Serine/threonine kinase

Overview
NameSerine/threonine kinase
Smed IDSMED30022758
Length (bp)2017
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine kinase (SMED30022758) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine kinase (SMED30022758) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine kinase (SMED30022758) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine kinase (SMED30022758) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022758

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30022758SMESG000010489.1 dd_Smed_v4_1953_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022758SMESG000010489.1 dd_Smed_v4_1953_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: STK25 (serine/threonine kinase 25 [Source:HGNC Symbol;Acc:HGNC:11404])

HSP 1 Score: 418.698 bits (1075), Expect = 1.832e-140
Identity = 222/286 (77.62%), Postives = 252/286 (88.11%), Query Frame = 1
Query:  139 NIRSNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKK-AKKTAYLQELIDRYQKWKAEA 993
            N  S VDPE ++  L+RIGKGSFGEV+KG++   K +VAIKIIDLEEAEDEIEDIQQEI VLSQCDSPY+T+YFGSYLK TKLWIIMEYLGGGSA+DL+KPGPL ETYIA ILREILKGLDYLHS++K+HRDIKAANVLLSE GDVKLADFGVAGQLT+T  KR TFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPP+S+LHPMRVLFLIPKN  P L+G  SK F++FV+ CLNK+P  RP+A+ELL H FI +  KKT++L ELIDRY++WK+E 
Sbjct:    9 NQHSRVDPEELFTKLDRIGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYITRYFGSYLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNSPPTLEGQHSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTSFLTELIDRYKRWKSEG 294          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: STK25 (serine/threonine kinase 25 [Source:HGNC Symbol;Acc:HGNC:11404])

HSP 1 Score: 418.698 bits (1075), Expect = 1.832e-140
Identity = 222/286 (77.62%), Postives = 252/286 (88.11%), Query Frame = 1
Query:  139 NIRSNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKK-AKKTAYLQELIDRYQKWKAEA 993
            N  S VDPE ++  L+RIGKGSFGEV+KG++   K +VAIKIIDLEEAEDEIEDIQQEI VLSQCDSPY+T+YFGSYLK TKLWIIMEYLGGGSA+DL+KPGPL ETYIA ILREILKGLDYLHS++K+HRDIKAANVLLSE GDVKLADFGVAGQLT+T  KR TFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPP+S+LHPMRVLFLIPKN  P L+G  SK F++FV+ CLNK+P  RP+A+ELL H FI +  KKT++L ELIDRY++WK+E 
Sbjct:    9 NQHSRVDPEELFTKLDRIGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYITRYFGSYLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNSPPTLEGQHSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTSFLTELIDRYKRWKSEG 294          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: STK25 (serine/threonine kinase 25 [Source:HGNC Symbol;Acc:HGNC:11404])

HSP 1 Score: 418.698 bits (1075), Expect = 1.832e-140
Identity = 222/286 (77.62%), Postives = 252/286 (88.11%), Query Frame = 1
Query:  139 NIRSNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKK-AKKTAYLQELIDRYQKWKAEA 993
            N  S VDPE ++  L+RIGKGSFGEV+KG++   K +VAIKIIDLEEAEDEIEDIQQEI VLSQCDSPY+T+YFGSYLK TKLWIIMEYLGGGSA+DL+KPGPL ETYIA ILREILKGLDYLHS++K+HRDIKAANVLLSE GDVKLADFGVAGQLT+T  KR TFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPP+S+LHPMRVLFLIPKN  P L+G  SK F++FV+ CLNK+P  RP+A+ELL H FI +  KKT++L ELIDRY++WK+E 
Sbjct:    9 NQHSRVDPEELFTKLDRIGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYITRYFGSYLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNSPPTLEGQHSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTSFLTELIDRYKRWKSEG 294          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: STK24 (serine/threonine kinase 24 [Source:HGNC Symbol;Acc:HGNC:11403])

HSP 1 Score: 409.453 bits (1051), Expect = 1.287e-136
Identity = 220/290 (75.86%), Postives = 255/290 (87.93%), Query Frame = 1
Query:  124 PDRNMNIRSNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFI-KKAKKTAYLQELIDRYQKWKAE 990
            P  + N+++  DPE ++  LE+IGKGSFGEV KG++   + +VAIKIIDLEEAEDEIEDIQQEI VLSQCDSPYVTKY+GSYLK TKLWIIMEYLGGGSA+DL++PGPL+ET IA ILREILKGLDYLHS+KK+HRDIKAANVLLSE+G+VKLADFGVAGQLT+T  KR TFVGTPFWMAPEVIKQSAYD KADIWSLGITAIELA+GEPPHS LHPM+VLFLIPKN  P L+G++SK  ++FV+ CLNKEP  RP+A+ELL H FI + AKKT+YL ELIDRY++WKAE
Sbjct:   22 PGGSTNLKA--DPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAE 309          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: STK24 (serine/threonine kinase 24 [Source:HGNC Symbol;Acc:HGNC:11403])

