Match: GLRA3 (glycine receptor alpha 3 [Source:HGNC Symbol;Acc:HGNC:4328])

HSP 1 Score: 201.83 bits (512), Expect = 1.108e-57
Identity = 135/385 (35.06%), Postives = 217/385 (56.36%), Query Frame = 3
Query:  507 AINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS-SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIAR--------RRKSEDWQKQVREIVRQELARWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEILLCPDTXXXXXXXXXXXXNRSKPQKSVDSEIDCYSRFLFPACFVLYNCFYW 1634
            +  S+    M+Y  ++ LRQ+W D RL +  +P     + S+   P++ + +W PDLFF N K    H +T  N L+R+  NG +LYS ++T+  SC M+L  FPMD Q CIM + S+GYT++ L F W+++ P+ +A  + +P+F    +     C+K    +TG +TC++  FHL RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + ++R        RRK ++   +VRE      A     C             +      TP G     + + P +     +     ++R+K       +ID  SR  FP  F+++N FYW
Sbjct:   80 SFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGLTLPQFLLKEEKDLRYCTKH--YNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRKNKDDEVRESRFSFTAYGMGPC-------------LQAKDGMTPKGPNH-PVQVMPKS---PDEMRKVFIDRAK-------KIDTISRACFPLAFLIFNIFYW 433          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Human
Match: GLRA1 (glycine receptor alpha 1 [Source:HGNC Symbol;Acc:HGNC:4326])

HSP 1 Score: 199.134 bits (505), Expect = 1.207e-56
Identity = 134/390 (34.36%), Postives = 216/390 (55.38%), Query Frame = 3
Query:  507 AINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS-SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKS------------EDWQKQVR-EIVRQELARWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEILLCPDTXXXXXXXXXXXXNRSKPQKSVDSEIDCYSRFLFPACFVLYNCFYW 1634
            +  S+    M+Y  ++ LRQ+W D RL ++ +P     + S+   P++ + +W PDLFF N K  + H +T  N L+R++ NG +LYS +IT+  +C M+L  FPMD Q CIM + S+GYT++ L F W+E+  + +A  + +P+F    +     C+K    +TG +TC++A FHL RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + ++R+ K             ED   + R       +   C   +    V+  N+S             E++  L                  R+K       +ID  SR  FP  F+++N FYW
Sbjct:   75 SFGSIAETTMDYRVNIFLRQQWNDPRLAYNEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEEKDLRYCTKH--YNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWISFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRRHHKEDEAGEGRFNFSAYGMGPACLQAKDGISVKGANNSNTTNPPPAPSKSPEEMRKLFI---------------QRAK-------KIDKISRIGFPMAFLIFNMFYW 435          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Human
Match: GLRA2 (glycine receptor alpha 2 [Source:HGNC Symbol;Acc:HGNC:4327])

HSP 1 Score: 195.667 bits (496), Expect = 3.377e-56
Identity = 128/375 (34.13%), Postives = 210/375 (56.00%), Query Frame = 3
Query:  534 MEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS-SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKS-------EDWQKQVREIVRQELARWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEILLCPDTXXXXXXXXXXXXNRSKPQKSVDSEIDCYSRFLFPACFVLYNCFYW 1634
            M+Y  ++ LRQ+W D RL +  +P     + S+   P++ + +W PDLFF N K    H +T  N L+R++ NG +LYS ++T+  SC M+L  FPMD Q C M + S+GYT++ L F W    P+ +A  + +P+F    +     C+K    +TG +TC++  FHL RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + ++R+ K        +  Q +  ++ R+    +        L     +++        P   +D + +              + V+R+K        ID  SR  FP  F+++N FYW
Sbjct:    1 MDYRVNIFLRQQWNDSRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELGYCTKH--YNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFLRLRRRQKRQNKEEDVTRESRFNFSGYGMGHCLQVKDGTAVKATPANPLPQPPKDGDAI------------KKKFVDRAK-------RIDTISRAAFPLAFLIFNIFYW 349          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Human
Match: GLRA1 (glycine receptor alpha 1 [Source:HGNC Symbol;Acc:HGNC:4326])

HSP 1 Score: 197.593 bits (501), Expect = 5.237e-56
Identity = 112/273 (41.03%), Postives = 182/273 (66.67%), Query Frame = 3
Query:  507 AINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS-SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRK 1322
            +  S+    M+Y  ++ LRQ+W D RL ++ +P     + S+   P++ + +W PDLFF N K  + H +T  N L+R++ NG +LYS +IT+  +C M+L  FPMD Q CIM + S+GYT++ L F W+E+  + +A  + +P+F    +     C+K    +TG +TC++A FHL RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + ++R+ K
Sbjct:   75 SFGSIAETTMDYRVNIFLRQQWNDPRLAYNEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEEKDLRYCTKH--YNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWISFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHK 340          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Human
Match: GLRA2 (glycine receptor alpha 2 [Source:HGNC Symbol;Acc:HGNC:4327])

HSP 1 Score: 196.823 bits (499), Expect = 1.153e-55
Identity = 130/384 (33.85%), Postives = 213/384 (55.47%), Query Frame = 3
Query:  507 AINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS-SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKS-------EDWQKQVREIVRQELARWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEILLCPDTXXXXXXXXXXXXNRSKPQKSVDSEIDCYSRFLFPACFVLYNCFYW 1634
            +  SV    M+Y  ++ LRQ+W D RL +  +P     + S+   P++ + +W PDLFF N K    H +T  N L+R++ NG +LYS ++T+  SC M+L  FPMD Q C M + S+GYT++ L F W    P+ +A  + +P+F    +     C+K    +TG +TC++  FHL RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + ++R+ K        +  Q +  ++ R+    +        L     +++        P   +D + +              + V+R+K        ID  SR  FP  F+++N FYW
Sbjct:   81 SFGSVTETTMDYRVNIFLRQQWNDSRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELGYCTKHY--NTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFLRLRRRQKRQNKEEDVTRESRFNFSGYGMGHCLQVKDGTAVKATPANPLPQPPKDGDAI------------KKKFVDRAK-------RIDTISRAAFPLAFLIFNIFYW 438          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Celegans
Match: glc-1 (Glutamate-gated chloride channel alpha [Source:UniProtKB/Swiss-Prot;Acc:G5EBR3])

HSP 1 Score: 188.734 bits (478), Expect = 3.739e-53
Identity = 130/403 (32.26%), Postives = 216/403 (53.60%), Query Frame = 3
Query:  438 NYNLHERPSEVKQTEVVVYMRVL--AINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSISSPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNI--QIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKSEDWQKQVREIVRQELARWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEILLCPDTXXXXXXXXXXXXNRSKPQKSVDSEIDCYSRFLFPACFVLYNCFYW 1634
             Y+   RP       VVV + +L   I+ +DV+ MEYS  + LR+ W+D RL++                 +  ++W+PD FF N K+ Y H++  PN L+R++++G +LYS +I++  SC M L  +PMD Q+C +D+ SY YT   +++LW+E  P+ +   +   +P F  +    T+ C+  + T+TG Y+CL+ +  L+R+   YL   YIP+ ++V+VSW++FW    AIPAR+TLG+ TLL +  Q+ G+++ LP VSYIKAID+WI AC+ F+  AL+EFA+ + IA ++  E   +  RE     L +                         T +  ++ ++   P   ++          +++    +   +D  SR LFP  F ++N  YW
Sbjct:   74 GYDFRVRPPTDNGGPVVVSVNMLLRTISKIDVVNMEYSAQLTLRESWIDKRLSYGVK---GDGQPDFVILTVGHQIWMPDTFFPNEKQAYKHTIDKPNVLIRIHNDGTVLYSVRISLVLSCPMYLQYYPMDVQQCSIDLASYAYTTKDIEYLWKEHSPLQLKVGLSSSLPSFQLTNTSTTY-CT--SVTNTGIYSCLRTTIQLKREFSFYLLQLYIPSCMLVIVSWVSFWFDRTAIPARVTLGVTTLLTMTAQSAGINSQLPPVSYIKAIDVWIGACMTFIFCALLEFALVNHIANKQGVERKARTEREKAEIPLLQNL------------------HNDVPTKVFNQEEKVRTVPLNRRQMNSFLNLLETKTE-WNDISKRVDLISRALFPVLFFVFNILYW 451          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Celegans
Match: glc-1 (Glutamate-gated chloride channel alpha [Source:UniProtKB/Swiss-Prot;Acc:G5EBR3])

HSP 1 Score: 188.734 bits (478), Expect = 3.739e-53
Identity = 130/403 (32.26%), Postives = 216/403 (53.60%), Query Frame = 3
Query:  438 NYNLHERPSEVKQTEVVVYMRVL--AINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSISSPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNI--QIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKSEDWQKQVREIVRQELARWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEILLCPDTXXXXXXXXXXXXNRSKPQKSVDSEIDCYSRFLFPACFVLYNCFYW 1634
             Y+   RP       VVV + +L   I+ +DV+ MEYS  + LR+ W+D RL++                 +  ++W+PD FF N K+ Y H++  PN L+R++++G +LYS +I++  SC M L  +PMD Q+C +D+ SY YT   +++LW+E  P+ +   +   +P F  +    T+ C+  + T+TG Y+CL+ +  L+R+   YL   YIP+ ++V+VSW++FW    AIPAR+TLG+ TLL +  Q+ G+++ LP VSYIKAID+WI AC+ F+  AL+EFA+ + IA ++  E   +  RE     L +                         T +  ++ ++   P   ++          +++    +   +D  SR LFP  F ++N  YW
Sbjct:   74 GYDFRVRPPTDNGGPVVVSVNMLLRTISKIDVVNMEYSAQLTLRESWIDKRLSYGVK---GDGQPDFVILTVGHQIWMPDTFFPNEKQAYKHTIDKPNVLIRIHNDGTVLYSVRISLVLSCPMYLQYYPMDVQQCSIDLASYAYTTKDIEYLWKEHSPLQLKVGLSSSLPSFQLTNTSTTY-CT--SVTNTGIYSCLRTTIQLKREFSFYLLQLYIPSCMLVIVSWVSFWFDRTAIPARVTLGVTTLLTMTAQSAGINSQLPPVSYIKAIDVWIGACMTFIFCALLEFALVNHIANKQGVERKARTEREKAEIPLLQNL------------------HNDVPTKVFNQEEKVRTVPLNRRQMNSFLNLLETKTE-WNDISKRVDLISRALFPVLFFVFNILYW 451          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Celegans
Match: glc-3 (Glutamate-gated ChLoride channel; Glutamate-gated chloride channel subunit [Source:UniProtKB/TrEMBL;Acc:G5EEZ3])

HSP 1 Score: 186.808 bits (473), Expect = 3.940e-52
Identity = 122/312 (39.10%), Postives = 196/312 (62.82%), Query Frame = 3
Query:  411 EDILKIVFENYNLHERPSEVKQT------EVVVYMRVL--AINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSISSPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQ--IPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARR 1316
            E I K++ + Y+   RP  +  T       V+VY+ +L  +I+ +D + MEYS  +  R+EW+D RL  +  P  ++ +  I +    +++W+PD FF+N K+ + H +  PN L+R++ +G ILYS +I+M  SC M+L  +PMD Q C++D+ SY YT + +++ W++ +P+ +   +   +P F  +    T   SK   T+TG Y+CL+    LRRQ   YL   YIP+ ++V+VSW++FW+   A+PAR+TLG+ TLL + TQA+G++  LP VSY KAID+WI AC+ F+ GAL+EFA  + I+ R
Sbjct:   29 EIIKKLLGKGYDWRVRPPGINLTIPGTHGAVIVYVNMLIRSISKIDDVNMEYSVQLTFREEWVDGRLA-YGFPGDSTPDFLILTAG--QQIWMPDSFFQNEKQAHKHDIDKPNVLIRIHRDGRILYSVRISMVLSCPMHLQYYPMDVQTCLIDLASYAYTENDIEYRWKKTDPVQLKKGLHSSLPSFELNNVDTTLCTSK---TNTGTYSCLRTVLELRRQFSYYLLQLYIPSTMLVIVSWVSFWLDRGAVPARVTLGVTTLLTMTTQASGINAKLPPVSYTKAIDVWIGACLTFIFGALLEFAWVTYISSR 334          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Celegans
Match: avr-14 (pep chromosome:WBcel235:I:5968009:5973320:-1 gene:WBGene00000232.1 transcript:B0207.12a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:avr-14)

HSP 1 Score: 181.8 bits (460), Expect = 4.871e-51
Identity = 123/348 (35.34%), Postives = 206/348 (59.20%), Query Frame = 3
Query:  390 SENNVTREDILKIVFENYNLHERPSEVKQT----------EVVVYMRVLAINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPR-----------LASYNKSISSPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQ--IPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKSEDWQKQVREIVRQ 1364
            ++  +  ++I++ + ++Y+   RP  +  T           V +Y+R  +I+ +D + MEYS     R+EW D RL + R+             LA+   +  S    +++W+PD FF+N K+   H +  PN L+R++ NG ILYS ++++  SC M+L  +P+D Q C++D+ SY YT   +K+ W+EK+PI     ++  +P F    D  T  C+  + T+TG Y+CL+    LRR+   YL   YIP+ ++V+VSW++FW+  +++PAR+TLG+ TLL + TQ++G++  LP VSY KAID+WI  C+ F+ GAL+EFA+ +  AR+  +     QV + +RQ
Sbjct:   21 AKRKLKEQEIIQRILKDYDWRVRPRGMNATWPDTGGPVLVTVNIYLR--SISKIDDVNMEYSAQFTFREEWTDQRLAYERYEESGDTEVPPFVVLATSENADQS----QQIWMPDTFFQNEKEARRHLIDKPNVLIRIHKNGQILYSVRLSLVLSCPMSLEFYPLDRQNCLIDLASYAYTTQDIKYEWKEKKPIQQKDGLRQSLPSFELQ-DVVTDYCT--SLTNTGEYSCLRTRMVLRREFSYYLLQLYIPSFMLVIVSWVSFWLDKDSVPARVTLGVTTLLTMTTQSSGINAKLPPVSYTKAIDVWIGVCLAFIFGALLEFALVNYAARKDMT-----QVSQRIRQ 354          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Celegans
Match: avr-14 (pep chromosome:WBcel235:I:5967250:5973320:-1 gene:WBGene00000232.1 transcript:B0207.12a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:avr-14)