HSP 1 Score: 408.683 bits (1049), Expect = 1.799e-136
Identity = 218/280 (77.86%), Postives = 249/280 (88.93%), Query Frame = 1
Query:  154 VDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFI-KKAKKTAYLQELIDRYQKWKAE 990
             DPE ++  LE+IGKGSFGEV KG++   + +VAIKIIDLEEAEDEIEDIQQEI VLSQCDSPYVTKY+GSYLK TKLWIIMEYLGGGSA+DL++PGPL+ET IA ILREILKGLDYLHS+KK+HRDIKAANVLLSE+G+VKLADFGVAGQLT+T  KR TFVGTPFWMAPEVIKQSAYD KADIWSLGITAIELA+GEPPHS LHPM+VLFLIPKN  P L+G++SK  ++FV+ CLNKEP  RP+A+ELL H FI + AKKT+YL ELIDRY++WKAE
Sbjct:   18 ADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAE 297          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 388.652 bits (997), Expect = 1.798e-126
Identity = 203/280 (72.50%), Postives = 245/280 (87.50%), Query Frame = 1
Query:  148 SNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGS-FSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKKAKKTAYLQELIDRYQKWK 984
            S +DPE ++   ERIG+GSFGEV+KG++     +VAIKIIDLE+AEDEIEDIQQEI VLSQCDS YVTKYFGS+LK +KLWIIMEYLGGGSA+DL K G L+E++IA+ILREILKGL+YLHS++K+HRDIKAANVL+SE+GDVK+ADFGVAGQLT T  KR+TFVG+PFWMAPE+IKQS+YD+KADIWSLGITAIELA GEPPHS+LHPMRVLFLIPKNP P L GS +SK F++FV+ CLNK+P+NRPSA  LL H FIK+AKK + L +LI+R  +++
Sbjct:    6 SKLDPEVIFTKQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLEQAEDEIEDIQQEIQVLSQCDSQYVTKYFGSFLKGSKLWIIMEYLGGGSALDLTKSGKLDESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLTETVKKRITFVGSPFWMAPELIKQSSYDYKADIWSLGITAIELANGEPPHSDLHPMRVLFLIPKNPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQFIKRAKKNSILVDLIERAAEYR 285          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 386.726 bits (992), Expect = 1.115e-125
Identity = 202/278 (72.66%), Postives = 244/278 (87.77%), Query Frame = 1
Query:  154 VDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGS-FSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKKAKKTAYLQELIDRYQKWK 984
            +DPE ++   ERIG+GSFGEV+KG++     +VAIKIIDLE+AEDEIEDIQQEI VLSQCDS YVTKYFGS+LK +KLWIIMEYLGGGSA+DL K G L+E++IA+ILREILKGL+YLHS++K+HRDIKAANVL+SE+GDVK+ADFGVAGQLT T  KR+TFVG+PFWMAPE+IKQS+YD+KADIWSLGITAIELA GEPPHS+LHPMRVLFLIPKNP P L GS +SK F++FV+ CLNK+P+NRPSA  LL H FIK+AKK + L +LI+R  +++
Sbjct:   13 LDPEVIFTKQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLEQAEDEIEDIQQEIQVLSQCDSQYVTKYFGSFLKGSKLWIIMEYLGGGSALDLTKSGKLDESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLTETVKKRITFVGSPFWMAPELIKQSSYDYKADIWSLGITAIELANGEPPHSDLHPMRVLFLIPKNPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQFIKRAKKNSILVDLIERAAEYR 290          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 387.111 bits (993), Expect = 1.490e-125
Identity = 202/278 (72.66%), Postives = 244/278 (87.77%), Query Frame = 1
Query:  154 VDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGS-FSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKKAKKTAYLQELIDRYQKWK 984
            +DPE ++   ERIG+GSFGEV+KG++     +VAIKIIDLE+AEDEIEDIQQEI VLSQCDS YVTKYFGS+LK +KLWIIMEYLGGGSA+DL K G L+E++IA+ILREILKGL+YLHS++K+HRDIKAANVL+SE+GDVK+ADFGVAGQLT T  KR+TFVG+PFWMAPE+IKQS+YD+KADIWSLGITAIELA GEPPHS+LHPMRVLFLIPKNP P L GS +SK F++FV+ CLNK+P+NRPSA  LL H FIK+AKK + L +LI+R  +++
Sbjct:   28 LDPEVIFTKQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLEQAEDEIEDIQQEIQVLSQCDSQYVTKYFGSFLKGSKLWIIMEYLGGGSALDLTKSGKLDESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLTETVKKRITFVGSPFWMAPELIKQSSYDYKADIWSLGITAIELANGEPPHSDLHPMRVLFLIPKNPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQFIKRAKKNSILVDLIERAAEYR 305          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 387.882 bits (995), Expect = 3.482e-124
Identity = 203/280 (72.50%), Postives = 245/280 (87.50%), Query Frame = 1
Query:  148 SNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGS-FSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKKAKKTAYLQELIDRYQKWK 984
            S +DPE ++   ERIG+GSFGEV+KG++     +VAIKIIDLE+AEDEIEDIQQEI VLSQCDS YVTKYFGS+LK +KLWIIMEYLGGGSA+DL K G L+E++IA+ILREILKGL+YLHS++K+HRDIKAANVL+SE+GDVK+ADFGVAGQLT T  KR+TFVG+PFWMAPE+IKQS+YD+KADIWSLGITAIELA GEPPHS+LHPMRVLFLIPKNP P L GS +SK F++FV+ CLNK+P+NRPSA  LL H FIK+AKK + L +LI+R  +++
Sbjct:  176 SKLDPEVIFTKQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLEQAEDEIEDIQQEIQVLSQCDSQYVTKYFGSFLKGSKLWIIMEYLGGGSALDLTKSGKLDESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLTETVKKRITFVGSPFWMAPELIKQSSYDYKADIWSLGITAIELANGEPPHSDLHPMRVLFLIPKNPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQFIKRAKKNSILVDLIERAAEYR 455          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 337.806 bits (865), Expect = 7.733e-107
Identity = 189/281 (67.26%), Postives = 230/281 (81.85%), Query Frame = 1
Query:  148 SNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLS-ENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGS-FSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKKAKKTAYLQELIDRYQKWK 984
            S +DPE ++   ERIG+GSFGEV+KG++     +VAIKIIDLE+AEDEIEDIQQEI VLSQCDS YVTKYFGS+LK +KLWIIMEYLGGGSA+DL K G L+E++IA+ILREILKGL+YLHS++K+HRDIK ANVLL  +   VK+ D+GVA  L +T  K  TFVGTPF+MAPEV+K   Y  +ADIWSLGITAIELA GEPPHS+LHPMRVLFLIPKNP P L GS +SK F++FV+ CLNK+P+NRPSA  LL H FIK+AKK + L +LI+R  +++
Sbjct:    6 SKLDPEVIFTKQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLEQAEDEIEDIQQEIQVLSQCDSQYVTKYFGSFLKGSKLWIIMEYLGGGSALDLTKSGKLDESHIAVILREILKGLEYLHSERKIHRDIKGANVLLDRQTAAVKICDYGVAKPL-DTVLKANTFVGTPFFMAPEVVK-GEYSIEADIWSLGITAIELANGEPPHSDLHPMRVLFLIPKNPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQFIKRAKKNSILVDLIERAAEYR 284          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: GckIII (gene:FBgn0266465 transcript:FBtr0083399)

HSP 1 Score: 418.698 bits (1075), Expect = 7.136e-138
Identity = 219/283 (77.39%), Postives = 248/283 (87.63%), Query Frame = 1
Query:  136 MNIRSNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKKAKKTAYLQELIDRYQKWK 984
            M+    VDPE ++   ERIGKGSFGEV KG++   + +VAIKIIDLEEAEDEI+DIQQEI VLSQCDSPYVTKY+GS+LK TKLWIIMEYLGGGSA+DLMK G   E +I IILRE+LKGLDYLHS++KLHRDIKAANVLLSE GDVKLADFGVAGQLTNTT+KR TFVGTPFWMAPEVIKQS YD KADIWSLGITAIELAKGEPP+S LHPMRVLFLIPKN  PQL GS++K F+DFV+ CLNK+P+NRP+A+ELL + FIKKAKK AYL +LIDR++KWK
Sbjct:    1 MSWTEKVDPELIFTKQERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIDDIQQEIMVLSQCDSPYVTKYYGSFLKGTKLWIIMEYLGGGSALDLMKAGSFEEMHIGIILREVLKGLDYLHSERKLHRDIKAANVLLSEQGDVKLADFGVAGQLTNTTSKRNTFVGTPFWMAPEVIKQSQYDAKADIWSLGITAIELAKGEPPNSELHPMRVLFLIPKNNPPQLTGSYTKSFKDFVEACLNKDPENRPTAKELLKYPFIKKAKKNAYLIDLIDRFKKWK 283          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: hpo (gene:FBgn0261456 transcript:FBtr0331920)

HSP 1 Score: 278.1 bits (710), Expect = 1.021e-83
Identity = 142/274 (51.82%), Postives = 191/274 (69.71%), Query Frame = 1
Query:  160 PETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMK--PGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLD--GSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKKAKKTAYLQELIDR 969
            PE V+D++ ++G+GS+G V+K V+K   +IVAIK++ +E    EI       +++ QCDSPYV +Y+GSY K   LWI MEY G GS  D+M+     L E  IA IL + L+GL YLH ++K+HRDIKAAN+LL+  G  KLADFGVAGQLT+T  KR T +GTPFWMAPEVI++  YD  ADIWSLGITA+E+A+G+PP+  +HPMR +F+IP+ P P       +S  F DFV  CL KEPD+R +A ELL H FI+ AK  + L+ +++ 
Sbjct:   38 PEKVFDIMYKLGEGSYGSVYKAVHKESSSIVAIKLVPVESDLHEIIKEI---SIMQQCDSPYVVRYYGSYFKQYDLWICMEYCGAGSVSDIMRLRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRDIKAANILLNTEGYAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIEEIGYDCVADIWSLGITALEMAEGKPPYGEIHPMRAIFMIPQKPPPSFREPDRWSTEFIDFVSKCLVKEPDDRATATELLEHEFIRNAKHRSILKPMLEE 308          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: hpo (gene:FBgn0261456 transcript:FBtr0086500)

HSP 1 Score: 278.1 bits (710), Expect = 1.021e-83
Identity = 142/274 (51.82%), Postives = 191/274 (69.71%), Query Frame = 1
Query:  160 PETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMK--PGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLD--GSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKKAKKTAYLQELIDR 969
            PE V+D++ ++G+GS+G V+K V+K   +IVAIK++ +E    EI       +++ QCDSPYV +Y+GSY K   LWI MEY G GS  D+M+     L E  IA IL + L+GL YLH ++K+HRDIKAAN+LL+  G  KLADFGVAGQLT+T  KR T +GTPFWMAPEVI++  YD  ADIWSLGITA+E+A+G+PP+  +HPMR +F+IP+ P P       +S  F DFV  CL KEPD+R +A ELL H FI+ AK  + L+ +++ 
Sbjct:   38 PEKVFDIMYKLGEGSYGSVYKAVHKESSSIVAIKLVPVESDLHEIIKEI---SIMQQCDSPYVVRYYGSYFKQYDLWICMEYCGAGSVSDIMRLRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRDIKAANILLNTEGYAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIEEIGYDCVADIWSLGITALEMAEGKPPYGEIHPMRAIFMIPQKPPPSFREPDRWSTEFIDFVSKCLVKEPDDRATATELLEHEFIRNAKHRSILKPMLEE 308          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: hppy (gene:FBgn0263395 transcript:FBtr0340454)

HSP 1 Score: 243.432 bits (620), Expect = 6.204e-69
Identity = 131/284 (46.13%), Postives = 184/284 (64.79%), Query Frame = 1
Query:  148 SNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMK-PGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVI---KQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKN----PSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKKAKKTAYLQELIDRYQ 975
            S  +P+  Y+++++IG G++G+V+K   +I    +A   +   E  D+I+ IQQEI ++  C  P +  Y+GSYL+  KLWI ME+ GGGS  D+ +  GPL E  IA + RE LKGL+YLHS  K+HRDIK AN+LL+E GDVKLADFGV+ Q+T T NKR +F+GTP+WMAPEV    ++  Y+   DIW+ GITAIELA+ +PP  +LHPMR LFL+ K+    P+      +S  F +F+   L K P  RP+A  LL H F++        +EL+ +YQ
Sbjct:   18 SRRNPQDEYELIQKIGSGTYGDVYK-AKRIQSNELAAIKVIKLEPSDDIQIIQQEIIMMRDCRHPNIIAYYGSYLRRDKLWICMEFCGGGSLQDIYQVTGPLTEVQIAYMCRETLKGLEYLHSMGKMHRDIKGANILLTEYGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQLCDIWACGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPTLNNKDKWSPTFHNFIKTALTKNPKKRPTAERLLQHPFVQCEMSLRVAKELLQKYQ 300          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: hppy (gene:FBgn0263395 transcript:FBtr0340456)

HSP 1 Score: 243.047 bits (619), Expect = 6.742e-69
Identity = 131/284 (46.13%), Postives = 184/284 (64.79%), Query Frame = 1
Query:  148 SNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMK-PGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVI---KQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKN----PSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKKAKKTAYLQELIDRYQ 975
            S  +P+  Y+++++IG G++G+V+K   +I    +A   +   E  D+I+ IQQEI ++  C  P +  Y+GSYL+  KLWI ME+ GGGS  D+ +  GPL E  IA + RE LKGL+YLHS  K+HRDIK AN+LL+E GDVKLADFGV+ Q+T T NKR +F+GTP+WMAPEV    ++  Y+   DIW+ GITAIELA+ +PP  +LHPMR LFL+ K+    P+      +S  F +F+   L K P  RP+A  LL H F++        +EL+ +YQ
Sbjct:   18 SRRNPQDEYELIQKIGSGTYGDVYK-AKRIQSNELAAIKVIKLEPSDDIQIIQQEIIMMRDCRHPNIIAYYGSYLRRDKLWICMEFCGGGSLQDIYQVTGPLTEVQIAYMCRETLKGLEYLHSMGKMHRDIKGANILLTEYGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQLCDIWACGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPTLNNKDKWSPTFHNFIKTALTKNPKKRPTAERLLQHPFVQCEMSLRVAKELLQKYQ 300          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: stk25b (serine/threonine kinase 25b [Source:ZFIN;Acc:ZDB-GENE-040426-2537])

HSP 1 Score: 421.394 bits (1082), Expect = 1.031e-141
Identity = 226/294 (76.87%), Postives = 256/294 (87.07%), Query Frame = 1
Query:  115 HIMPDRNMNIRSNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKK-AKKTAYLQELIDRYQKWKAEA 993
            H+   +N N  S +DPE  +   ERIGKGSFGEV+KG+N   K +VAIKIIDLEEAEDEIEDIQQEI VLSQCDSPYVTKY+GSYLK TKLWIIMEYLGGGSA+DL+KPGPL ETYIA ILREILKGL+YLHS++K+HRDIKAANVLLSE GDVKLADFGVAGQLT+T  KR TFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPP+S+LHPMRVLFLIPKN  P L+GS+SK F++FV+ CLNK+P  RP+A+ELL H FI +  KKT+YL ELIDRY++WK+E 
Sbjct:    3 HLRDMQNQN--SRLDPEEYFTKQERIGKGSFGEVYKGINNRTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKGTKLWIIMEYLGGGSALDLLKPGPLEETYIATILREILKGLEYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNTPPTLEGSYSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTSYLTELIDRYRRWKSEG 294          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: stk25a (serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-GENE-041010-92])

HSP 1 Score: 416.387 bits (1069), Expect = 6.747e-140
Identity = 224/294 (76.19%), Postives = 253/294 (86.05%), Query Frame = 1
Query:  115 HIMPDRNMNIRSNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKK-AKKTAYLQELIDRYQKWKAEA 993
            H+   RN N R N  PE  +  LERIGKGSFGEV+KG+N   K +VAIKIIDLEEAEDEIEDIQQEI VLSQCDSPYVTKY+GSYL  +KLWIIMEYLGGGSA+DL++PG L E YIA ILREILKGLDYLHS++K+HRDIKAANVLLSE+G+VKLADFGVAGQLT+T  KR TFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPP++ LHPMRVLFLIPKN  P L+GS+SK F+DFV+ CLNKEP  RP+A+ELL H FI +  KKT+YL ELIDRY++WK+E 
Sbjct:    3 HLQNIRNQNSRLN--PEEYFTKLERIGKGSFGEVYKGINNRTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLTGSKLWIIMEYLGGGSALDLLRPGTLEEVYIATILREILKGLDYLHSERKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNAELHPMRVLFLIPKNNPPTLEGSYSKAFKDFVEACLNKEPRFRPTAKELLKHKFITRYTKKTSYLSELIDRYRRWKSEG 294          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: stk24b (serine/threonine kinase 24b (STE20 homolog, yeast) [Source:ZFIN;Acc:ZDB-GENE-040426-2841])

HSP 1 Score: 400.979 bits (1029), Expect = 6.849e-134
Identity = 214/279 (76.70%), Postives = 246/279 (88.17%), Query Frame = 1
Query:  157 DPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKK-AKKTAYLQELIDRYQKWKAE 990
            DPE ++  LERIGKGSFGEV KG++   + +VAIKIIDLEEAEDEIEDIQQEI VLSQCDSP+VTKY+GSYLK TKLWIIMEYLGGGSA+DL++PG L+ET IA ILREILKGL+YLHS+KK+HRDIKAANVLLSE G+VKLADFGVAGQLT+T  KR TFVGTPFWMAPEVIKQSAYD KADIWSLGITAIELAKGEPPHS+LHPM+VLFLIPKN  P L+G++ K  ++FV+ CLNKEP  RP+A+ELL H  I + AKKT+YL ELID+Y++WKAE
Sbjct:    7 DPEELFTKLERIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPFVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGSLDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSDLHPMKVLFLIPKNNPPTLEGNYCKPLKEFVEACLNKEPSFRPTAKELLKHKLIVRFAKKTSYLTELIDKYKRWKAE 285          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: stk26 (serine/threonine protein kinase 26 [Source:ZFIN;Acc:ZDB-GENE-080516-5])