HSP 1 Score: 181.8 bits (460), Expect = 4.871e-51
Identity = 123/348 (35.34%), Postives = 206/348 (59.20%), Query Frame = 3
Query:  390 SENNVTREDILKIVFENYNLHERPSEVKQT----------EVVVYMRVLAINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPR-----------LASYNKSISSPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQ--IPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKSEDWQKQVREIVRQ 1364
            ++  +  ++I++ + ++Y+   RP  +  T           V +Y+R  +I+ +D + MEYS     R+EW D RL + R+             LA+   +  S    +++W+PD FF+N K+   H +  PN L+R++ NG ILYS ++++  SC M+L  +P+D Q C++D+ SY YT   +K+ W+EK+PI     ++  +P F    D  T  C+  + T+TG Y+CL+    LRR+   YL   YIP+ ++V+VSW++FW+  +++PAR+TLG+ TLL + TQ++G++  LP VSY KAID+WI  C+ F+ GAL+EFA+ +  AR+  +     QV + +RQ
Sbjct:   21 AKRKLKEQEIIQRILKDYDWRVRPRGMNATWPDTGGPVLVTVNIYLR--SISKIDDVNMEYSAQFTFREEWTDQRLAYERYEESGDTEVPPFVVLATSENADQS----QQIWMPDTFFQNEKEARRHLIDKPNVLIRIHKNGQILYSVRLSLVLSCPMSLEFYPLDRQNCLIDLASYAYTTQDIKYEWKEKKPIQQKDGLRQSLPSFELQ-DVVTDYCT--SLTNTGEYSCLRTRMVLRREFSYYLLQLYIPSFMLVIVSWVSFWLDKDSVPARVTLGVTTLLTMTTQSSGINAKLPPVSYTKAIDVWIGVCLAFIFGALLEFALVNYAARKDMT-----QVSQRIRQ 354          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Fly
Match: GluClalpha (gene:FBgn0024963 transcript:FBtr0343789)

HSP 1 Score: 201.83 bits (512), Expect = 7.982e-58
Identity = 153/446 (34.30%), Postives = 242/446 (54.26%), Query Frame = 3
Query:  333 VIVLTSICNIS-AQNSTTYFSENNVTREDILKIVFENYNLHERPSEVKQTE----VVVYMRVLAINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSISSPALKE--KVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFD-CSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKSEDWQKQVREIVRQELARWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEI-LLCPDTXXXXXXXXXXXXNRSK---PQKSVDSEIDCYSRFLFPACFVLYNCFYW 1634
            ++   S+C+ S A N+   F E      D + +    Y+   RPS +  T+    V V + V +I+ +D + MEYS  +  R++W D+RL      +       +    L E  +VW+PDLFF N K+G+ H++ +PN  +R+  NG +LYS +I++  +C MNL  +P+D Q C + + SYG+T + L FLW+E +P+ +  N+ +P F  + + +  D C+ +  T+TG Y+CLK     +R+   YL   YIP  ++V+VSW++FW+   A+PAR++LG+ TLL + TQ +G++ SLP VSY KAID+W   C+ FV GAL+EFA+ +  +R  ++ D  K+  +  R++L +         L    N++   +     P     LE  L C   +Q  K+    K   SK    Q S    ID  SR  FP  F L+N  YW
Sbjct:   10 ILYFASLCSASLANNAKINFREKEKKVLDQI-LGAGKYDARIRPSGINGTDGPAVVRVNIFVRSISKIDDVTMEYSVQLTFREQWTDERL------KFDDIQGRLKYLTLTEANRVWMPDLFFSNEKEGHFHNIIMPNVYIRIFPNGSVLYSIRISLTLACPMNLKLYPLDRQICSLRMASYGWTTNDLVFLWKEGDPVQVVKNLHLPRF--TLEKFLTDYCNSK--TNTGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVSLGVTTLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALVNYASRSDRAADMHKENMKKKRRDLEQASLDAASDLLDTDSNATFAMKPLVRHPGDPLALEKRLQCEVHMQAPKRPNCCKTWLSKFPTRQCSRSKRIDVISRITFPLVFALFNLVYW 444          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Fly
Match: GluClalpha (gene:FBgn0024963 transcript:FBtr0335420)

HSP 1 Score: 199.134 bits (505), Expect = 5.422e-57
Identity = 152/450 (33.78%), Postives = 236/450 (52.44%), Query Frame = 3
Query:  333 VIVLTSICNIS-AQNSTTYFSENNVTREDILKIVFENYNLHERPSEV-----KQTEVVVYMRVLAINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSISSPALKE--KVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFD-CSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKSEDWQKQVREIVRQELARWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEILL-------CPDTXXXXXXXXXXXXNRSKPQKSVDSEIDCYSRFLFPACFVLYNCFYW 1634
            ++   S+C+ S A N+   F E      D + +    Y+   RPS +     K T V V M + +I+ +D  KMEYS  +  R++W D+RL      +       +    L E  +VW+PDLFF N K+G+ H++ +PN  +R+  NG +LYS +I++  +C MNL  +P+D Q C + + SYG+T + L FLW+E +P+ +  N+ +P F  + + +  D C+ +  T+TG Y+CLK     +R+   YL   YIP  ++V+VSW++FW+   A+PAR++LG+ TLL + TQ +G++ SLP VSY KAID+W   C+ FV GAL+EFA+ +  +R     D  K+  +  R++L +         L    N++   +     P     LE  L        P      K    +   RSK        ID  SR  FP  F L+N  YW
Sbjct:   10 ILYFASLCSASLANNAKINFREKEKKVLDQI-LGAGKYDARIRPSGINGTDNKATNVSVNMFLRSISKIDDYKMEYSVQLTFREQWTDERL------KFDDIQGRLKYLTLTEANRVWMPDLFFSNEKEGHFHNIIMPNVYIRIFPNGSVLYSIRISLTLACPMNLKLYPLDRQICSLRMASYGWTTNDLVFLWKEGDPVQVVKNLHLPRF--TLEKFLTDYCNSK--TNTGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVSLGVTTLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALVNYASR----SDMHKENMKKKRRDLEQASLDAASDLLDTDSNATFAMKPLVRHPGDPLALEKRLQCEVHMQAPKRPNCCKTWLSKFPTRSK-------RIDVISRITFPLVFALFNLVYW 437          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Fly
Match: GluClalpha (gene:FBgn0024963 transcript:FBtr0343788)

HSP 1 Score: 197.593 bits (501), Expect = 3.564e-56
Identity = 146/453 (32.23%), Postives = 244/453 (53.86%), Query Frame = 3
Query:  333 VIVLTSICNIS-AQNSTTYFSENNVTREDILKIVFENYNLHERPSEVKQTE----VVVYMRVLAINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSISSPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFD-CSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKSE-DWQKQVREIVRQELARWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEILLCPDTXXXXXXXXXXXXNRSKPQK------------SVDSEIDCYSRFLFPACFVLYNCFYW 1634
            ++   S+C+ S A N+   F E      D + +    Y+   RPS +  T+    V V + V +I+ +D + MEYS  +  R++W D+RL +        Y     +     +VW+PDLFF N K+G+ H++ +PN  +R+  NG +LYS +I++  +C MNL  +P+D Q C + + SYG+T + L FLW+E +P+ +  N+ +P F  + + +  D C+ +  T+TG Y+CLK     +R+   YL   YIP  ++V+VSW++FW+   A+PAR++LG+ TLL + TQ +G++ SLP VSY KAID+W   C+ FV GAL+EFA+ +  +R   ++ +  K+  +  R++L +         L    N++    +QF    G +   ++  P      +K+   +V+   P++            +    ID  SR  FP  F L+N  YW
Sbjct:   10 ILYFASLCSASLANNAKINFREKEKKVLDQI-LGAGKYDARIRPSGINGTDGPAVVRVNIFVRSISKIDDVTMEYSVQLTFREQWTDERLKFDDIQGRLKYLTLTEA----NRVWMPDLFFSNEKEGHFHNIIMPNVYIRIFPNGSVLYSIRISLTLACPMNLKLYPLDRQICSLRMASYGWTTNDLVFLWKEGDPVQVVKNLHLPRF--TLEKFLTDYCNSK--TNTGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVSLGVTTLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALVNYASRSGSNKANMHKENMKKKRRDLEQASLDAASDLLDTDSNATFAMASQFARG-GGQQKPLVRHPGDPLALEKRLQCEVHMQAPKRPNCCKTWLSKFPTRSKRIDVISRITFPLVFALFNLVYW 452          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Fly
Match: GluClalpha (gene:FBgn0024963 transcript:FBtr0335418)

HSP 1 Score: 197.208 bits (500), Expect = 3.941e-56
Identity = 154/448 (34.38%), Postives = 242/448 (54.02%), Query Frame = 3
Query:  333 VIVLTSICNIS-AQNSTTYFSENNVTREDILKIVFENYNLHERPSEV-----KQTEVVVYMRVLAINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSISSPALKE--KVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFD-CSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKSE-DWQKQVREIVRQELARWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEI-LLCPDTXXXXXXXXXXXXNRSK---PQKSVDSEIDCYSRFLFPACFVLYNCFYW 1634
            ++   S+C+ S A N+   F E      D + +    Y+   RPS +     K T V V M + +I+ +D  KMEYS  +  R++W D+RL      +       +    L E  +VW+PDLFF N K+G+ H++ +PN  +R+  NG +LYS +I++  +C MNL  +P+D Q C + + SYG+T + L FLW+E +P+ +  N+ +P F  + + +  D C+ +  T+TG Y+CLK     +R+   YL   YIP  ++V+VSW++FW+   A+PAR++LG+ TLL + TQ +G++ SLP VSY KAID+W   C+ FV GAL+EFA+ +  +R   ++ +  K+  +  R++L +         L    N++   +     P     LE  L C   +Q  K+    K   SK    Q S    ID  SR  FP  F L+N  YW
Sbjct:   10 ILYFASLCSASLANNAKINFREKEKKVLDQI-LGAGKYDARIRPSGINGTDNKATNVSVNMFLRSISKIDDYKMEYSVQLTFREQWTDERL------KFDDIQGRLKYLTLTEANRVWMPDLFFSNEKEGHFHNIIMPNVYIRIFPNGSVLYSIRISLTLACPMNLKLYPLDRQICSLRMASYGWTTNDLVFLWKEGDPVQVVKNLHLPRF--TLEKFLTDYCNSK--TNTGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVSLGVTTLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALVNYASRSGSNKANMHKENMKKKRRDLEQASLDAASDLLDTDSNATFAMKPLVRHPGDPLALEKRLQCEVHMQAPKRPNCCKTWLSKFPTRQCSRSKRIDVISRITFPLVFALFNLVYW 446          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Fly
Match: GluClalpha (gene:FBgn0024963 transcript:FBtr0335416)

HSP 1 Score: 196.438 bits (498), Expect = 5.028e-56
Identity = 150/449 (33.41%), Postives = 236/449 (52.56%), Query Frame = 3
Query:  333 VIVLTSICNIS-AQNSTTYFSENNVTREDILKIVFENYNLHERPSEVKQTE----VVVYMRVLAINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSISSPALKE--KVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFD-CSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKSEDWQKQVREIVRQELARWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEILL-------CPDTXXXXXXXXXXXXNRSKPQKSVDSEIDCYSRFLFPACFVLYNCFYW 1634
            ++   S+C+ S A N+   F E      D + +    Y+   RPS +  T+    V V + V +I+ +D + MEYS  +  R++W D+RL      +       +    L E  +VW+PDLFF N K+G+ H++ +PN  +R+  NG +LYS +I++  +C MNL  +P+D Q C + + SYG+T + L FLW+E +P+ +  N+ +P F  + + +  D C+ +  T+TG Y+CLK     +R+   YL   YIP  ++V+VSW++FW+   A+PAR++LG+ TLL + TQ +G++ SLP VSY KAID+W   C+ FV GAL+EFA+ +  +R     D  K+  +  R++L +         L    N++   +     P     LE  L        P      K    +   RSK        ID  SR  FP  F L+N  YW
Sbjct:   10 ILYFASLCSASLANNAKINFREKEKKVLDQI-LGAGKYDARIRPSGINGTDGPAVVRVNIFVRSISKIDDVTMEYSVQLTFREQWTDERL------KFDDIQGRLKYLTLTEANRVWMPDLFFSNEKEGHFHNIIMPNVYIRIFPNGSVLYSIRISLTLACPMNLKLYPLDRQICSLRMASYGWTTNDLVFLWKEGDPVQVVKNLHLPRF--TLEKFLTDYCNSK--TNTGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVSLGVTTLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALVNYASR----SDMHKENMKKKRRDLEQASLDAASDLLDTDSNATFAMKPLVRHPGDPLALEKRLQCEVHMQAPKRPNCCKTWLSKFPTRSK-------RIDVISRITFPLVFALFNLVYW 436          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Zebrafish
Match: glra1 (glycine receptor, alpha 1 [Source:NCBI gene;Acc:30676])

HSP 1 Score: 205.682 bits (522), Expect = 2.558e-59
Identity = 137/382 (35.86%), Postives = 218/382 (57.07%), Query Frame = 3
Query:  507 AINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS-SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKS-EDWQKQVREIVRQELA----RWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEILLCPDTXXXXXXXXXXXXNRSKPQKSVDSEIDCYSRFLFPACFVLYNCFYW 1634
            +  S+    M+Y  ++ LRQ+W D RL +  +P     + S+   P++ + +W PDLFF N K    H +T  N L+R++ NG +LYS +IT+  +C M+L  FPMD Q CIM + S+GYT++ L F W EK  + +A  + +P+F    +     C+K    +TG +TC++A FHL RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + IAR+ K    +Q++ R +   E       + A       +Q ++   I       P  T   E        +  ++     ++R+K        ID  SR  FP  F+++N FYW
Sbjct:   71 SFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLVLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYCTKH--YNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQHKELLRFQRRRRHLKEDEAGDGRFSFAAYGMGPACLQAKDGMAIKGNNNNAPTSTNPPE--------KTVEEMRKLFISRAK-------RIDTVSRVAFPLVFLIFNIFYW 430          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Zebrafish
Match: glra1 (glycine receptor, alpha 1 [Source:NCBI gene;Acc:30676])

HSP 1 Score: 205.682 bits (522), Expect = 3.538e-59
Identity = 137/382 (35.86%), Postives = 218/382 (57.07%), Query Frame = 3
Query:  507 AINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS-SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKS-EDWQKQVREIVRQELA----RWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEILLCPDTXXXXXXXXXXXXNRSKPQKSVDSEIDCYSRFLFPACFVLYNCFYW 1634
            +  S+    M+Y  ++ LRQ+W D RL +  +P     + S+   P++ + +W PDLFF N K    H +T  N L+R++ NG +LYS +IT+  +C M+L  FPMD Q CIM + S+GYT++ L F W EK  + +A  + +P+F    +     C+K    +TG +TC++A FHL RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + IAR+ K    +Q++ R +   E       + A       +Q ++   I       P  T   E        +  ++     ++R+K        ID  SR  FP  F+++N FYW
Sbjct:   86 SFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLVLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYCTKH--YNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQHKELLRFQRRRRHLKEDEAGDGRFSFAAYGMGPACLQAKDGMAIKGNNNNAPTSTNPPE--------KTVEEMRKLFISRAK-------RIDTVSRVAFPLVFLIFNIFYW 445          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Zebrafish
Match: glra1 (glycine receptor, alpha 1 [Source:NCBI gene;Acc:30676])

HSP 1 Score: 205.682 bits (522), Expect = 3.860e-59
Identity = 137/382 (35.86%), Postives = 218/382 (57.07%), Query Frame = 3
Query:  507 AINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS-SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKS-EDWQKQVREIVRQELA----RWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEILLCPDTXXXXXXXXXXXXNRSKPQKSVDSEIDCYSRFLFPACFVLYNCFYW 1634
            +  S+    M+Y  ++ LRQ+W D RL +  +P     + S+   P++ + +W PDLFF N K    H +T  N L+R++ NG +LYS +IT+  +C M+L  FPMD Q CIM + S+GYT++ L F W EK  + +A  + +P+F    +     C+K    +TG +TC++A FHL RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + IAR+ K    +Q++ R +   E       + A       +Q ++   I       P  T   E        +  ++     ++R+K        ID  SR  FP  F+++N FYW
Sbjct:   84 SFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLVLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYCTKH--YNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQHKELLRFQRRRRHLKEDEAGDGRFSFAAYGMGPACLQAKDGMAIKGNNNNAPTSTNPPE--------KTVEEMRKLFISRAK-------RIDTVSRVAFPLVFLIFNIFYW 443          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Zebrafish
Match: glra3 (glycine receptor, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-020402-1])

HSP 1 Score: 201.445 bits (511), Expect = 1.136e-57
Identity = 136/382 (35.60%), Postives = 217/382 (56.81%), Query Frame = 3
Query:  507 AINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS-SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKSEDWQKQVREIVRQELARWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEILLCPDTXXXXXXXXXXXXNRSKPQKS---VD--SEIDCYSRFLFPACFVLYNCFYW 1634
            +  S+    M+Y  ++ LRQ+W D RL +  +P     + S+   P++ + +W PDLFF N K  + H +T  N L+R+  NG +LYS ++T+  SC M+L  FPMD Q CIM + S+GYT++ L F W+EK P+ +A  + +P+F    +     C+K    +TG +TC++  FHL RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + ++R+ K              EL R+    ++    +    S   R  F TP   +D  +    +       +P     +S  +     +D   +ID  SR  FP  F+ +N FYW
Sbjct:   80 SFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGAHFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEKGPVQVADGLTLPQFILKDESDLRYCTKH--YNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRTSLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHK--------------ELLRFRRRRKKSGKEEEVRES---RLSF-TPNAGKDGAVPKTANNAATTPSEPAVAPGKSHEEMRKLFIDRAKKIDTVSRAGFPLAFLFFNIFYW 436          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Zebrafish
Match: glra2 (glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-090407-1])

HSP 1 Score: 198.749 bits (504), Expect = 1.310e-56
Identity = 132/380 (34.74%), Postives = 218/380 (57.37%), Query Frame = 3
Query:  507 AINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS-SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKSEDWQKQVREIVRQELARWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEILLCPDTXXXXXXXXXXXXN-RSKPQKSVD--SEIDCYSRFLFPACFVLYNCFYW 1634
            +  SV    M+Y  ++ LRQ+W D RL +  +P     + S+   P++ + +W PDLFF N K    H +T  N L+R+  +G +LYS ++T+  SC M+L  FPMD Q C M + S+GYT++ L F W +K P+ +A  + +P+F    +     C+K    +TG +TC++  FHL RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + ++R++K     K+ +   ++E              +      +  + + T    +D  ++   +T     ++P    N  +  +K VD    ID  SR  FP  F+++N FYW
Sbjct:   79 SFGSVTETTMDYRVNIFLRQKWNDPRLAYSEYP-----DSSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRIFKDGTVLYSIRLTLILSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLDKGPVQVADGLTLPQFLIRDEKDLGYCTKHY--NTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAGVNFVSRQQKEFLRLKRRQRRTQKE--------------EDLQDGRLHFSSYNTTTCVKDGAVV--KNTQVNQIQQPSILKNTETNRKKFVDRAKRIDTISRAAFPLAFLIFNVFYW 435          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Xenopus
Match: GLRA3 (glycine receptor alpha 3 [Source:NCBI gene;Acc:100488938])

HSP 1 Score: 198.749 bits (504), Expect = 9.886e-57
Identity = 136/401 (33.92%), Postives = 223/401 (55.61%), Query Frame = 3
Query:  438 NYNLHERPS-EVKQTEVVVYMRVLAINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS-SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKSEDWQKQVREIVRQELARWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEILLCPDTXXXXXXXXXXXXNRSKPQKSVDSEIDCYSRFLFPACFVLYNCFYW 1634
             Y+   RP+ +     V   + V +  S+    M+Y  ++ LRQ+W D RL +  +P     + S+   P++ + +W PDLFF N K    H +T  N L+R+  +G +LYS ++T+  SC M+L  FPMD Q CIM + S+GYT++ L F W+E  P+ IA  + +P+F    +     C+K    +TG +TC++  FHL RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + ++R+ K         E++R    R        +  +   ++       +   G      L  P   +  ++     ++R+K       +ID  SR  FP  F+++N FYW
Sbjct:   39 GYDARIRPNFKGPPVNVTCNIFVNSFGSIAETTMDYRLNIFLRQKWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKDGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQENGPVQIADGLTLPQFVLKEEKDLRYCTKH--YNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHK---------ELLRFRRKRKKDRDDDVRESRFSFTAYGMGPCLQAKDGVNPKGPLNAPPAPKTHEEMRKVFIDRAK-------KIDTLSRACFPLAFLIFNIFYW 416          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Xenopus
Match: GLRA3 (glycine receptor alpha 3 [Source:NCBI gene;Acc:100488938])

HSP 1 Score: 198.749 bits (504), Expect = 1.272e-56
Identity = 136/401 (33.92%), Postives = 223/401 (55.61%), Query Frame = 3
Query:  438 NYNLHERPS-EVKQTEVVVYMRVLAINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS-SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKSEDWQKQVREIVRQELARWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEILLCPDTXXXXXXXXXXXXNRSKPQKSVDSEIDCYSRFLFPACFVLYNCFYW 1634
             Y+   RP+ +     V   + V +  S+    M+Y  ++ LRQ+W D RL +  +P     + S+   P++ + +W PDLFF N K    H +T  N L+R+  +G +LYS ++T+  SC M+L  FPMD Q CIM + S+GYT++ L F W+E  P+ IA  + +P+F    +     C+K    +TG +TC++  FHL RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + ++R+ K         E++R    R        +  +   ++       +   G      L  P   +  ++     ++R+K       +ID  SR  FP  F+++N FYW
Sbjct:   51 GYDARIRPNFKGPPVNVTCNIFVNSFGSIAETTMDYRLNIFLRQKWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKDGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQENGPVQIADGLTLPQFVLKEEKDLRYCTKH--YNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHK---------ELLRFRRKRKKDRDDDVRESRFSFTAYGMGPCLQAKDGVNPKGPLNAPPAPKTHEEMRKVFIDRAK-------KIDTLSRACFPLAFLIFNIFYW 428          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Xenopus
Match: GLRA1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:100498379])

HSP 1 Score: 196.823 bits (499), Expect = 7.805e-56
Identity = 125/337 (37.09%), Postives = 203/337 (60.24%), Query Frame = 3
Query:  318 TDLIFVIVLTSICNISAQNSTTYFSENNVTREDILKIVFENYNLHERPS-EVKQTEVVVYMRVLAINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS-SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRK 1322
            T L F +  +     SA++S    S ++   + + KI    Y+   RP+ +     V   + + +  S+    M+Y  ++ LRQ+W D RL +  +P     + S+   P++ + +W PDLFF N K    H +T  N L+R+  NG +LYS ++T+  +C M+L  FPMD Q CIM + S+GYT++ L F W E   + +A  + +P+F    +     C+K    STG +TC++A FHL RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + ++R+ K
Sbjct:   14 TVLFFSLAASKEVGASARSSAKLMSPSDFLDKLMGKI--SGYDARIRPNFKGPPVNVSCNIFINSFGSIAETTMDYRLNIFLRQQWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHEITTDNKLLRIFKNGNVLYSIRLTLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWEEVGAVQVAEGLTLPQFILKEEKDLRYCTKH--YSTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHK 341          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Xenopus
Match: GLRA1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:100498379])

HSP 1 Score: 195.667 bits (496), Expect = 2.251e-55
Identity = 125/335 (37.31%), Postives = 202/335 (60.30%), Query Frame = 3
Query:  327 IFVIVLTSICNISAQNSTTYFSENNVTREDILKIVFENYNLHERPSEVKQTEVVVYMRVL--AINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS-SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRK 1322
            +F +  +     SA++S    S ++   + + KI    Y+   RP+  K   V V   +   +  S+    M+Y  ++ LRQ+W D RL +  +P     + S+   P++ + +W PDLFF N K    H +T  N L+R+  NG +LYS ++T+  +C M+L  FPMD Q CIM + S+GYT++ L F W E   + +A  + +P+F    +     C+K    STG +TC++A FHL RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + ++R+ K
Sbjct:   10 LFFLAASKEVGASARSSAKLMSPSDFLDKLMGKI--SGYDARIRPN-FKGPPVNVSCNIFINSFGSIAETTMDYRLNIFLRQQWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHEITTDNKLLRIFKNGNVLYSIRLTLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWEEVGAVQVAEGLTLPQFILKEEKDLRYCTKH--YSTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHK 334          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Xenopus
Match: GLRA1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:100498379])

HSP 1 Score: 195.667 bits (496), Expect = 2.572e-55
Identity = 125/339 (36.87%), Postives = 206/339 (60.77%), Query Frame = 3
Query:  312 LVTDLIFVIVLTSICNISAQNSTTYFSENNVTREDILKIVFENYNLHERPS-EVKQTEVVVYMRVLAINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS-SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRK 1322
            +V+ +IF+     +   SA++S    S ++   + + KI    Y+   RP+ +     V   + + +  S+    M+Y  ++ LRQ+W D RL +  +P     + S+   P++ + +W PDLFF N K    H +T  N L+R+  NG +LYS ++T+  +C M+L  FPMD Q CIM + S+GYT++ L F W E   + +A  + +P+F    +     C+K    STG +TC++A FHL RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + ++R+ K
Sbjct:   14 IVSAMIFLAASKEV-GASARSSAKLMSPSDFLDKLMGKI--SGYDARIRPNFKGPPVNVSCNIFINSFGSIAETTMDYRLNIFLRQQWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHEITTDNKLLRIFKNGNVLYSIRLTLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWEEVGAVQVAEGLTLPQFILKEEKDLRYCTKH--YSTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHK 342          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Mouse
Match: Glra1 (glycine receptor, alpha 1 subunit [Source:MGI Symbol;Acc:MGI:95747])

HSP 1 Score: 198.364 bits (503), Expect = 2.046e-57
Identity = 111/264 (42.05%), Postives = 179/264 (67.80%), Query Frame = 3
Query:  534 MEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS-SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRK 1322
            M+Y  ++ LRQ+W D RL ++ +P     + S+   P++ + +W PDLFF N K  + H +T  N L+R++ NG +LYS +IT+  +C M+L  FPMD Q CIM + S+GYT++ L F W+E+  + +A  + +P+F    +     C+K    +TG +TC++A FHL RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + ++R+ K
Sbjct:    1 MDYRVNIFLRQQWNDPRLAYNEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEEKDLRYCTKH--YNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWISFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHK 257          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Mouse
Match: Glra1 (glycine receptor, alpha 1 subunit [Source:MGI Symbol;Acc:MGI:95747])

HSP 1 Score: 198.364 bits (503), Expect = 1.504e-56
Identity = 112/273 (41.03%), Postives = 182/273 (66.67%), Query Frame = 3
Query:  507 AINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS-SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRK 1322
            +  S+    M+Y  ++ LRQ+W D RL ++ +P     + S+   P++ + +W PDLFF N K  + H +T  N L+R++ NG +LYS +IT+  +C M+L  FPMD Q CIM + S+GYT++ L F W+E+  + +A  + +P+F    +     C+K    +TG +TC++A FHL RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + ++R+ K
Sbjct:   75 SFGSIAETTMDYRVNIFLRQQWNDPRLAYNEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEEKDLRYCTKH--YNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWISFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHK 340          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Mouse
Match: Glra1 (glycine receptor, alpha 1 subunit [Source:MGI Symbol;Acc:MGI:95747])

HSP 1 Score: 198.364 bits (503), Expect = 1.789e-56
Identity = 112/273 (41.03%), Postives = 182/273 (66.67%), Query Frame = 3
Query:  507 AINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS-SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRK 1322
            +  S+    M+Y  ++ LRQ+W D RL ++ +P     + S+   P++ + +W PDLFF N K  + H +T  N L+R++ NG +LYS +IT+  +C M+L  FPMD Q CIM + S+GYT++ L F W+E+  + +A  + +P+F    +     C+K    +TG +TC++A FHL RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + ++R+ K
Sbjct:   75 SFGSIAETTMDYRVNIFLRQQWNDPRLAYNEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEEKDLRYCTKH--YNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWISFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHK 340          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Mouse
Match: Glra2 (glycine receptor, alpha 2 subunit [Source:MGI Symbol;Acc:MGI:95748])