HSP 1 Score: 400.593 bits (1028), Expect = 7.090e-134
Identity = 211/283 (74.56%), Postives = 247/283 (87.28%), Query Frame = 1
Query:  148 SNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFI-KKAKKTAYLQELIDRYQKWKAEA 993
            S  DPE ++  L+RIGKGSFGEV KG+++  + +VAIK IDLEEAEDEIEDIQQEI VLSQCDSP+VTKY+GSYLK +KLWIIMEYLGGGSA+DL++ GP +E  IA +L+EILKGLDYLHS+KK+HRDIKAANVLLSE+G+VKLADFGVAGQLT+T  KR TFVGTPFWMAPEVI+QSAYD KADIWSLGITAIELAKGEPP+S++HPMRVLF IPKN  P L+G FSK+F++FVD CLNK+P  RP+A+ELL H FI K AKKT+YL ELIDR ++WKAE 
Sbjct:   16 SRTDPEELFTKLDRIGKGSFGEVFKGIDRQTQNVVAIKTIDLEEAEDEIEDIQQEITVLSQCDSPHVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEYQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSESGEVKLADFGVAGQLTDTQIKRETFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFHIPKNTPPTLNGDFSKIFKEFVDSCLNKDPAFRPTAKELLKHKFIVKYAKKTSYLTELIDRLKRWKAEG 298          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: stk24b (serine/threonine kinase 24b (STE20 homolog, yeast) [Source:ZFIN;Acc:ZDB-GENE-040426-2841])

HSP 1 Score: 400.979 bits (1029), Expect = 9.470e-134
Identity = 214/279 (76.70%), Postives = 246/279 (88.17%), Query Frame = 1
Query:  157 DPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKK-AKKTAYLQELIDRYQKWKAE 990
            DPE ++  LERIGKGSFGEV KG++   + +VAIKIIDLEEAEDEIEDIQQEI VLSQCDSP+VTKY+GSYLK TKLWIIMEYLGGGSA+DL++PG L+ET IA ILREILKGL+YLHS+KK+HRDIKAANVLLSE G+VKLADFGVAGQLT+T  KR TFVGTPFWMAPEVIKQSAYD KADIWSLGITAIELAKGEPPHS+LHPM+VLFLIPKN  P L+G++ K  ++FV+ CLNKEP  RP+A+ELL H  I + AKKT+YL ELID+Y++WKAE
Sbjct:   19 DPEELFTKLERIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPFVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGSLDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSDLHPMKVLFLIPKNNPPTLEGNYCKPLKEFVEACLNKEPSFRPTAKELLKHKLIVRFAKKTSYLTELIDKYKRWKAE 297          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: stk25 (serine/threonine kinase 25 [Source:NCBI gene;Acc:548355])

HSP 1 Score: 412.149 bits (1058), Expect = 1.751e-138
Identity = 216/283 (76.33%), Postives = 250/283 (88.34%), Query Frame = 1
Query:  148 SNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFI-KKAKKTAYLQELIDRYQKWKAEA 993
            S +DPE ++  LERIGKGSFGEV+KG+    K +VAIKIIDLEEAEDEIEDIQQEI VLSQCDSPY+T+Y+GSYLK +KLWIIMEYLGGGSA+DL+KPGPL E YIA ILREILKGLDYLHS++K+HRDIKAANVLLSE GDVKLADFGVAGQLT+T  KR TFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPP+S+LHPMRVLFLIPKN  P L G +SK F+DFV+ CLNK+P +RP+ARELL H FI +  KKT++L EL++R+++WK++ 
Sbjct:   11 SRMDPERLFTKLERIGKGSFGEVYKGIENRSKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYITRYYGSYLKGSKLWIIMEYLGGGSALDLLKPGPLEEAYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPYSDLHPMRVLFLIPKNNPPSLQGQYSKPFKDFVEACLNKDPRSRPTARELLKHRFILRYTKKTSFLVELVERHKRWKSQG 293          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: stk25 (serine/threonine kinase 25 [Source:NCBI gene;Acc:548355])

HSP 1 Score: 410.223 bits (1053), Expect = 5.762e-138
Identity = 215/281 (76.51%), Postives = 249/281 (88.61%), Query Frame = 1
Query:  154 VDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFI-KKAKKTAYLQELIDRYQKWKAEA 993
            +DPE ++  LERIGKGSFGEV+KG+    K +VAIKIIDLEEAEDEIEDIQQEI VLSQCDSPY+T+Y+GSYLK +KLWIIMEYLGGGSA+DL+KPGPL E YIA ILREILKGLDYLHS++K+HRDIKAANVLLSE GDVKLADFGVAGQLT+T  KR TFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPP+S+LHPMRVLFLIPKN  P L G +SK F+DFV+ CLNK+P +RP+ARELL H FI +  KKT++L EL++R+++WK++ 
Sbjct:    1 MDPERLFTKLERIGKGSFGEVYKGIENRSKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYITRYYGSYLKGSKLWIIMEYLGGGSALDLLKPGPLEEAYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPYSDLHPMRVLFLIPKNNPPSLQGQYSKPFKDFVEACLNKDPRSRPTARELLKHRFILRYTKKTSFLVELVERHKRWKSQG 281          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: stk25 (serine/threonine kinase 25 [Source:NCBI gene;Acc:548355])

HSP 1 Score: 410.223 bits (1053), Expect = 1.004e-137
Identity = 215/281 (76.51%), Postives = 249/281 (88.61%), Query Frame = 1
Query:  154 VDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFI-KKAKKTAYLQELIDRYQKWKAEA 993
            +DPE ++  LERIGKGSFGEV+KG+    K +VAIKIIDLEEAEDEIEDIQQEI VLSQCDSPY+T+Y+GSYLK +KLWIIMEYLGGGSA+DL+KPGPL E YIA ILREILKGLDYLHS++K+HRDIKAANVLLSE GDVKLADFGVAGQLT+T  KR TFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPP+S+LHPMRVLFLIPKN  P L G +SK F+DFV+ CLNK+P +RP+ARELL H FI +  KKT++L EL++R+++WK++ 
Sbjct:    1 MDPERLFTKLERIGKGSFGEVYKGIENRSKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYITRYYGSYLKGSKLWIIMEYLGGGSALDLLKPGPLEEAYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPYSDLHPMRVLFLIPKNNPPSLQGQYSKPFKDFVEACLNKDPRSRPTARELLKHRFILRYTKKTSFLVELVERHKRWKSQG 281          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: stk25 (serine/threonine kinase 25 [Source:NCBI gene;Acc:548355])

HSP 1 Score: 410.609 bits (1054), Expect = 1.041e-137
Identity = 215/281 (76.51%), Postives = 249/281 (88.61%), Query Frame = 1
Query:  154 VDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFI-KKAKKTAYLQELIDRYQKWKAEA 993
            +DPE ++  LERIGKGSFGEV+KG+    K +VAIKIIDLEEAEDEIEDIQQEI VLSQCDSPY+T+Y+GSYLK +KLWIIMEYLGGGSA+DL+KPGPL E YIA ILREILKGLDYLHS++K+HRDIKAANVLLSE GDVKLADFGVAGQLT+T  KR TFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPP+S+LHPMRVLFLIPKN  P L G +SK F+DFV+ CLNK+P +RP+ARELL H FI +  KKT++L EL++R+++WK++ 
Sbjct:    1 MDPERLFTKLERIGKGSFGEVYKGIENRSKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYITRYYGSYLKGSKLWIIMEYLGGGSALDLLKPGPLEEAYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPYSDLHPMRVLFLIPKNNPPSLQGQYSKPFKDFVEACLNKDPRSRPTARELLKHRFILRYTKKTSFLVELVERHKRWKSQG 281          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: slc39a7 (solute carrier family 39 member 7 [Source:Xenbase;Acc:XB-GENE-492963])