HSP 1 Score: 197.208 bits (500), Expect = 5.584e-56
Identity = 130/384 (33.85%), Postives = 213/384 (55.47%), Query Frame = 3
Query:  507 AINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS-SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKS-------EDWQKQVREIVRQELARWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEILLCPDTXXXXXXXXXXXXNRSKPQKSVDSEIDCYSRFLFPACFVLYNCFYW 1634
            +  SV    M+Y  ++ LRQ+W D RL +  +P     + S+   P++ + +W PDLFF N K    H +T  N L+R++ NG +LYS ++T+  SC M+L  FPMD Q C M + S+GYT++ L F W    P+ +A  + +P+F    +     C+K    +TG +TC++  FHL RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + ++R+ K        +  Q +  ++ R+    +        L     +++        P   +D + +              + V+R+K        ID  SR  FP  F+++N FYW
Sbjct:   81 SFGSVTETTMDYRVNIFLRQQWNDSRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELGYCTKHY--NTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFLRLRRRQKRQNKEEDVTRESRFNFSGYGMGHCLQMKDGTAVKATPANPLPQPPKDADAI------------KKKFVDRAK-------RIDTISRAAFPLAFLIFNIFYW 438          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Mouse
Match: Glra4 (glycine receptor, alpha 4 subunit [Source:MGI Symbol;Acc:MGI:95750])

HSP 1 Score: 196.438 bits (498), Expect = 1.011e-55
Identity = 139/392 (35.46%), Postives = 213/392 (54.34%), Query Frame = 3
Query:  507 AINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS-SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPII-IASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRK--------------SEDWQKQVREIVRQELARWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEILLCPDTXXXXXXXXXXXXNRSKPQKSVDSEIDCYSRFLFPACFVLYNCFYW 1634
            +  SV    M+Y  +V LRQ+W D RL +  +P     + S+   P++ + +W PDLFF N K    H +T  N L+R+  NG +LYS ++T+  SC M+L  FPMD Q C M + S+GYT++ L F W E  P + +A  + +P+F    +     C+K    +TG +TC++  FHL RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + ++R+ K               ED  ++ R   R         C Q +       S I   Q  TP+  E              +      V+R+K        ID  SR +FP  F+++N FYW
Sbjct:   80 SFGSVTETTMDYRVNVFLRQQWNDPRLAYREYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLILSCPMDLKNFPMDIQTCTMQLESFGYTMNDLMFEWLEDAPAVQVAEGLTLPQFILRDEKDLGYCTKHY--NTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFMRLRRRQRRQRMEEDIIRESRFYFR---GYGLGHCLQARDGGPMEGSSIYSPQPPTPLLKEG-------------ETMRKLYVDRAK-------RIDTISRAVFPFTFLVFNIFYW 441          
BLAST of Glycine receptor subunit alpha-3 vs. UniProt/SwissProt
Match: sp|O93430|GLRA1_DANRE (Glycine receptor subunit alphaZ1 OS=Danio rerio OX=7955 GN=glra1 PE=1 SV=1)

HSP 1 Score: 205.682 bits (522), Expect = 1.931e-58
Identity = 137/382 (35.86%), Postives = 218/382 (57.07%), Query Frame = 3
Query:  507 AINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS-SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKS-EDWQKQVREIVRQELA----RWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEILLCPDTXXXXXXXXXXXXNRSKPQKSVDSEIDCYSRFLFPACFVLYNCFYW 1634
            +  S+    M+Y  ++ LRQ+W D RL +  +P     + S+   P++ + +W PDLFF N K    H +T  N L+R++ NG +LYS +IT+  +C M+L  FPMD Q CIM + S+GYT++ L F W EK  + +A  + +P+F    +     C+K    +TG +TC++A FHL RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + IAR+ K    +Q++ R +   E       + A       +Q ++   I       P  T   E        +  ++     ++R+K        ID  SR  FP  F+++N FYW
Sbjct:   71 SFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLVLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYCTKH--YNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQHKELLRFQRRRRHLKEDEAGDGRFSFAAYGMGPACLQAKDGMAIKGNNNNAPTSTNPPE--------KTVEEMRKLFISRAK-------RIDTVSRVAFPLVFLIFNIFYW 430          
BLAST of Glycine receptor subunit alpha-3 vs. UniProt/SwissProt
Match: sp|Q64018|GLRA1_MOUSE (Glycine receptor subunit alpha-1 OS=Mus musculus OX=10090 GN=Glra1 PE=1 SV=2)

HSP 1 Score: 198.364 bits (503), Expect = 1.251e-55
Identity = 112/273 (41.03%), Postives = 182/273 (66.67%), Query Frame = 3
Query:  507 AINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS-SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRK 1322
            +  S+    M+Y  ++ LRQ+W D RL ++ +P     + S+   P++ + +W PDLFF N K  + H +T  N L+R++ NG +LYS +IT+  +C M+L  FPMD Q CIM + S+GYT++ L F W+E+  + +A  + +P+F    +     C+K    +TG +TC++A FHL RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + ++R+ K
Sbjct:   75 SFGSIAETTMDYRVNIFLRQQWNDPRLAYNEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEEKDLRYCTKH--YNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWISFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHK 340          
BLAST of Glycine receptor subunit alpha-3 vs. UniProt/SwissProt
Match: sp|P07727|GLRA1_RAT (Glycine receptor subunit alpha-1 OS=Rattus norvegicus OX=10116 GN=Glra1 PE=1 SV=4)

HSP 1 Score: 198.364 bits (503), Expect = 1.291e-55
Identity = 112/273 (41.03%), Postives = 182/273 (66.67%), Query Frame = 3
Query:  507 AINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS-SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRK 1322
            +  S+    M+Y  ++ LRQ+W D RL ++ +P     + S+   P++ + +W PDLFF N K  + H +T  N L+R++ NG +LYS +IT+  +C M+L  FPMD Q CIM + S+GYT++ L F W+E+  + +A  + +P+F    +     C+K    +TG +TC++A FHL RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + ++R+ K
Sbjct:   75 SFGSIAETTMDYRVNIFLRQQWNDPRLAYNEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEEKDLRYCTKH--YNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWISFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHK 340          
BLAST of Glycine receptor subunit alpha-3 vs. UniProt/SwissProt
Match: sp|P57695|GLRA1_BOVIN (Glycine receptor subunit alpha-1 OS=Bos taurus OX=9913 GN=GLRA1 PE=1 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 1.774e-55
Identity = 112/273 (41.03%), Postives = 182/273 (66.67%), Query Frame = 3
Query:  507 AINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS-SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRK 1322
            +  S+    M+Y  ++ LRQ+W D RL ++ +P     + S+   P++ + +W PDLFF N K  + H +T  N L+R++ NG +LYS +IT+  +C M+L  FPMD Q CIM + S+GYT++ L F W+E+  + +A  + +P+F    +     C+K    +TG +TC++A FHL RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + ++R+ K
Sbjct:   75 SFGSIAETTMDYRVNIFLRQQWNDPRLAYNEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEEKDLRYCTKH--YNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWISFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHK 340          
BLAST of Glycine receptor subunit alpha-3 vs. UniProt/SwissProt
Match: sp|P23415|GLRA1_HUMAN (Glycine receptor subunit alpha-1 OS=Homo sapiens OX=9606 GN=GLRA1 PE=1 SV=2)

HSP 1 Score: 197.593 bits (501), Expect = 2.515e-55
Identity = 112/273 (41.03%), Postives = 182/273 (66.67%), Query Frame = 3
Query:  507 AINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS-SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRK 1322
            +  S+    M+Y  ++ LRQ+W D RL ++ +P     + S+   P++ + +W PDLFF N K  + H +T  N L+R++ NG +LYS +IT+  +C M+L  FPMD Q CIM + S+GYT++ L F W+E+  + +A  + +P+F    +     C+K    +TG +TC++A FHL RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + ++R+ K
Sbjct:   75 SFGSIAETTMDYRVNIFLRQQWNDPRLAYNEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEEKDLRYCTKH--YNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWISFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHK 340          
BLAST of Glycine receptor subunit alpha-3 vs. TrEMBL
Match: A0A183LIM7 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS3652 PE=3 SV=1)

HSP 1 Score: 413.305 bits (1061), Expect = 3.273e-136
Identity = 238/413 (57.63%), Postives = 310/413 (75.06%), Query Frame = 3
Query:  408 REDILKIVFENYNLHERPSEVKQTEVV-VYMRVLAINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSISSPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKSEDWQKQVREIVRQELARWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEILLCPDTXXXXXXXXXXXXNRSKPQKS---VDSEIDCYSRFLFPACFVLYNCFYW 1634
            R+ I+ ++   Y  +ERP +     +V V M+VLAI S+DV  M+Y  D+LLRQ W D RL+W+  P  A +N+ + SP LKE++WLPDLFFRNGK GY+H +TLPNYL+R++ NG +LYSQKITMRFSCQM+L TFPMD+Q C ++IGSYGYTL++LKF+W   +P+ +A  +Q+ EF       T DCS    TSTG YTCL A+F L+RQLGSYLA+TYIPNVLI+MVSWL+FWV+V++ PAR+ LGLL+LLGILTQA  +S++LPRVSYIKAIDIW+I  IIFVIG L+E+A+A  I RR++SE W + V+EIVR+ELARWCA+CQQQQL+Q+QNS+ + R Q E     E+LE LL         +      +++KP++    ++SEID YSRFLFPACFVLYNCFYW
Sbjct:    2 RDRIVNLIMSKYRSYERPPDGGNATIVTVNMKVLAIFSIDVRTMDYYIDLLLRQVWRDRRLSWYDIPEFAKFNEPLVSPKLKEQLWLPDLFFRNGKDGYLHKLTLPNYLLRVHPNGNVLYSQKITMRFSCQMHLQTFPMDNQHCHINIGSYGYTLNELKFVWNHDKPVELAEKLQLSEFETPKQFITNDCSSGYSTSTGQYTCLNATFELQRQLGSYLATTYIPNVLIIMVSWLSFWVNVDSAPARVPLGLLSLLGILTQAISVSSTLPRVSYIKAIDIWMIFSIIFVIGVLVEYAIALTILRRKQSETWHEDVKEIVREELARWCAICQQQQLIQLQNSNHLTRGQLEF---REELEHLL-------TNQFIDDHKDKTKPKRPPGLIESEIDTYSRFLFPACFVLYNCFYW 404          
BLAST of Glycine receptor subunit alpha-3 vs. TrEMBL
Match: A0A3S5FGS1 (Uncharacterized protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS33396 PE=3 SV=1)

HSP 1 Score: 411.379 bits (1056), Expect = 6.437e-135
Identity = 242/415 (58.31%), Postives = 303/415 (73.01%), Query Frame = 3
Query:  396 NNVTREDILKIVFENYNLHERPSEVKQT--EVVVYMRVLAINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSISSPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKSEDWQKQVREIVRQELARWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEILLCPDTXXXXXXXXXXXXNRSKPQKSVDSEIDCYSRFLFPACFVLYNCFYW 1634
            N+ TR+ I+  +F NY  HERP+E+  T  EV V MRVLAI S+DV  M+Y  D  LRQ W D RL W        Y + I S  LK  +WLPDLFFRNGK+GY+H+MT+PNYL+R+  +G +LYSQKITMRFSCQM L  FPMD Q C ++IGSYGYTL++LKF+W E E + ++  ++I EFN      TFDC+  + TSTGNYTCL A+F L+RQL SYLA+TYIPN+LI+MVSWL+FWV+V+A PAR+ LGLL+LLGILTQA+ +SNSLPRVSYIKAIDIW+I  IIFVIG L+E+A+A  + RR++++ W + VREIVRQELA+WC  CQQQ LVQ+QNS  + R Q E     E+LE LL    +   K+K        KP  + +SEID YSRFLFPACF+LYNCFYW
Sbjct:   29 NSSTRDRIVNHIFRNYLKHERPTELDNTPTEVGVNMRVLAIFSIDVRNMDYYIDAYLRQIWFDKRLAWAHIDEFRQYKQPIVSSKLKNDIWLPDLFFRNGKEGYLHTMTVPNYLLRVMPDGNVLYSQKITMRFSCQMELQNFPMDMQVCGLNIGSYGYTLNELKFVWHE-EKVNLSGRMRISEFNTPETFDTFDCTNSSKTSTGNYTCLNATFKLKRQLSSYLATTYIPNILIIMVSWLSFWVNVDAAPARVPLGLLSLLGILTQASSVSNSLPRVSYIKAIDIWMIFSIIFVIGVLVEYALALTMLRRKRADTWHRDVREIVRQELAKWCTACQQQHLVQLQNSHQLTRGQLEF---CEELEALLTNQVIDHQKEKNKAV----KPTTTTESEIDSYSRFLFPACFLLYNCFYW 435          
BLAST of Glycine receptor subunit alpha-3 vs. TrEMBL
Match: A0A183W0B4 (Uncharacterized protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS6169 PE=3 SV=1)

HSP 1 Score: 414.846 bits (1065), Expect = 7.604e-135
Identity = 237/413 (57.38%), Postives = 309/413 (74.82%), Query Frame = 3
Query:  408 REDILKIVFENYNLHERPSEVKQTEVV-VYMRVLAINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSISSPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKSEDWQKQVREIVRQELARWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEILLCPDTXXXXXXXXXXXXNRSKPQKS---VDSEIDCYSRFLFPACFVLYNCFYW 1634
            R+ I+ ++   Y  +ERP +     +V V M+VLAI S+DV  M+Y+ D+LLRQ W D RL+WH  P    + + + SP LKE++WLPDLFFRNGK GY+H +TLPNYL+R++ NG +LYSQKITMRFSCQM+L TFPMDSQ C +DIGSYGYTL++LKF+W  ++P+ +  N+Q+ EF         DCS    TSTG Y CLKA+F L+RQLGSYLA+TY+PNVLI+MVSWL+FWV+V++ PAR+ LGLL+LLGILTQA  +S++LPRVSYIKAIDIW+I  IIFVIG L+E+A+A  + RR++SE W + V++IVR+ELARWCA+CQQQQLVQ+QNS  + R Q E     E+LE LL         +   +  ++SKP++    V+SE+D YSRFLFPACFVLYNCFYW
Sbjct:  141 RDRIVSLIMSKYRSYERPPDGGNATIVTVNMKVLAIFSIDVRTMDYNVDLLLRQAWRDRRLSWHEIPEFRDFKEPLVSPKLKEQLWLPDLFFRNGKDGYLHKLTLPNYLLRVHPNGNVLYSQKITMRFSCQMHLQTFPMDSQSCYIDIGSYGYTLNELKFVWNGEKPVELGENLQLSEFETPEKFDAHDCSSGYSTSTGQYACLKATFELQRQLGSYLATTYVPNVLIIMVSWLSFWVNVDSAPARVPLGLLSLLGILTQAISVSSTLPRVSYIKAIDIWMIFSIIFVIGVLVEYAVALTLLRRKQSETWHEDVKDIVREELARWCAICQQQQLVQLQNSQGLTRGQMEF---REELEHLLT-------NQLIEESKDKSKPRRPPGLVESEVDTYSRFLFPACFVLYNCFYW 543          
BLAST of Glycine receptor subunit alpha-3 vs. TrEMBL
Match: A0A0R3U2G6 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS652 PE=3 SV=1)