HSP 1 Score: 410.609 bits (1054), Expect = 1.313e-137
Identity = 222/293 (75.77%), Postives = 252/293 (86.01%), Query Frame = 1
Query:  115 HIMPDRNMNIRSNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFI-KKAKKTAYLQELIDRYQKWKAE 990
            H   D  + I    DPE ++  LE+IGKGSFGEV KG++   + +VAIKIIDLEEAEDEIEDIQQEI VLSQCDSPYVTKY+GSYLK TKLWIIMEYLGGGSA+DL++PGPL+ET IA ILREILKGLDYLHS+KK+HRDIKAANVLLSE+G+VKLADFGVAGQLT+T  KR TFVGTPFWMAPEVIKQSAYD KADIWSLGITAIELAKGEPPHS LHPM+VLFLIPKN  P L+G++SK  ++FV+ CLNKEP  RPSA+ELL H FI + AKKT+YL ELIDRY++WK E
Sbjct:    3 HSALDIALYILLKADPEELFRKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKGLKEFVEACLNKEPSFRPSAKELLKHKFIMRSAKKTSYLTELIDRYKRWKIE 295          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Stk25 (serine/threonine kinase 25 (yeast) [Source:MGI Symbol;Acc:MGI:1891699])

HSP 1 Score: 416.001 bits (1068), Expect = 1.154e-139
Identity = 221/283 (78.09%), Postives = 251/283 (88.69%), Query Frame = 1
Query:  148 SNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKK-AKKTAYLQELIDRYQKWKAEA 993
            S VDPE ++  L+RIGKGSFGEV+KG++   K +VAIKIIDLEEAEDEIEDIQQEI VLSQCDSPY+T+YFGSYLK TKLWIIMEYLGGGSA+DL+KPGPL ETYIA ILREILKGLDYLHS++K+HRDIKAANVLLSE GDVKLADFGVAGQLT+T  KR TFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPP+S+LHPMRVLFLIPKN  P L+G  SK F++FV+ CLNK+P  RP+A+ELL H FI +  KKT++L ELIDRY++WK+E 
Sbjct:   12 SRVDPEELFTKLDRIGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYITRYFGSYLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNNPPTLEGHHSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTSFLTELIDRYKRWKSEG 294          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Stk24 (serine/threonine kinase 24 [Source:MGI Symbol;Acc:MGI:2385007])

HSP 1 Score: 407.912 bits (1047), Expect = 2.362e-136
Identity = 218/280 (77.86%), Postives = 248/280 (88.57%), Query Frame = 1
Query:  154 VDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGF-IKKAKKTAYLQELIDRYQKWKAE 990
             DPE ++  LE+IGKGSFGEV KG++   + +VAIKIIDLEEAEDEIEDIQQEI VLSQCDSPYVTKY+GSYLK TKLWIIMEYLGGGSA+DL++PGPL+E  IA ILREILKGLDYLHS+KK+HRDIKAANVLLSE+G+VKLADFGVAGQLT+T  KR TFVGTPFWMAPEVIKQSAYD KADIWSLGITAIELAKGEPPHS LHPM+VLFLIPKN  P L+G++SK  ++FV+ CLNKEP  RP+A+ELL H F I+ AKKT+YL ELIDRY++WKAE
Sbjct:   18 ADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDEIQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFIIRNAKKTSYLTELIDRYKRWKAE 297          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Stk26 (serine/threonine kinase 26 [Source:MGI Symbol;Acc:MGI:1917665])

HSP 1 Score: 397.512 bits (1020), Expect = 1.563e-132
Identity = 212/286 (74.13%), Postives = 249/286 (87.06%), Query Frame = 1
Query:  142 IRSNV-DPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFI-KKAKKTAYLQELIDRYQKWKAEA 993
            +++N+ DPE ++  LERIGKGSFGEV KG++   + +VAIKIIDLEEAEDEIEDIQQEI VLSQCDS YVTKY+GSYLK +KLWIIMEYLGGGSA+DL++ GP +E  IA +L+EILKGLDYLHS+KK+HRDIKAANVLLSE GDVKLADFGVAGQLT+T  KR TFVGTPFWMAPEVI+QSAYD KADIWSLGITAIELAKGEPP+S++HPMRVLFLIPKN  P L G F+K F++F+D CLNK+P  RP+A+ELL H FI K +KKT+YL ELIDR+++WKAE 
Sbjct:   13 MQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLIGDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELIDRFKRWKAEG 298          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Stk26 (serine/threonine kinase 26 [Source:MGI Symbol;Acc:MGI:1917665])

HSP 1 Score: 396.356 bits (1017), Expect = 2.056e-132
Identity = 212/286 (74.13%), Postives = 249/286 (87.06%), Query Frame = 1
Query:  142 IRSNV-DPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFI-KKAKKTAYLQELIDRYQKWKAEA 993
            +++N+ DPE ++  LERIGKGSFGEV KG++   + +VAIKIIDLEEAEDEIEDIQQEI VLSQCDS YVTKY+GSYLK +KLWIIMEYLGGGSA+DL++ GP +E  IA +L+EILKGLDYLHS+KK+HRDIKAANVLLSE GDVKLADFGVAGQLT+T  KR TFVGTPFWMAPEVI+QSAYD KADIWSLGITAIELAKGEPP+S++HPMRVLFLIPKN  P L G F+K F++F+D CLNK+P  RP+A+ELL H FI K +KKT+YL ELIDR+++WKAE 
Sbjct:   13 MQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLIGDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELIDRFKRWKAEG 298          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Stk25 (serine/threonine kinase 25 (yeast) [Source:MGI Symbol;Acc:MGI:1891699])

HSP 1 Score: 341.658 bits (875), Expect = 1.652e-113
Identity = 187/223 (83.86%), Postives = 204/223 (91.48%), Query Frame = 1
Query:  145 RSNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSP 813
             S VDPE ++  L+RIGKGSFGEV+KG++   K +VAIKIIDLEEAEDEIEDIQQEI VLSQCDSPY+T+YFGSYLK TKLWIIMEYLGGGSA+DL+KPGPL ETYIA ILREILKGLDYLHS++K+HRDIKAANVLLSE GDVKLADFGVAGQLT+T  KR TFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPP+S+LHPMRVLFLIPKN  P
Sbjct:   11 HSRVDPEELFTKLDRIGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYITRYFGSYLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNNPP 233          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|O00506|STK25_HUMAN (Serine/threonine-protein kinase 25 OS=Homo sapiens OX=9606 GN=STK25 PE=1 SV=1)

HSP 1 Score: 418.698 bits (1075), Expect = 8.796e-140
Identity = 222/286 (77.62%), Postives = 252/286 (88.11%), Query Frame = 1
Query:  139 NIRSNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKK-AKKTAYLQELIDRYQKWKAEA 993
            N  S VDPE ++  L+RIGKGSFGEV+KG++   K +VAIKIIDLEEAEDEIEDIQQEI VLSQCDSPY+T+YFGSYLK TKLWIIMEYLGGGSA+DL+KPGPL ETYIA ILREILKGLDYLHS++K+HRDIKAANVLLSE GDVKLADFGVAGQLT+T  KR TFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPP+S+LHPMRVLFLIPKN  P L+G  SK F++FV+ CLNK+P  RP+A+ELL H FI +  KKT++L ELIDRY++WK+E 
Sbjct:    9 NQHSRVDPEELFTKLDRIGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYITRYFGSYLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNSPPTLEGQHSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTSFLTELIDRYKRWKSEG 294          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q3SWY6|STK25_BOVIN (Serine/threonine-protein kinase 25 OS=Bos taurus OX=9913 GN=STK25 PE=2 SV=1)

HSP 1 Score: 416.387 bits (1069), Expect = 7.243e-139
Identity = 221/286 (77.27%), Postives = 252/286 (88.11%), Query Frame = 1
Query:  139 NIRSNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKK-AKKTAYLQELIDRYQKWKAEA 993
            N  S VDPE ++  L+RIGKGSFGEV+KG++   K +VAIKIIDLEEAEDEIEDIQQEI VLSQCDSPY+T+YFGSYLK TKLWIIMEYLGGGSA+DL+KPGPL ETYIA ILREILKGLDYLHS++K+HRDIKAANVLLSE GDVKLADFGVAGQLT+T  KR TFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPP+S+LHPMRVLFLIPKN  P L+G  SK F++FV+ CLNK+P  RP+A+ELL H FI +  KKT++L ELIDRY++W++E 
Sbjct:    9 NQHSRVDPEELFTKLDRIGKGSFGEVYKGIDNRTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYITRYFGSYLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNSPPTLEGHHSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTSFLTELIDRYKRWRSEG 294          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q9Z2W1|STK25_MOUSE (Serine/threonine-protein kinase 25 OS=Mus musculus OX=10090 GN=Stk25 PE=1 SV=2)