HSP 1 Score: 411.379 bits (1056), Expect = 2.413e-134
Identity = 225/414 (54.35%), Postives = 306/414 (73.91%), Query Frame = 3
Query:  408 REDILKIVFENYNLHERPSEV--KQTEVVVYMRVLAINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSISSPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKSEDWQKQVREIVRQELARWCAVCXXXXXXXXXNSSLI--DRTQFETPIGT-EDLEILLCPDTXXXXXXXXXXXXNRSKPQKSVDSEIDCYSRFLFPACFVLYNCFYW 1634
            R+ ++ ++F NY  HERP+E   + T V V M+VLAI SVDV  M+Y  D LLRQ W D RL W       +Y + + SP LKE +WLPDLFFRNGK GY+H MTLPNYL+R++ NG +LYSQKITMRF+CQM+L+TFPMD+Q C M+IGSYGYTL +LKF+WREKEP+ + +N+Q+ EFN  T+  TFDC+ ++ TSTGNYTCL A F L+RQLGSYL +TYIPN+LI+MVSWL+F+VSV+A PAR+ LGLL+LLG+LTQA+ ++ +LPRVSYIKAID+W+I  IIFVIG L+E+A+A  + R+++ E W+  V +IV++EL RW A C+Q QL  I+  S++  D+   +  +    DL+  L    +++ + K      +++   +V+SEID YSRFLFP C+++YN FYW
Sbjct:   70 RDKLVGMLFTNYKTHERPTEKLDRPTVVEVNMKVLAIFSVDVRTMDYYIDALLRQTWTDPRLAWEHKEGFENYTQPLVSPTLKENLWLPDLFFRNGKDGYLHKMTLPNYLLRVHPNGDVLYSQKITMRFACQMDLATFPMDTQYCFMNIGSYGYTLSELKFVWREKEPVEVQNNLQLSEFNTPTNFSTFDCTAQSSTSTGNYTCLMAKFSLKRQLGSYLVTTYIPNILIIMVSWLSFYVSVDAAPARVPLGLLSLLGLLTQASSITGTLPRVSYIKAIDLWLIFSIIFVIGVLVEYAIAITMLRQKRKETWRGDVEKIVKEELTRWLAACEQGQLASIKGGSVVGGDQAFIQQQLAYFSDLDAFLTKSVIEETRTKKGATGKKNRIPVAVESEIDAYSRFLFPTCYIMYNIFYW 483          
BLAST of Glycine receptor subunit alpha-3 vs. TrEMBL
Match: A0A5K3EVT1 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 407.527 bits (1046), Expect = 5.335e-134
Identity = 224/408 (54.90%), Postives = 302/408 (74.02%), Query Frame = 3
Query:  426 IVFENYNLHERPSEV--KQTEVVVYMRVLAINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSISSPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKSEDWQKQVREIVRQELARWCAVCXXXXXXXXXNSSLI--DRTQFETPIGT-EDLEILLCPDTXXXXXXXXXXXXNRSKPQKSVDSEIDCYSRFLFPACFVLYNCFYW 1634
            ++F NY  HERP+E   + T V V M+VLAI SVDV  M+Y  D LLRQ W D RL W       +Y + + SP LKE +WLPDLFFRNGK GY+H MTLPNYL+R++ NG +LYSQKITMRF+CQM+L+TFPMD+Q C M+IGSYGYTL +LKF+WREKEP+ + +N+Q+ EFN  T+  TFDC+ ++ TSTGNYTCL A F L+RQLGSYL +TYIPN+LI+MVSWL+F+VSV+A PAR+ LGLL+LLG+LTQA+ ++ +LPRVSYIKAID+W+I  IIFVIG L+E+A+A  + R+++ E W+  V +IV++EL RW A C+Q QL  I+  S++  D+   +  +    DL+  L    +++ + K      +++   +V+SEID YSRFLFP C+++YN FYW
Sbjct:    1 MLFTNYKTHERPTEKLDRPTVVEVNMKVLAIFSVDVRTMDYYIDALLRQTWTDPRLAWEHKEGFENYTQPLVSPTLKENLWLPDLFFRNGKDGYLHKMTLPNYLLRVHPNGDVLYSQKITMRFACQMDLATFPMDTQYCFMNIGSYGYTLSELKFVWREKEPVEVQNNLQLSEFNTPTNFSTFDCTAQSSTSTGNYTCLMAKFSLKRQLGSYLVTTYIPNILIIMVSWLSFYVSVDAAPARVPLGLLSLLGLLTQASSITGTLPRVSYIKAIDLWLIFSIIFVIGVLVEYAIAITMLRQKRKETWRGDVEKIVKEELTRWLAACEQGQLASIKGGSVVGGDQAFIQQQLAYFSDLDAFLTKSVIEETRTKKGATGKKNRIPVAVESEIDAYSRFLFPTCYIMYNIFYW 408          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Cavefish
Match: glra1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:103026517])

HSP 1 Score: 204.912 bits (520), Expect = 5.157e-59
Identity = 137/389 (35.22%), Postives = 215/389 (55.27%), Query Frame = 3
Query:  507 AINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS-SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKS-EDWQKQVREIVRQELARWCAVCXXXXXXXXXNSSLIDRTQFET-PIGTEDLEILLCPDTXXXXXXXXXXXXNRSKPQKSVD----------SEIDCYSRFLFPACFVLYNCFYW 1634
            +  S+    M+Y  ++ LRQ+W D RL +  +P     + S+   P++ + +W PDLFF N K    H +T  N L+R++ NG +LYS +IT+  +C M+L  FPMD Q CIM + S+GYT++ L F W EK  + +A  + +P+F    +     C+K    +TG +TC++A FHL RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + IAR+ K    +Q++ R +   E                       R  F    +G   L+     D +           +   P+K+V+            ID  SR  FP  F+++N FYW
Sbjct:   74 SFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLVLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYCTKH--YNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQHKELLRFQRRRRHLKEDEAGE-------------------GRFSFAAYGMGPACLQ---AKDGMAIKGNNNNAPTSSIPPEKTVEEMRKLFISRAKRIDTVSRVAFPLVFLIFNIFYW 433          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Cavefish
Match: glra3 (glycine receptor, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-020402-1])

HSP 1 Score: 204.912 bits (520), Expect = 6.068e-59
Identity = 130/378 (34.39%), Postives = 218/378 (57.67%), Query Frame = 3
Query:  507 AINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS-SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKSE-DWQKQVREIVRQELARWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEILLCPDTXXXXXXXXXXXXNRSKPQKSVDSEIDCYSRFLFPACFVLYNCFYW 1634
            +  S+    M+Y  ++ LRQ+W D RL +  +P     + S+   P++ + +W PDLFF N K  + H +T  N L+R+  NG +LYS ++T+  SC M+L  FPMD Q CIM + S+GYT++ L F W+   P+ +A  + +P+F    +     C+K    +TG +TC++  FHL RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + ++R+ K    ++++ ++  ++E  R   +       +    +        TP G     +   P   +  ++     ++R+K       +ID  SR  FP  F+ +N FYW
Sbjct:   79 SFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGAHFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQANGPVQVADGLTLPQFILKDESDLRYCTKHY--NTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRTSLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRRRKKSTKEEEVRESCLSFTANAGKDGTMTKPTNNAASTPKGQPTPTV---PQAGKSTEEMRKIFIDRAK-------KIDTVSRAGFPLAFLFFNIFYW 439          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Cavefish
Match: glra1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:103026517])

HSP 1 Score: 204.527 bits (519), Expect = 8.007e-59
Identity = 135/388 (34.79%), Postives = 212/388 (54.64%), Query Frame = 3
Query:  507 AINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS-SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKS-EDWQKQVREIVRQELARWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEILLCPDTXXXXXXXXXXXXNRSKPQKSVD----------SEIDCYSRFLFPACFVLYNCFYW 1634
            +  S+    M+Y  ++ LRQ+W D RL +  +P     + S+   P++ + +W PDLFF N K    H +T  N L+R++ NG +LYS +IT+  +C M+L  FPMD Q CIM + S+GYT++ L F W EK  + +A  + +P+F    +     C+K    +TG +TC++A FHL RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + IAR+ K    +Q++ R +   E                         +F           L   D +           +   P+K+V+            ID  SR  FP  F+++N FYW
Sbjct:   87 SFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLVLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYCTKH--YNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQHKELLRFQRRRRHLKEDEAG---------------------EGRFSFAAYGMGPACLQAKDGMAIKGNNNNAPTSSIPPEKTVEEMRKLFISRAKRIDTVSRVAFPLVFLIFNIFYW 446          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Cavefish
Match: glra2 (glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-090407-1])

HSP 1 Score: 198.364 bits (503), Expect = 1.134e-56
Identity = 134/388 (34.54%), Postives = 215/388 (55.41%), Query Frame = 3
Query:  507 AINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS-SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIAR---------RRKSEDWQKQVREIVRQELARWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEILLCPDTXXXXXXXXXXXXNRSKPQKSVD--SEIDCYSRFLFPACFVLYNCFYW 1634
            +  SV    M+Y  ++ LRQ+W D RL +  +P     + S+   P++ + +W PDLFF N K    H +T  N L+R++ +G +LYS ++T+  SC M+L  FPMD Q C M + S+GYT++ L F W ++ P+ +A  + +P+F    +     C+K    +TG +TC++  F L RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + ++R         RR+  + ++++RE          A C +   V    ++       + P    D E                   NR   +K VD    ID  SR  FP  F+++N FYW
Sbjct:   69 SFGSVTETTMDYRVNIFLRQKWNDPRLAYSEYP-----DPSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKDGTVLYSIRLTLILSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLDEGPVQVAEGLTLPQFIMREEKELGYCTKHY--NTGKFTCIEVKFKLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAGVNFVSRQQKEFLRLKRRQKRNLKEELREGRFHFSGYSMAPCMKDGTVVKSATA----NAIQQPSALRDAE------------------HNR---KKFVDRAKRIDTISRAAFPLAFLIFNIFYW 424          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Cavefish
Match: glra3 (glycine receptor, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-020402-1])

HSP 1 Score: 195.282 bits (495), Expect = 1.855e-55
Identity = 111/273 (40.66%), Postives = 178/273 (65.20%), Query Frame = 3
Query:  507 AINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS-SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRK 1322
            +  S+    M+Y  ++ LRQ+W D RL +  +P     + S+   P++ + +W PDLFF N K  + H +T  N L+R+  NG +LYS ++T+  SC M+L  FPMD Q CIM + S+GYT++ L F W+   P+ +A  + +P+F    +     C+K    +TG +TC++  FHL RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + ++R+ K
Sbjct:   79 SFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGAHFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQANGPVQVADGLTLPQFILKDESDLRYCTKHY--NTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRTSLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHK 344          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Sea Lamprey
Match: glra2 (glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-090407-1])

HSP 1 Score: 199.904 bits (507), Expect = 1.623e-58
Identity = 131/382 (34.29%), Postives = 215/382 (56.28%), Query Frame = 3
Query:  507 AINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS-SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKSEDWQKQVREIVRQELARWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDL---EILLCPDTXXXXXXXXXXXXNRSKPQKSVD--SEIDCYSRFLFPACFVLYNCFYW 1634
            +  S+    M+Y  ++ LRQ+W D RL +  +P     + S+   P++ + +W PDLFF N K    H +T  N L+R+  +G +LYS ++T+  SC M+L  FPMD Q C M + S+GYT++ L F W+++  + +A  + +P+F    +     C+K    +TG +TC++  FHL RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + ++R+ K     ++ R+  + +L     +C         NSS+     F+   G E     + +                   +  +K VD    ID  SR  FP  F+++N FYW
Sbjct:   16 SFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKDGNVLYSIRLTLTLSCPMDLKNFPMDVQTCAMQLESFGYTMNDLIFEWKQEGAVQVAEGLTLPQFVLKDEKDLVYCTKH--YNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKELLRIRRRRQRNQIDLTSLILIC--NIFTYFINSSVPIFNMFKRVEGNERALTKDSVSVKGVNATNAAPAPAPTQDAIKKKFVDRAKRIDTISRAAFPLAFLIFNIFYW 388          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Sea Lamprey
Match: glra1 (glycine receptor, alpha 1 [Source:NCBI gene;Acc:30676])