HSP 1 Score: 416.001 bits (1068), Expect = 8.070e-139
Identity = 221/283 (78.09%), Postives = 251/283 (88.69%), Query Frame = 1
Query:  148 SNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKK-AKKTAYLQELIDRYQKWKAEA 993
            S VDPE ++  L+RIGKGSFGEV+KG++   K +VAIKIIDLEEAEDEIEDIQQEI VLSQCDSPY+T+YFGSYLK TKLWIIMEYLGGGSA+DL+KPGPL ETYIA ILREILKGLDYLHS++K+HRDIKAANVLLSE GDVKLADFGVAGQLT+T  KR TFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPP+S+LHPMRVLFLIPKN  P L+G  SK F++FV+ CLNK+P  RP+A+ELL H FI +  KKT++L ELIDRY++WK+E 
Sbjct:   12 SRVDPEELFTKLDRIGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYITRYFGSYLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNNPPTLEGHHSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTSFLTELIDRYKRWKSEG 294          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q9Y6E0|STK24_HUMAN (Serine/threonine-protein kinase 24 OS=Homo sapiens OX=9606 GN=STK24 PE=1 SV=1)

HSP 1 Score: 409.453 bits (1051), Expect = 6.181e-136
Identity = 220/290 (75.86%), Postives = 255/290 (87.93%), Query Frame = 1
Query:  124 PDRNMNIRSNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFI-KKAKKTAYLQELIDRYQKWKAE 990
            P  + N+++  DPE ++  LE+IGKGSFGEV KG++   + +VAIKIIDLEEAEDEIEDIQQEI VLSQCDSPYVTKY+GSYLK TKLWIIMEYLGGGSA+DL++PGPL+ET IA ILREILKGLDYLHS+KK+HRDIKAANVLLSE+G+VKLADFGVAGQLT+T  KR TFVGTPFWMAPEVIKQSAYD KADIWSLGITAIELA+GEPPHS LHPM+VLFLIPKN  P L+G++SK  ++FV+ CLNKEP  RP+A+ELL H FI + AKKT+YL ELIDRY++WKAE
Sbjct:   22 PGGSTNLKA--DPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAE 309          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q99KH8|STK24_MOUSE (Serine/threonine-protein kinase 24 OS=Mus musculus OX=10090 GN=Stk24 PE=1 SV=1)

HSP 1 Score: 407.912 bits (1047), Expect = 1.652e-135
Identity = 218/280 (77.86%), Postives = 248/280 (88.57%), Query Frame = 1
Query:  154 VDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGF-IKKAKKTAYLQELIDRYQKWKAE 990
             DPE ++  LE+IGKGSFGEV KG++   + +VAIKIIDLEEAEDEIEDIQQEI VLSQCDSPYVTKY+GSYLK TKLWIIMEYLGGGSA+DL++PGPL+E  IA ILREILKGLDYLHS+KK+HRDIKAANVLLSE+G+VKLADFGVAGQLT+T  KR TFVGTPFWMAPEVIKQSAYD KADIWSLGITAIELAKGEPPHS LHPM+VLFLIPKN  P L+G++SK  ++FV+ CLNKEP  RP+A+ELL H F I+ AKKT+YL ELIDRY++WKAE
Sbjct:   18 ADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDEIQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFIIRNAKKTSYLTELIDRYKRWKAE 297          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A267DF87 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029879g1 PE=4 SV=1)

HSP 1 Score: 448.743 bits (1153), Expect = 5.317e-148
Identity = 242/324 (74.69%), Postives = 279/324 (86.11%), Query Frame = 1
Query:  136 MNIRS-NVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKKAKKTAYLQELIDRYQKWKAEAXXXXXXXXXXXXXXXXXXHRPVTTQGARDKGTFKWNF 1104
            ++IR+ N DPE++YD +ERIGKGSFGEV KG+++  K IVAIKIIDLEE EDEIEDIQQEINVLSQCDSPY+TKYFGSYL+ TKLWIIMEYLGGGSA+DL+K G  +E YIAIILREILKGLDYLHS++KLHRDIKAAN+LLS+NGDVKLADFGVAGQLTNTT+KRVTFVGTPFWMAPEVIKQS YDFKADIWSLGITAIELAKGEPP+S LHPMRVLFLIPKNPSPQL G++SK+F+DFV+ CL+K P+NRP+A+ELL   FIK+AKKTAYL ELI+R++ WKA+  ++ D D DDD          +   GA   GTFKW F
Sbjct:    7 ISIRAQNTDPESIYDKMERIGKGSFGEVFKGIDRRTKEIVAIKIIDLEEEEDEIEDIQQEINVLSQCDSPYITKYFGSYLRGTKLWIIMEYLGGGSALDLIKAGLPDEQYIAIILREILKGLDYLHSERKLHRDIKAANILLSDNGDVKLADFGVAGQLTNTTSKRVTFVGTPFWMAPEVIKQSEYDFKADIWSLGITAIELAKGEPPNSELHPMRVLFLIPKNPSPQLTGNYSKVFQDFVNACLDKNPENRPTAKELLKFPFIKRAKKTAYLVELIERFKNWKAQGGDRDDDDDDDDDDADAL----IDEDGADRAGTFKWKF 326          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A267G9F9 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029879g2 PE=4 SV=1)

HSP 1 Score: 448.743 bits (1153), Expect = 5.496e-148
Identity = 242/324 (74.69%), Postives = 279/324 (86.11%), Query Frame = 1
Query:  136 MNIRS-NVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKKAKKTAYLQELIDRYQKWKAEAXXXXXXXXXXXXXXXXXXHRPVTTQGARDKGTFKWNF 1104
            ++IR+ N DPE++YD +ERIGKGSFGEV KG+++  K IVAIKIIDLEE EDEIEDIQQEINVLSQCDSPY+TKYFGSYL+ TKLWIIMEYLGGGSA+DL+K G  +E YIAIILREILKGLDYLHS++KLHRDIKAAN+LLS+NGDVKLADFGVAGQLTNTT+KRVTFVGTPFWMAPEVIKQS YDFKADIWSLGITAIELAKGEPP+S LHPMRVLFLIPKNPSPQL G++SK+F+DFV+ CL+K P+NRP+A+ELL   FIK+AKKTAYL ELI+R++ WKA+  ++ D D DDD          +   GA   GTFKW F
Sbjct:    7 ISIRAQNTDPESIYDKMERIGKGSFGEVFKGIDRRTKEIVAIKIIDLEEEEDEIEDIQQEINVLSQCDSPYITKYFGSYLRGTKLWIIMEYLGGGSALDLIKAGLPDEQYIAIILREILKGLDYLHSERKLHRDIKAANILLSDNGDVKLADFGVAGQLTNTTSKRVTFVGTPFWMAPEVIKQSEYDFKADIWSLGITAIELAKGEPPNSELHPMRVLFLIPKNPSPQLTGNYSKVFQDFVNACLDKNPENRPTAKELLKFPFIKRAKKTAYLVELIERFKNWKAQGGDRDDDDDDDDDDADAL----IDEDGADRAGTFKWKF 326          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A4Z2CU10 (Serine/threonine-protein kinase 25 isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_007650 PE=4 SV=1)