HSP 1 Score: 195.667 bits (496), Expect = 2.412e-58
Identity = 98/250 (39.20%), Postives = 157/250 (62.80%), Query Frame = 3
Query:  489 VYMRVLAINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSISSPALK------EKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVS 1220
            VY++  +  S++   M+Y   + LRQ+W+D RLT+  +P           P L       + +W PDLFF N K  Y H +T  N ++R+  NG++L++ ++T+  SC M+L  FPMD+Q C M + S+GYT+  L F W E+EP+II+  + +P+F  S+   T  C K   + TG+++C+ A F L R++G YL   Y+P+ LIV++SW++FW+++EA PAR+ LG+ T+L + TQ+TG   SLP+V+
Sbjct:   36 VYIK--SFGSIEETTMDYQVTIFLRQKWIDPRLTYSHYPE----------PYLDLDQSNIQYIWRPDLFFDNEKSAYFHEVTTDNKMLRIFKNGLVLFTVRLTLTLSCPMDLRNFPMDTQMCYMFLESFGYTMADLSFHWDEEEPVIISKELVLPQFVLSSKIDTDSCDKLYSSGTGHFSCISARFVLHREMGFYLIQLYVPSALIVIISWVSFWINMEAAPARVALGITTVLTMTTQSTGARASLPKVT 273          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008467.1 (pep scaffold:Pmarinus_7.0:GL477211:8305:20106:1 gene:ENSPMAG00000007648.1 transcript:ENSPMAT00000008467.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 185.652 bits (470), Expect = 1.898e-52
Identity = 133/409 (32.52%), Postives = 218/409 (53.30%), Query Frame = 3
Query:  435 ENYNLHERP---SEVKQTEVVVYMRVLAINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHP-RLASYNKSISSPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARR-----RKSEDWQKQVREIVRQELARWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEILLCPDTXXXXXXXXXXXXNRSKPQKSVDSEIDCYSRFLFPACFVLYNCFYW 1634
              YN   RP            V++R  +  S+     +Y   V LRQ W D RL +  +P  L   ++S       + +W PDLFF N K  + H +T  N ++R+ +NG++ Y+ ++T+  SC M+L  FPMD+Q C M + S+GYT   + F W    P+ +   + +P+F  S    T  C+K    STG++TC+ A F L R++G YL   Y+P++LIV++SW++FW+++EA PAR+ LG+ T+L + TQ+TG   SLP+VSYIKA+DIW+  C++FV  AL+E+A  ++ +R+     +K    QK +  +V +++  W  +  +     +  +  I       P+      +++C   ++        K    K   +    ID  SR  FP  F+++N  YW
Sbjct:   54 SGYNHRVRPNFGGPAVNVSCGVFIR--SFGSIQEATSDYRMTVYLRQRWTDPRLAYSHYPVPLLHLDQSNI-----KHIWKPDLFFDNEKSAHFHEITTDNKMLRIANNGVVDYAMRLTLTLSCPMDLHNFPMDTQMCSMYLESFGYTTADIVFHWNGPTPVSLFEGLTLPQFVLSNKISTGSCTKTY--STGSFTCIFAKFTLHREMGFYLIQLYVPSILIVILSWVSFWINMEAAPARVALGITTVLTLTTQSTGARASLPKVSYIKAMDIWMATCLLFVFAALLEYAAVNVTSRQSQGFMKKGRGNQKPIDLLVHKKMF-WKFLVAENDNDLLYFTITIFTLNGLLPVSDSKKPVIVC---IKPLLSLQETKEKMRKKYVACAQTIDNISRLFFPISFLIFNVVYW 449          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Sea Lamprey
Match: gabra6a (gamma-aminobutyric acid (GABA) A receptor, alpha 6a [Source:ZFIN;Acc:ZDB-GENE-040426-1692])

HSP 1 Score: 165.236 bits (417), Expect = 1.644e-44
Identity = 92/280 (32.86%), Postives = 155/280 (55.36%), Query Frame = 3
Query:  399 NVTREDILKIVFENYNLHERPS-EVKQTEVVVYMRVLAINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSISSPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFD----CSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSY 1223
            N+T+  IL  + + Y+   RP      TEV   + V +   V  ++M+Y+ DV  RQ W+D+RL +     +   N       +  ++W PD +FRNGKK   H+MT PN L R+  NG +LY+ ++T+   C M L  FPMD   C +  GSY Y   ++ + W +       +++++P+ + S   Y        S+E  +  G+Y  +  SF+L+R++G ++  TYIP ++ V++S ++FW++ E++PAR   G+ T+L + TQ+     SLP+VSY
Sbjct:   44 NITK--ILDRLLDGYDNRLRPGFGGPVTEVKTDIYVTSFGPVSDVEMDYTMDVFFRQTWVDERLKFDGPIEILRLNN-----LMVNRIWTPDTYFRNGKKSIAHNMTAPNKLFRIMQNGTVLYTMRLTINAECPMRLMDFPMDGHTCPLKFGSYAYPKSEIIYSWTKGA----NNSVEVPQESSSLLQYDLTGHNVSSEELKSKIGDYVVMTVSFYLKRKMGYFIVQTYIPCIMTVILSQVSFWINKESVPARTVFGITTVLTMTTQSISARGSLPKVSY 312          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Sea Lamprey
Match: glra4a (glycine receptor, alpha 4a [Source:ZFIN;Acc:ZDB-GENE-010410-3])

HSP 1 Score: 162.54 bits (410), Expect = 3.595e-44
Identity = 141/439 (32.12%), Postives = 213/439 (48.52%), Query Frame = 3
Query:  384 YFSENNVTREDILKIVFENYNLHERPSEVKQTEVVVYMRVL--AINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS--------SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGM---ILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKSEDWQKQVREIVRQELA-RWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEILLCPDTXXXXXXXXXXXXNR---SKPQKSVDS-----EIDCYSRFLFPACFVLYNCFYW 1634
            + S +NV R+         Y+   RP+ V    VVV   +L      V+   M+YS ++ LRQ W D        PR+ +  KSI           +  + VW PDLFF N K        L      + +  M        ++++  +C M+L  +PMD+Q C + + SYGYT + L F W + EP+   + +  P+F  S + +  +C+KE   + G ++C+KA+F L R +G YL   YIP+ L+V++SWL+FW++VEA PAR+ LG+ T+L + TQ T  + +LP+VSYIKAID+W+ AC +FV  AL+EFA  +M  RR              + EL   W       +  +  N S + R Q   P    D      P       ++      R   S  +    S      ID  SR +FP  F+++N FYW
Sbjct:   44 FLSMDNVIRD-------TGYDSRMRPN-VDGPPVVVNCSILVKGFGPVEEATMDYSINIFLRQTWND--------PRILNVLKSIEYNTDFLDLGNSFVDSVWKPDLFFENEKSAAFQMYQLVTGFKYMYTFAMWITCFLCFRLSLVLACPMSLEVYPMDAQYCSIYLESYGYTTNDLIFQWNDTEPVSFGAGVSTPKFTLSNETFLGECTKEY--TYGTFSCVKATFFLDRDMGYYLIQVYIPSCLLVIISWLSFWLNVEAAPARVGLGITTILTVTTQMTSANAALPKVSYIKAIDVWMGACQVFVFSALLEFAAVNMATRRHGISPSHHDGDHGTKGELPIEW-------KRHRHANVSSVRRPQRHRP--ERDCRSQGKPGVFHTNSRRDENNATRVHVSDEEWRYQSLLHARRIDYISRVIFPTVFMIFNIFYW 455          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Nematostella
Match: EDO35410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK4])

HSP 1 Score: 156.762 bits (395), Expect = 4.572e-43
Identity = 92/278 (33.09%), Postives = 158/278 (56.83%), Query Frame = 3
Query:  417 ILKIVFENYNLHERPSEVKQTEVVVY--MRVLAINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSISSPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREK----EPIIIASNIQIPEFNPSTDPYTFDCSKEAGT---STGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSY 1223
            +LK + E Y+   RP   K   VVVY  M V  I ++  + M+++ D+ LRQ W D+RL +      A    S     + +++W+P  +F   KK Y H +T  NYL+++  +G + YS ++T+  SC+++L  FP D+Q C + + SYGY    + ++W E+      I I  ++++P+F           S+ A     + GN++ L A+F ++R++G +L  TYIP+ +IV++SW++FW+  E  PAR+ LG+ T+L + T  +    +LP+VSY
Sbjct:   25 VLKNLLEGYDRRIRPGS-KGEPVVVYVDMYVSNIWAMQEMNMDFTIDIYLRQYWRDERLQFETQTPGAMLTLS---SDINKQIWVPSTYFLATKKAYFHDVTTDNYLLQVKPDGSLFYSIRLTITTSCRLDLRDFPHDTQSCSLSLESYGYQSTDVLYVWNERLDNTSAIYIHDDLELPQFE------VLGVSRSAKMNKYNIGNHSSLVANFRMKRRIGYFLIDTYIPSTIIVIISWISFWIDPETAPARVALGITTVLTMTTLISSARANLPKVSY 292          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Nematostella
Match: EDO39173 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAS4])

HSP 1 Score: 146.747 bits (369), Expect = 8.495e-40
Identity = 89/247 (36.03%), Postives = 142/247 (57.49%), Query Frame = 3
Query:  483 VVVYMRVLAINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSISSPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSY 1223
            + VYM V++ ++V    ME+S DV  +Q W D RL   RH     +   I   + KEK W+PD FF N K    H +   N  + +  +G I  S+++T+  SC+M+L  +P+D Q C+++I SY + ++ + + W+ KE +II    ++ EF         +  +++ + TG YT L A F  RR+L       Y P  LIV++SWL+FW+S +A+PAR+ LG+ T+L I+T    + NS+P+VSY
Sbjct:   31 ISVYMSVVSFSTVYEKDMEFSLDVFFKQAWRDPRL---RHSAKMPF---ILPGSQKEKFWIPDTFFLNVKTARFHQVPAANTRIVVTPDGDIELSERLTVSASCRMDLRMYPLDQQTCVLEILSYSFDINDIDYRWKAKEDLIILDG-EMNEFELKDS--RGERKQKSRSCTGTYTHLVAKFVFRRRLAYSFIQIYSPTFLIVVLSWLSFWISKDAVPARVALGITTVLTIVTLMGSLRNSVPKVSY 268          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Nematostella
Match: EDO37555 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFG6])

HSP 1 Score: 149.058 bits (375), Expect = 2.469e-39
Identity = 94/274 (34.31%), Postives = 153/274 (55.84%), Query Frame = 3
Query:  417 ILKIVFENYNLHERPS-EVKQTEVVVYMRVLAINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSISSPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQI---PEFNPSTDPYTFDCSKEAGT-STGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSY 1223
            +L  + + Y+   RP        V V   VL+I++++V+ M+Y  D  LRQ W D RL       LA  N       + +K+W+PD +F N K    HS+T  N ++ ++ +G++ Y+ ++T++ SC MNL  FP D Q C +DI SYGY+ D +++ W  +    IA N +I   P++N S      + S+       GN++ L A+F  RR+ G ++   Y P  LIV++SW++F +  E+  ARI LG+ ++L I T    ++NS+P+VSY
Sbjct:    9 LLDNLIQGYDPRLRPDFGGDPVTVTVGFWVLSIDAINVIDMDYRMDFFLRQLWRDPRLKHRFDDTLALSN------TMLDKIWVPDTYFVNSKMSKFHSVTTINKMLSISPDGLVHYNSRVTVKASCAMNLRMFPKDVQNCNIDIESYGYSADNVQYQWENRSDNGIAVNKKIRDMPQYNLS----DINVSRHFTMYVAGNWSGLTATFRFRRRSGYFIIHIYAPCALIVILSWISFCIPPESTAARIALGITSVLTITTILNMLNNSMPKVSY 272          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Nematostella
Match: EDO30047 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1W8])

HSP 1 Score: 143.665 bits (361), Expect = 1.303e-38
Identity = 89/269 (33.09%), Postives = 152/269 (56.51%), Query Frame = 3
Query:  435 ENYNLHERPS-EVKQTEVVVYMRVLAINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSISSPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKE----PIIIASNIQIPEFN-PSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSY 1223
            E Y+   RP+       V V   VL+I++++V+ M+Y+ D+ LRQ W+D+RL+   +  +   N       + +K+WLPD +F N K+G  H +T  N ++ +  +G + Y+ ++T+R SC MNL  FPMD+Q C + + SYGY+ D + F W  ++      +  S   +P++     +P +  C        GN++ +KA F   R    ++   Y P  LIV+VSW++F +  E  PARITLG+ ++L ++T    ++NS+P+V+Y
Sbjct:   12 EKYDKRLRPNYGAGPVIVTVGFWVLSIDTINVVDMDYTLDIFLRQSWVDERLSHDLNTTMFLSN------TVMDKIWLPDSYFVNAKQGSFHKVTKDNMMVMIQPDGQVQYNARVTIRASCPMNLRKFPMDTQHCPLTLESYGYSSDHIVFKWEIEDGDGLGFVPESLKMLPQYKLAPNEPRSELCF----VIPGNWSGIKALFTFERMYSYFVIHVYGPCALIVVVSWVSFLLPKEQAPARITLGVTSVLTVVTILNMLNNSMPKVNY 270          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Nematostella
Match: EDO40478 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S763])

HSP 1 Score: 140.584 bits (353), Expect = 1.097e-37
Identity = 91/258 (35.27%), Postives = 140/258 (54.26%), Query Frame = 3
Query:  468 VKQTEVVVY--MRVLAINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSISSPA-LKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLW---REKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSY 1223
            V    V+VY  M VL I  +    ME+      RQ W D RL +        YNK ++  A + + +W+PD++F N K G  H +T  N ++R+  +G + +S +++M  SC M L ++PMD Q C +   S+ Y   +L F W   R  + + ++  +QIP+F  +    T   S+ A  +TG+Y+ L   F   R +G +L  TYIP  LIVM+SW+ FW++  + PARI LG+ T+L + T       SLP+VSY
Sbjct:    1 VSGDPVIVYTDMFVLDIGDISEADMEFRVMFFYRQYWQDTRLAYD----YTGYNKRLALNARMVDYMWIPDIYFVNEKSGIKHDLTKQNEVVRVWPDGRVFHSIRLSMTASCPMKLHSYPMDKQTCKLSFESFSYPSTELIFKWNKNRGNKEVQVSDELQIPQFILTEYKTT---SEFANFTTGSYSRLTVLFRFERSIGFFLIQTYIPAYLIVMLSWIAFWINHTSTPARIGLGITTVLTMTTLTNSARASLPKVSY 251          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Medaka
Match: ENSORLT00000025211.2 (glycine receptor subunit alpha-3 [Source:NCBI gene;Acc:101174559])

HSP 1 Score: 204.527 bits (519), Expect = 7.816e-59
Identity = 129/382 (33.77%), Postives = 217/382 (56.81%), Query Frame = 3
Query:  507 AINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS-SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKSEDWQKQVREIVRQELARWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEILLCPDTXXXXXXXXXXXXNRSKPQKS---VD--SEIDCYSRFLFPACFVLYNCFYW 1634
            +  S+    M+Y  ++ LRQ+W D RL +  +P     + S+   P++ + +W PDLFF N K  + H +T  N L+R+  NG +LYS ++T+  SC M+L  FPMD Q CIM + S+GYT++ L F W+E  P+ +A  + +P+F    +     C+K    +TG +TC++  FHL RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + ++R+ K     ++ +   ++E+             ++ +++++  T   +      +   + P               RS  +     +D   +ID  SR  FP  F+ +N FYW
Sbjct:   72 SFGSIAETTMDYRVNIFLRQQWNDPRLAYAEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGAHFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFQWQENGPVQVAEGLTLPQFILKDESDLRYCTKH--YNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRTSLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRHKSKTKEEVGE----------SKLTSTAVMTSTPSISKDSKASVNNAVAPAANTTQNAPAAGGGGRSTEEMRKLFIDRAKKIDTVSRAGFPLAFLFFNIFYW 436          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Medaka
Match: glra4a (glycine receptor subunit alpha-4-like [Source:NCBI gene;Acc:101156095])

HSP 1 Score: 201.06 bits (510), Expect = 1.556e-57
Identity = 136/384 (35.42%), Postives = 214/384 (55.73%), Query Frame = 3
Query:  507 AINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSISSPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARR-------RKSEDWQKQVREIVRQELARWC-AVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEILLCPDTXXXXXXXXXXXXNRSKPQKSVDSEIDCYSRFLFPACFVLYNCFYW 1634
            +  S+    M+Y  +V LRQ W D RL +  +P     N     P++ + +W PDLFF N K    H +T  N L+R+  +G +LYS ++T+  SC M+L  FPMD Q C M + S+GYT++ L F W    P+ +A ++ +P+F    +     C+K    +TG +TC++  FHL RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + ++R+       RK +  Q+   E+VR+    +         L     + L   T F  P           P T+   +    + V+R+K        ID  SR +FP  F+++N FYW
Sbjct:   80 SFGSITETTMDYRLNVFLRQNWNDPRLAYSEYPD----NSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFQDGSVLYSIRLTLILSCPMDLKNFPMDIQTCTMQLESFGYTMNDLIFEWLSDNPVQVADDLTLPQFVLKEEKDLGYCTKHY--NTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFIRLRKKQRQQRIEEELVRESRGFYFRGYGLGHCLQTKDGAPLEGATVFSPP----------PPMTMYDGEVFSKRFVDRAK-------RIDTISRAVFPLSFLIFNIFYW 440          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Medaka
Match: glra1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:101173557])

HSP 1 Score: 198.749 bits (504), Expect = 9.078e-57
Identity = 137/390 (35.13%), Postives = 214/390 (54.87%), Query Frame = 3
Query:  507 AINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS-SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRK------------SEDWQKQVR-EIVRQELARWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEILLCPDTXXXXXXXXXXXXNRSKPQKSVDSEIDCYSRFLFPACFVLYNCFYW 1634
            +  S+    M+Y  ++ LRQ+W D RL +  +P     + S+   P++ + +W PDLFF N K    H +T  N L+R++ NG +LYS +IT+  +C M+L  FPMD Q CIM + S+GYT++ L F W EK  + +A  + +P+F    +     C+K    +TG +TC++A FHL RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + IAR+ K             ED     R       +   C   +    ++  N++       E  I  E+++ L                  R+K        ID  SR  FP  F+++N FYW
Sbjct:   77 SFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLILACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYCTKH--YNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQHKELLRFRRRRRHMKEDETGDGRFGFPGYGMGPACLQAKDGMAIKGNNNNAPTSAAPEKSI--EEMKKLFI---------------GRAK-------RIDTVSRVAFPLVFLIFNIFYW 435          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Medaka
Match: glra1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:101173557])

HSP 1 Score: 197.593 bits (501), Expect = 1.744e-56
Identity = 119/297 (40.07%), Postives = 188/297 (63.30%), Query Frame = 3
Query:  438 NYNLHERPS-EVKQTEVVVYMRVLAINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS-SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRK 1322
             Y+   RP+ +     V   + + +  S+    M+Y  ++ LRQ+W D RL +  +P     + S+   P++ + +W PDLFF N K    H +T  N L+R++ NG +LYS +IT+  +C M+L  FPMD Q CIM + S+GYT++ L F W EK  + +A  + +P+F    +     C+K    +TG +TC++A FHL RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + IAR+ K
Sbjct:   40 GYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLILACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYCTKH--YNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQHK 329          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Medaka
Match: glra1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:101173557])

HSP 1 Score: 197.593 bits (501), Expect = 3.459e-56
Identity = 115/273 (42.12%), Postives = 179/273 (65.57%), Query Frame = 3
Query:  507 AINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSIS-SPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRK 1322
            +  S+    M+Y  ++ LRQ+W D RL +  +P     + S+   P++ + +W PDLFF N K    H +T  N L+R++ NG +LYS +IT+  +C M+L  FPMD Q CIM + S+GYT++ L F W EK  + +A  + +P+F    +     C+K    +TG +TC++A FHL RQ+G YL   YIP++LIV++SW++FW++++A PAR+ LG+ T+L + TQ++G   SLP+VSY+KAIDIW+  C++FV  AL+E+A  + IAR+ K
Sbjct:   92 SFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLILACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYCTKH--YNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQHK 357          
BLAST of Glycine receptor subunit alpha-3 vs. Planmine SMEST
Match: SMESG000061905.1 (SMESG000061905.1)

HSP 1 Score: 822.002 bits (2122), Expect = 0.000e+0
Identity = 457/457 (100.00%), Postives = 457/457 (100.00%), Query Frame = 3
Query:  264 MFSAGLSLQMDYIKKMLVTDLIFVIVLTSICNISAQNSTTYFSENNVTREDILKIVFENYNLHERPSEVKQTEVVVYMRVLAINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSISSPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKSEDWQKQVREIVRQELARWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEILLCPDTXXXXXXXXXXXXNRSKPQKSVDSEIDCYSRFLFPACFVLYNCFYW 1634
            MFSAGLSLQMDYIKKMLVTDLIFVIVLTSICNISAQNSTTYFSENNVTREDILKIVFENYNLHERPSEVKQTEVVVYMRVLAINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSISSPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARITLGLLTLLGILTQATGMSNSLPRVSYIKAIDIWIIACIIFVIGALIEFAMASMIARRRKSEDWQKQVREIVRQELARWCAVCQQQQLVQIQNSSLIDRTQFETPIGTEDLEILLCPDTVQKWKKKPVQKVNRSKPQKSVDSEIDCYSRFLFPACFVLYNCFYW
Sbjct:    1 MFSAGLSLQMDYIKKMLVTDLIFVIVLTSICNISAQNSTTYFSENNVTREDILKIVFENYNLHERPSEVKQTEVVVYMRVLAINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSISSPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARITLGLLTLLGILTQATGMSNSLPRVSYIKAIDIWIIACIIFVIGALIEFAMASMIARRRKSEDWQKQVREIVRQELARWCAVCQQQQLVQIQNSSLIDRTQFETPIGTEDLEILLCPDTVQKWKKKPVQKVNRSKPQKSVDSEIDCYSRFLFPACFVLYNCFYW 457          
BLAST of Glycine receptor subunit alpha-3 vs. Planmine SMEST
Match: SMESG000041885.1 (SMESG000041885.1)

HSP 1 Score: 458.759 bits (1179), Expect = 4.437e-157
Identity = 254/400 (63.50%), Postives = 314/400 (78.50%), Query Frame = 3
Query:  435 ENYNLHERPSEVKQTEVVVYMRVLAINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSISSPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKSEDWQKQVREIVRQELARWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEILLCPDTXXXXXXXXXXXXNRSKPQKSVDSEIDCYSRFLFPACFVLYNCFYW 1634
            + Y   ERPSE+ QT V+VYM+VLAINSV V KMEYSTDV LRQEW D RLTW       S+N +I SP+LK+ +WLPDLFFRNGK+GYVH MTLPNYLMRL  NG ILYSQKITMRFSC+MNL TFPMDSQEC+MDIGSYGYTLD+LKF WR+++PI+I++ +QI EFN      T DC+ ++ TSTG YTCLKA F L+RQLGSYL ST++P++LIVMVSWLNFW++V+++PAR+TLGL+TLLG+LTQATG+S++LPRVSYIKAID+W+IACI+FVIGAL+E+ +AS++AR++KS  W+K VREIVR ELARWC+ CQ+QQ   +Q  + +DR + E     E L I    D  +  K          K   + DS+ID YSRFLFPACF+LYNCFYW
Sbjct:   43 KRYKKDERPSEIYQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARVTLGLVTLLGMLTQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTI--------KTTPTEDSDIDSYSRFLFPACFLLYNCFYW 434          
BLAST of Glycine receptor subunit alpha-3 vs. Planmine SMEST
Match: SMESG000037124.1 (SMESG000037124.1)

HSP 1 Score: 457.603 bits (1176), Expect = 2.042e-156
Identity = 271/441 (61.45%), Postives = 328/441 (74.38%), Query Frame = 3
Query:  375 STTYFSEN-NVTREDILKIVFENYNLHERPSEVKQTEVVVYMRVLAINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSISSPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKSEDWQKQVREIVRQELARWCAVCXXXXXXXX----------XNSSLIDRTQFETPIGTED-----LEILLCPDTXXXXXXXXXXXXNRSKPQKS-----VDSEIDCYSRFLFPACFVLYNCFYW 1634
            STT+   + N  RE I   +F+ Y  +ERPSE KQT V VYM+VLAINSVDV+KMEYSTDV LRQEW+D+RL W    +  SYN ++ SP  KEK+WLPDLFFRNGK GYVHSMT PNYL+RL  NG +LYSQKITM+FSCQM+L TFPMD+QEC MDIGSYGYTLDQLKF WR  EP+I+   +QIPEFN  T+  T DCS+ + TSTG+YTC+KA+F L+RQLGSYLASTYIPNVLIVMVSWLNFWVS++A+PARITLGLLTLLGILTQATGMS +LPRVSYIKAID+WIIACI+FVIGALIEFA+ASMI+R+ KSE WQ+ V+ IV QEL +W  +  ++Q              + +S  +  Q  +   + +     LE+ L    + +       + + SKPQ S     +DSEID YS+FLFPA F+LYNCFYW
Sbjct:    2 STTFLGTSMNSDREQIQNHIFKGYKSNERPSENKQTIVTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNLVSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARITLGLLTLLGILTQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQ-LLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYW 441          
BLAST of Glycine receptor subunit alpha-3 vs. Planmine SMEST
Match: SMESG000032691.1 (SMESG000032691.1)

HSP 1 Score: 424.861 bits (1091), Expect = 6.742e-144
Identity = 251/449 (55.90%), Postives = 324/449 (72.16%), Query Frame = 3
Query:  300 IKKMLVTDLIFVIVLTSICNISAQNSTTYFSENNVTREDILKIVFENYNLHERPSEVKQTEVVVYMRVLAINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSISSPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKSEDWQKQVREIVRQELARWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEILLCPDTXXXXXXXXXXXXNRSKPQKSV----DSEIDCYSRFLFPACFVLYNCFYW 1634
            IK+      IF++ +   CN          S   +TRE I+  + +NY+L+ERP E  QT V+V+M+VLAINSV+V  MEYSTD+ LRQ W+D RL W        +N S+ SP+LK+++WLPDLFFRNGK+GYVH MT PNYLMRL  NG +LYSQKITMRFSCQM+L T+PMD+Q C M+IGSYGYTLDQLKF W +  P+ + +N+QIPEFN  T   T DC+  + T TG Y+CLKA F LRRQLGSYL ST+IPN LIV+VSWLNFWVSVEA+PARITLGLLTLLGILTQA+G+S +LPRVSYIKAID+W+IACI+FVIGAL+EFA+AS +A+++K   W+ +VR+IVRQEL+RW     +Q+   +Q S +++R + E     E+L+ILL             +  ++ K QK +    +S+ID YSR+LFP+CF+ YN  YW
Sbjct:    3 IKQQQSNIFIFLLAIHVGCNSC--------SVAGITRERIMDKILQNYSLNERPIESNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDARLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARITLGLLTLLGILTQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELEF---CEELDILLTAQ-QYANNYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYW 439          
BLAST of Glycine receptor subunit alpha-3 vs. Planmine SMEST
Match: SMESG000077704.1 (SMESG000077704.1)