HSP 1 Score: 425.246 bits (1092), Expect = 1.140e-141
Identity = 216/289 (74.74%), Postives = 257/289 (88.93%), Query Frame = 1
Query:  121 MPD-RNMNIRSNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKKAKKTAYLQELIDRYQKWK 984
            MPD R  +++ N++PET+YD+LERIG+GSFGEV+KGV++  + +VAIK+IDLE AEDEIEDIQQEI VLSQC+SPY+TKY GS+LK T LWI+MEYLGGGSA+DLMKPGP+ E +I+ ILREILKGLDYLHSQ K+HRDIKAANVLLS  GDVKLADFGVAGQL++T  KR TFVGTPFWMAPE+I++ AYDFK DIWS GITAIELAKGEPP+++LHP+RVL LIPKNPSPQL G FSK+F+DFVDCCL K P+NRP+A ELL H FIKKA+KTA+LQELI+RY+KW+
Sbjct:    1 MPDPRGTHVKVNINPETIYDILERIGRGSFGEVYKGVDRKTREVVAIKLIDLEAAEDEIEDIQQEIKVLSQCNSPYITKYHGSFLKDTTLWIVMEYLGGGSALDLMKPGPIPEVHISTILREILKGLDYLHSQSKIHRDIKAANVLLSYTGDVKLADFGVAGQLSSTITKRGTFVGTPFWMAPELIQRYAYDFKVDIWSTGITAIELAKGEPPNADLHPIRVLMLIPKNPSPQLTGDFSKVFKDFVDCCLTKVPENRPTAHELLRHSFIKKARKTAFLQELIERYRKWR 289          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: G4VR95 (Serine/threonine kinase OS=Schistosoma mansoni OX=6183 GN=Smp_096640 PE=4 SV=1)

HSP 1 Score: 433.721 bits (1114), Expect = 1.831e-140
Identity = 235/355 (66.20%), Postives = 279/355 (78.59%), Query Frame = 1
Query:  121 MPD-RNMNIRSNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKKAKKTAYLQELIDRYQKWKAEAXXXXXXXXXXXXXXXXXXHRPVTTQ----GARDK-----------------GTFKWNFDTVKA 1119
            MPD R   ++ NV+PET+YD+LERIG+GSFGEV+KGV++  + +VAIK+IDLE AEDEIEDIQQEI VLSQC+SPY+TKY GSYLK T LWI+MEYLGGGSA+DLMKPGP+ E +I+ ILREILKGLDYLHSQ K+HRDIKAANVLLS +GDVKLADFGVAGQL++T  KR TFVGTPFWMAPE+I++ AYDFK DIWS GITAIELAKGEPP+++LHP+RVL LIPKNPSPQL G FSK+F+DFVDCCL K P+NRP+A ELL H FIKKA+KTA+LQELI+RY+KW+ E  +       DD  +  D+   V       G  DK                  TFKWNF+TV+A
Sbjct:    1 MPDPRGTQLKVNVNPETIYDILERIGRGSFGEVYKGVDRKTREVVAIKLIDLEAAEDEIEDIQQEIKVLSQCNSPYITKYHGSYLKDTTLWIVMEYLGGGSALDLMKPGPIPEVHISTILREILKGLDYLHSQSKIHRDIKAANVLLSYSGDVKLADFGVAGQLSSTITKRGTFVGTPFWMAPELIQRYAYDFKVDIWSTGITAIELAKGEPPNADLHPIRVLMLIPKNPSPQLTGDFSKVFKDFVDCCLTKVPENRPTAHELLRHSFIKKARKTAFLQELIERYRKWRDEGGDDDADGESDDDGLVPDEEDLVNAHSNSPGGADKPGQKKKHFDGMRPGKASDTFKWNFETVRA 355          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: C1LFW7 (Serine/threonine kinase 25 OS=Schistosoma japonicum OX=6182 GN=STK25 PE=2 SV=1)

HSP 1 Score: 433.335 bits (1113), Expect = 3.536e-140
Identity = 232/359 (64.62%), Postives = 277/359 (77.16%), Query Frame = 1
Query:  121 MPD-RNMNIRSNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKKAKKTAYLQELIDRYQKWKAEAXXXXXXXXXXXX-----XXXXXXHRPVTTQGARDKG--------------------TFKWNFDTVKA 1119
            MPD R  +++ N++PET+YD+LERIG+GSFGEV+KGV++  + +VAIK+IDLE AEDEIEDIQQEI VLSQC+SPY+TKY GS+LK T LWI+MEYLGGGSA+DLMKPGP+ E +I+ ILREILKGLDYLHSQ K+HRDIKAANVLLS  GDVKLADFGVAGQL++T  KR TFVGTPFWMAPE+I++ AYDFK DIWS GITAIELAKGEPP+++LHP+RVL LIPKNPSPQL G FSK+F+DFVDCCL K P+NRP+A ELL H FIKKA+KTA+LQELI+RY+KW+ E  +       DD           +  P T  G    G                    TFKWNF+TV+A
Sbjct:    1 MPDPRGTHVKVNINPETIYDILERIGRGSFGEVYKGVDRKTREVVAIKLIDLEAAEDEIEDIQQEIKVLSQCNSPYITKYHGSFLKDTTLWIVMEYLGGGSALDLMKPGPIPEVHISTILREILKGLDYLHSQSKIHRDIKAANVLLSYTGDVKLADFGVAGQLSSTITKRGTFVGTPFWMAPELIQRYAYDFKVDIWSTGITAIELAKGEPPNADLHPIRVLMLIPKNPSPQLTGDFSKVFKDFVDCCLTKVPENRPTAHELLRHSFIKKARKTAFLQELIERYRKWRDEGGDDDADGESDDDGLVPDEEDLVNSHPETASGVASGGDKPNQGKKIADGLKSGKASDTFKWNFETVRA 359          

HSP 2 Score: 60.8474 bits (146), Expect = 9.020e-6
Identity = 29/54 (53.70%), Postives = 37/54 (68.52%), Query Frame = 3
Query: 1545 QLEAVYSRVAGGRHQPIAELTAAFEMVDSISPTYTSQFLSELLYRVFDNCPRLS 1706
             L+ VYS+V  G    I+ L A F+ VD+ SP YT++FLSELL RV D+ PRLS
Sbjct:  561 DLQDVYSQVTSGASDSISNLAATFQAVDAASPQYTTEFLSELLTRVLDSNPRLS 614          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: stk25a (serine/threonine-protein kinase 25 [Source:NCBI gene;Acc:103021644])

HSP 1 Score: 422.165 bits (1084), Expect = 3.229e-142
Identity = 226/294 (76.87%), Postives = 256/294 (87.07%), Query Frame = 1
Query:  115 HIMPDRNMNIRSNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKK-AKKTAYLQELIDRYQKWKAEA 993
            H+    N N R  +DPE  +  LERIGKGSFGEV+KG+N   K +VAIKIIDLEEAEDEIEDIQQEI VLSQCDSP+VTKYFGSYLK TKLWIIMEYLGGGSA+D++KPGPL E YIA ILREILKGLDYLHS++K+HRDIKAANVLLSE+G+VKLADFGVAGQLT+T  KR TFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPP+S+LHPMRVLFLIPKN  P L+GS+SK F+DFV+ CLNK+P  RP+A+ELL H FI +  KKT+YL ELIDRY++WK+E 
Sbjct:    3 HLRGIHNQNTR--LDPEQYFTKLERIGKGSFGEVYKGINNRTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPFVTKYFGSYLKSTKLWIIMEYLGGGSALDMLKPGPLEEAYIATILREILKGLDYLHSERKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNNPPTLEGSYSKAFKDFVEACLNKDPRFRPTAKELLKHKFITRYTKKTSYLAELIDRYRRWKSEG 294          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: stk25b (serine/threonine-protein kinase 25-like [Source:NCBI gene;Acc:103039280])