HSP 1 Score: 403.675 bits (1036), Expect = 1.354e-135
Identity = 233/415 (56.14%), Postives = 303/415 (73.01%), Query Frame = 3
Query:  390 SENNVTREDILKIVFENYNLHERPSEVKQTEVVVYMRVLAINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSISSPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARXXXXXXXXXXXXXQATGMSNSLPRVSYXXXXXXXXXXXXXXXXXXXXEFAMASMIARRRKSEDWQKQVREIVRQELARWCAVCXXXXXXXXXNSSLIDRTQFETPIGTEDLEILLCPDTXXXXXXXXXXXXNRSKPQKSVDSEIDCYSRFLFPACFVLYNCFYW 1634
            SE    R  I   +F  Y   +RP E +QTEV VYM++LAINSV V +MEYSTDV LRQEW+D RL W+   +  SYN +I SP+LK+ +WLPDLFFRNGK+GYVH MTLPNYLMRL+ NG+ILYSQKITMRFSCQM+L TFPMD+Q C MDIGSYGYTLD+L+F WR  + I IA+ +QI EFN      T DC+K + TSTG Y+CLKA F L+RQLGSY+ ST++P++LIVMVSWLNFW+ V+++PAR+ LGL+TLLG+LTQA G+S++LPRVSYIKAIDIW+I CIIFVI AL+E+A+A+ +  R  S + + +V+ IV++EL  WC    + Q+  +Q  + +DR + +     E+L I    D+ +K          + +P +  +S +D YSRFLFPA F+ YNCFYW
Sbjct:   26 SEKADQRSLIRAEIFSKYLKEDRPKEEEQTEVTVYMKILAINSVSVTQMEYSTDVYLRQEWVDSRLAWNNLDKFKSYNANIVSPSLKKVLWLPDLFFRNGKEGYVHKMTLPNYLMRLSPNGLILYSQKITMRFSCQMDLKTFPMDTQICEMDIGSYGYTLDELRFNWRVNDSISIATGMQISEFNSPGKFTTRDCTKLSSTSTGQYSCLKAEFVLQRQLGSYIVSTFVPSILIVMVSWLNFWIHVDSVPARVMLGLVTLLGMLTQAIGISSTLPRVSYIKAIDIWVIWCIIFVICALLEYAVANSVVARNYSNNMENEVKLIVQRELMNWCTAFDRLQISHMQVHNSLDRDRLQFCHDLENLLIEKAIDSHKKVI--------KVRPPE--NSIVDVYSRFLFPALFLFYNCFYW 430          
The following BLAST results are available for this feature:
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GLRA31.108e-5735.06glycine receptor alpha 3 [Source:HGNC Symbol;Acc:H... [more]
GLRA11.207e-5634.36glycine receptor alpha 1 [Source:HGNC Symbol;Acc:H... [more]
GLRA23.377e-5634.13glycine receptor alpha 2 [Source:HGNC Symbol;Acc:H... [more]
GLRA15.237e-5641.03glycine receptor alpha 1 [Source:HGNC Symbol;Acc:H... [more]
GLRA21.153e-5533.85glycine receptor alpha 2 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glc-13.739e-5332.26Glutamate-gated chloride channel alpha [Source:Un... [more]
glc-13.739e-5332.26Glutamate-gated chloride channel alpha [Source:Un... [more]
glc-33.940e-5239.10Glutamate-gated ChLoride channel; Glutamate-gated ... [more]
avr-144.871e-5135.34pep chromosome:WBcel235:I:5968009:5973320:-1 gene:... [more]
avr-144.871e-5135.34pep chromosome:WBcel235:I:5967250:5973320:-1 gene:... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GluClalpha7.982e-5834.30gene:FBgn0024963 transcript:FBtr0343789[more]
GluClalpha5.422e-5733.78gene:FBgn0024963 transcript:FBtr0335420[more]
GluClalpha3.564e-5632.23gene:FBgn0024963 transcript:FBtr0343788[more]
GluClalpha3.941e-5634.38gene:FBgn0024963 transcript:FBtr0335418[more]
GluClalpha5.028e-5633.41gene:FBgn0024963 transcript:FBtr0335416[more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glra12.558e-5935.86glycine receptor, alpha 1 [Source:NCBI gene;Acc:30... [more]
glra13.538e-5935.86glycine receptor, alpha 1 [Source:NCBI gene;Acc:30... [more]
glra13.860e-5935.86glycine receptor, alpha 1 [Source:NCBI gene;Acc:30... [more]
glra31.136e-5735.60glycine receptor, alpha 3 [Source:ZFIN;Acc:ZDB-GEN... [more]
glra21.310e-5634.74glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GLRA39.886e-5733.92glycine receptor alpha 3 [Source:NCBI gene;Acc:100... [more]
GLRA31.272e-5633.92glycine receptor alpha 3 [Source:NCBI gene;Acc:100... [more]
GLRA17.805e-5637.09glycine receptor alpha 1 [Source:NCBI gene;Acc:100... [more]
GLRA12.251e-5537.31glycine receptor alpha 1 [Source:NCBI gene;Acc:100... [more]
GLRA12.572e-5536.87glycine receptor alpha 1 [Source:NCBI gene;Acc:100... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Glra12.046e-5742.05glycine receptor, alpha 1 subunit [Source:MGI Symb... [more]
Glra11.504e-5641.03glycine receptor, alpha 1 subunit [Source:MGI Symb... [more]
Glra11.789e-5641.03glycine receptor, alpha 1 subunit [Source:MGI Symb... [more]
Glra25.584e-5633.85glycine receptor, alpha 2 subunit [Source:MGI Symb... [more]
Glra41.011e-5535.46glycine receptor, alpha 4 subunit [Source:MGI Symb... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O93430|GLRA1_DANRE1.931e-5835.86Glycine receptor subunit alphaZ1 OS=Danio rerio OX... [more]
sp|Q64018|GLRA1_MOUSE1.251e-5541.03Glycine receptor subunit alpha-1 OS=Mus musculus O... [more]
sp|P07727|GLRA1_RAT1.291e-5541.03Glycine receptor subunit alpha-1 OS=Rattus norvegi... [more]
sp|P57695|GLRA1_BOVIN1.774e-5541.03Glycine receptor subunit alpha-1 OS=Bos taurus OX=... [more]
sp|P23415|GLRA1_HUMAN2.515e-5541.03Glycine receptor subunit alpha-1 OS=Homo sapiens O... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183LIM73.273e-13657.63Uncharacterized protein OS=Schistosoma margrebowie... [more]
A0A3S5FGS16.437e-13558.31Uncharacterized protein OS=Protopolystoma xenopodi... [more]
A0A183W0B47.604e-13557.38Uncharacterized protein OS=Trichobilharzia regenti... [more]
A0A0R3U2G62.413e-13454.35Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3EVT15.335e-13454.90Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glra15.157e-5935.22glycine receptor alpha 1 [Source:NCBI gene;Acc:103... [more]
glra36.068e-5934.39glycine receptor, alpha 3 [Source:ZFIN;Acc:ZDB-GEN... [more]
glra18.007e-5934.79glycine receptor alpha 1 [Source:NCBI gene;Acc:103... [more]
glra21.134e-5634.54glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
glra31.855e-5540.66glycine receptor, alpha 3 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glra21.623e-5834.29glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
glra12.412e-5839.20glycine receptor, alpha 1 [Source:NCBI gene;Acc:30... [more]
ENSPMAT00000008467.11.898e-5232.52pep scaffold:Pmarinus_7.0:GL477211:8305:20106:1 ge... [more]
gabra6a1.644e-4432.86gamma-aminobutyric acid (GABA) A receptor, alpha 6... [more]
glra4a3.595e-4432.12glycine receptor, alpha 4a [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO354104.572e-4333.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391738.495e-4036.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375552.469e-3934.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO300471.303e-3833.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404781.097e-3735.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000025211.27.816e-5933.77glycine receptor subunit alpha-3 [Source:NCBI gene... [more]
glra4a1.556e-5735.42glycine receptor subunit alpha-4-like [Source:NCBI... [more]
glra19.078e-5735.13glycine receptor alpha 1 [Source:NCBI gene;Acc:101... [more]
glra11.744e-5640.07glycine receptor alpha 1 [Source:NCBI gene;Acc:101... [more]
glra13.459e-5642.12glycine receptor alpha 1 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000061905.10.000e+0100.00SMESG000061905.1[more]
SMESG000041885.14.437e-15763.50SMESG000041885.1[more]
SMESG000037124.12.042e-15661.45SMESG000037124.1[more]
SMESG000032691.16.742e-14455.90SMESG000032691.1[more]
SMESG000077704.11.354e-13556.14SMESG000077704.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022769 ID=SMED30022769|Name=Glycine receptor subunit alpha-3|organism=Schmidtea mediterranea sexual|type=transcript|length=1835bp
GAAAGAGGGAGAGAGAGAGGAATTGAGTGAAAGTGTTTTCATATAAAATA
TTTAATTTCAAACACACAAATCCAAAAAACAAAGTTTATATGGAAAAAAT
TGTCTGTTTGTAGAAGTTTGAGGAAGAATAAATTTAAAGAGGTGTGCGAT
TTTCTTATCGTTTTTTTCTTATTAAGCATGGAATTTAAAGATTCTGTCTG
ATGCAATTTCTCTTAAATATTCTAAATTAGAAATTTATCATACCATGTGG
GAAATGTGATTCTATGTTCAGTGCTGGTTTATCTCTACAAATGGATTATA
TTAAAAAGATGCTCGTAACTGATCTGATTTTTGTGATAGTGTTGACAAGT
ATTTGCAATATCTCTGCACAGAATTCGACGACGTATTTTTCCGAGAACAA
TGTCACTAGAGAGGACATTCTCAAGATTGTTTTTGAAAATTATAATTTAC
ACGAAAGACCTTCGGAAGTTAAGCAAACAGAAGTTGTTGTCTATATGCGT
GTTCTAGCAATTAATTCTGTTGATGTTTTAAAGATGGAGTATTCGACTGA
TGTGTTATTACGGCAAGAATGGCTTGATGATCGACTAACTTGGCACAGAC
ATCCACGATTGGCCTCGTACAATAAAAGTATAAGTTCTCCTGCACTCAAA
GAAAAAGTTTGGTTGCCGGATTTATTCTTCCGCAATGGTAAAAAAGGCTA
TGTTCATTCCATGACACTTCCTAATTATTTGATGAGACTTAATTCGAATG
GAATGATACTCTACAGCCAAAAAATCACGATGCGATTTTCATGCCAAATG
AATTTATCTACTTTCCCCATGGACAGTCAGGAATGCATAATGGATATAGG
CAGTTATGGTTATACCTTAGATCAATTAAAATTTCTATGGCGAGAAAAAG
AACCTATTATTATTGCAAGCAATATTCAAATCCCGGAATTTAATCCGTCT
ACAGATCCGTATACGTTTGATTGTTCAAAAGAAGCTGGTACATCGACAGG
GAATTACACTTGTTTAAAAGCTAGTTTCCATCTCAGAAGACAGCTGGGCT
CATATTTAGCTAGTACTTATATTCCTAACGTTCTGATTGTTATGGTGTCT
TGGCTTAATTTTTGGGTCAGTGTTGAAGCCATTCCAGCTCGAATAACATT
GGGATTATTGACATTGCTGGGTATTTTAACCCAAGCCACCGGAATGTCTA
ATTCGTTACCGAGGGTTAGTTACATAAAAGCCATAGATATATGGATAATT
GCATGCATAATATTTGTGATTGGAGCTTTGATTGAATTTGCAATGGCTAG
CATGATTGCCAGGCGTAGAAAAAGTGAAGACTGGCAAAAACAGGTTCGAG
AAATTGTAAGGCAAGAACTTGCTCGTTGGTGTGCAGTGTGCCAGCAGCAA
CAGCTGGTTCAGATTCAAAATTCATCTTTAATTGACCGCACACAGTTTGA
AACTCCTATTGGAACAGAAGATCTTGAGATATTGCTCTGTCCAGATACAG
TGCAAAAATGGAAAAAGAAACCAGTACAAAAAGTAAATCGCTCAAAGCCT
CAGAAATCTGTTGATTCTGAAATCGACTGCTATAGCCGATTTTTATTTCC
AGCTTGTTTTGTTTTATACAATTGCTTCTATTGGTTGTACTACTTGGTTC
TGGTACATCATAATTAGCTTAGGAAGCCCATAGATTTATGTAGAATTTTA
CTGTGTTATTTCTTTTAATTACATGTATTTTAGTGATACAACATTTTTTT
GTTTTTTAATTTGAAAGACTAGAGAACGTTTATTTTTATGTATTAGATGA
TTTTTCCTTCAAAAATACAGCTAAAAATAATCCTC
back to top

protein sequence of SMED30022769-orf-1

>SMED30022769-orf-1 ID=SMED30022769-orf-1|Name=SMED30022769-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=468bp
MFSAGLSLQMDYIKKMLVTDLIFVIVLTSICNISAQNSTTYFSENNVTRE
DILKIVFENYNLHERPSEVKQTEVVVYMRVLAINSVDVLKMEYSTDVLLR
QEWLDDRLTWHRHPRLASYNKSISSPALKEKVWLPDLFFRNGKKGYVHSM
TLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGY
TLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTC
LKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARITLGLLT
LLGILTQATGMSNSLPRVSYIKAIDIWIIACIIFVIGALIEFAMASMIAR
RRKSEDWQKQVREIVRQELARWCAVCQQQQLVQIQNSSLIDRTQFETPIG
TEDLEILLCPDTVQKWKKKPVQKVNRSKPQKSVDSEIDCYSRFLFPACFV
LYNCFYWLYYLVLVHHN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0005216ion channel activity
GO:0005230extracellular ligand-gated ion channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000035Category 3 cell
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036734Neur_chan_lig-bd_sf
IPR036719Neuro-gated_channel_TM_sf
IPR006201Neur_channel
IPR006028GABAA/Glycine_rcpt
IPR006029Neurotrans-gated_channel_TM
IPR006202Neur_chan_lig-bd
IPR018000Neurotransmitter_ion_chnl_CS
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
GO:0005886plasma membrane
GO:0030054cell junction
GO:0045202synapse
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0006810transport
GO:0034220ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006201Neurotransmitter-gated ion-channelPRINTSPR00252NRIONCHANNELcoord: 131..142
score: 46.68
coord: 177..191
score: 47.9
coord: 94..110
score: 40.88
coord: 255..267
score: 31.74
IPR006201Neurotransmitter-gated ion-channelTIGRFAMTIGR00860TIGR00860coord: 20..460
e-value: 3.7E-99
score: 330.5
IPR006201Neurotransmitter-gated ion-channelPANTHERPTHR18945NEUROTRANSMITTER GATED ION CHANNELcoord: 46..459
IPR006028Gamma-aminobutyric acid A receptor/Glycine receptor alphaPRINTSPR00253GABAARECEPTRcoord: 440..460
score: 47.11
coord: 290..311
score: 38.78
coord: 264..284
score: 45.17
coord: 324..345
score: 41.79
IPR006202Neurotransmitter-gated ion-channel ligand-binding domainPFAMPF02931Neur_chan_LBDcoord: 50..260
e-value: 2.4E-43
score: 148.1
IPR006029Neurotransmitter-gated ion-channel transmembrane domainPFAMPF02932Neur_chan_membcoord: 268..394
e-value: 8.2E-24
score: 85.0
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilyGENE3DG3DSA:2.70.170.10coord: 40..258
e-value: 1.9E-62
score: 212.3
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilySUPERFAMILYSSF63712Nicotinic receptor ligand binding domain-likecoord: 50..260
NoneNo IPR availablePANTHERPTHR18945:SF835GAMMA-AMINOBUTYRIC ACID RECEPTOR ALPHA-LIKEcoord: 46..459
NoneNo IPR availableCDDcd18987LGIC_ECD_anioncoord: 72..260
e-value: 1.00032E-66
score: 210.228
NoneNo IPR availableCDDcd19049LGIC_TM_anioncoord: 264..457
e-value: 6.13498E-19
score: 80.1887
NoneNo IPR availableTMHMMTMhelixcoord: 443..465
NoneNo IPR availableTMHMMTMhelixcoord: 294..311
NoneNo IPR availableTMHMMTMhelixcoord: 326..348
NoneNo IPR availableTMHMMTMhelixcoord: 265..287
IPR018000Neurotransmitter-gated ion-channel, conserved sitePROSITEPS00236NEUROTR_ION_CHANNELcoord: 177..191
IPR036719Neurotransmitter-gated ion-channel transmembrane domain superfamilySUPERFAMILYSSF90112Neurotransmitter-gated ion-channel transmembrane porecoord: 264..465