HSP 1 Score: 422.165 bits (1084), Expect = 4.015e-142
Identity = 225/294 (76.53%), Postives = 257/294 (87.41%), Query Frame = 1
Query:  115 HIMPDRNMNIRSNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKK-AKKTAYLQELIDRYQKWKAEA 993
            H+   +N N R  +DPE  +   ERIGKGSFGEV+KG+N   K +VAIKIIDLEEAEDEIEDIQQEI VLSQCDSP+VTKY+GSYLK TKLWIIMEYLGGGSA+DL++PGPL ETYIA ILREILKGL+YLHS++K+HRDIKAANVLLSE GDVKLADFGVAGQLT+T  KR TFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPP+S+LHPMRVLFLIPKNP P L+GS+SK F++FV+ CLNK+P  RP+A+ELL H FI +  KKT+YL ELIDRY++WK+E 
Sbjct:    3 HLRDIQNQNAR--LDPEEYFTKQERIGKGSFGEVYKGINNRTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPFVTKYYGSYLKGTKLWIIMEYLGGGSALDLLRPGPLEETYIATILREILKGLEYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNPPPTLEGSYSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTSYLTELIDRYRRWKSEG 294          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: stk25b (serine/threonine-protein kinase 25-like [Source:NCBI gene;Acc:103039280])

HSP 1 Score: 417.927 bits (1073), Expect = 9.950e-141
Identity = 221/283 (78.09%), Postives = 252/283 (89.05%), Query Frame = 1
Query:  148 SNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKK-AKKTAYLQELIDRYQKWKAEA 993
            + +DPE  +   ERIGKGSFGEV+KG+N   K +VAIKIIDLEEAEDEIEDIQQEI VLSQCDSP+VTKY+GSYLK TKLWIIMEYLGGGSA+DL++PGPL ETYIA ILREILKGL+YLHS++K+HRDIKAANVLLSE GDVKLADFGVAGQLT+T  KR TFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPP+S+LHPMRVLFLIPKNP P L+GS+SK F++FV+ CLNK+P  RP+A+ELL H FI +  KKT+YL ELIDRY++WK+E 
Sbjct:   16 ARLDPEEYFTKQERIGKGSFGEVYKGINNRTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPFVTKYYGSYLKGTKLWIIMEYLGGGSALDLLRPGPLEETYIATILREILKGLEYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNPPPTLEGSYSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTSYLTELIDRYRRWKSEG 298          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: ENSAMXT00000008518.2 (pep primary_assembly:Astyanax_mexicanus-2.0:19:14507502:14520436:1 gene:ENSAMXG00000008289.2 transcript:ENSAMXT00000008518.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 404.06 bits (1037), Expect = 1.736e-135
Identity = 216/279 (77.42%), Postives = 246/279 (88.17%), Query Frame = 1
Query:  157 DPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFI-KKAKKTAYLQELIDRYQKWKAE 990
            DPE ++  LE+IGKGSFGEV KG++   + +VAIKIIDLEEAEDEIEDIQQEI VLSQCDSP+VTKY+GSYLK TKLWIIMEYLGGGSA+DL++PGPL+ET IA ILREILKGL+YLHS+KK+HRDIKAANVLLSE GDVKLADFGVAGQLT+T  KR TFVGTPFWMAPEVIKQSAYD KADIWSLGITAIELAKGEPPHS LHPM+VLFLIPKN  P L+G++ K  ++FV+ CLNKEP  RP+A+ELL H  I + AKKT+YL ELIDRY++WKAE
Sbjct:   16 DPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPFVTKYYGSYLKGTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSELHPMKVLFLIPKNNPPTLEGNYCKPLKEFVEACLNKEPSFRPTAKELLKHKLIVRYAKKTSYLTELIDRYKRWKAE 294          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: stk26 (serine/threonine kinase 26 [Source:NCBI gene;Acc:103024322])

HSP 1 Score: 398.667 bits (1023), Expect = 3.609e-133
Identity = 211/280 (75.36%), Postives = 245/280 (87.50%), Query Frame = 1
Query:  157 DPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFI-KKAKKTAYLQELIDRYQKWKAEA 993
            DPE ++  LERIGKGSFGEV KG+++  + +VAIK IDLEEAEDEIEDIQQEI VLSQCDSP+VTKY+GSYLK +KLWIIMEYLGGGSA+DL++ GP +E  IA +L+EILKGLDYLHS+KK+HRDIKAANVLLSE+G+VKLADFGVAGQLT+T  KR TFVGTPFWMAPEVI+QSAYD KADIWSLGITAIELAKGEPP+S++HPMRVLF IPKN  P L+G FSK F++FVD CLNK+P  RP+A+ELL H FI K AKKT+YL ELIDR ++WKAE 
Sbjct:   19 DPEELFTKLERIGKGSFGEVFKGIDRRTQNVVAIKTIDLEEAEDEIEDIQQEITVLSQCDSPHVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDECQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSESGEVKLADFGVAGQLTDTQIKRETFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFHIPKNTPPTLNGDFSKSFKEFVDSCLNKDPTFRPTAKELLKHKFIVKNAKKTSYLTELIDRLKRWKAEG 298          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: stk25a (serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-GENE-041010-92])

HSP 1 Score: 409.453 bits (1051), Expect = 1.230e-137
Identity = 226/296 (76.35%), Postives = 252/296 (85.14%), Query Frame = 1
Query:  115 HIMPDRNMNIRSNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIK--AANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKK-AKKTAYLQELIDRYQKWKAEA 993
            H  P +N    S  DPE ++   ERIGKGSFGEV KG++   K +VAIKIIDLEEAEDEIEDIQQEI VLSQCDSPYVT YFGSYLK TKLWIIMEYLGGGSA+DL+KPGPL E  IA ILREILKGLDYLHS++K+HRDIK  AANVLLSE GDVKLADFGVAGQLT+T  KR TFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPP+S LHPMRVLFLIPKN  P L+G++SK F++FVD CLNK+P  RP+A+ELL H FI++ AKKT+YL ELIDRY++WKAE 
Sbjct:   11 HPRPPQN----SCADPEELFTKQERIGKGSFGEVFKGIDNRTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTHYFGSYLKGTKLWIIMEYLGGGSALDLIKPGPLEEHQIATILREILKGLDYLHSERKIHRDIKGPAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSELHPMRVLFLIPKNNPPTLEGNYSKAFKEFVDSCLNKDPQFRPTAKELLKHKFIQRSAKKTSYLTELIDRYKRWKAEG 302          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: MAP4K3 (mitogen-activated protein kinase kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6865])

HSP 1 Score: 231.106 bits (588), Expect = 1.220e-65
Identity = 124/274 (45.26%), Postives = 182/274 (66.42%), Query Frame = 1
Query:  172 YDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMK-PGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVI---KQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKN----PSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKKAKKTAYLQELIDR 969
            +++ ER+G G++G+VHK  N     +VAIKII LE  +D     Q+ + ++ +C    +  Y+GSYL+  KLWI ME+ GGGS  D+    GPL E  IA + RE L+GL YLHS+ K+HRDIK AN+LL+++GDVKLADFGV+ Q+T T  KR +F+GTP+WMAPEV    ++  Y+ + D+W++GITAIELA+ +PP  +LHPMR LFL+ K+    P  +    +S +F +F+   L K P  RP+A ++L H ++++    A   EL++R
Sbjct:   14 FELAERLGSGTYGDVHKARNVQTGELVAIKIIKLEPGDDFSVIQQEIV-MMKECKHTNIVAYYGSYLRHDKLWICMEHCGGGSLQDIYHVTGPLTERQIAYVTRETLQGLAYLHSEGKMHRDIKGANILLTDDGDVKLADFGVSAQITATIAKRKSFIGTPYWMAPEVAAVERKGGYNHQCDVWAVGITAIELAELQPPMFDLHPMRALFLMSKSGFQPPKLRDKQKWSPVFHNFIKMALTKNPKKRPTAEKMLTHSYVQQPLSRAQALELLER 286          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: slka (STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-050411-66])

HSP 1 Score: 220.705 bits (561), Expect = 2.765e-61
Identity = 122/289 (42.21%), Postives = 183/289 (63.32%), Query Frame = 1
Query:  124 PDRNMNIRSNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGS--AMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVI-----KQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLD--GSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKKAKKTAYLQELI 963
            P +  ++R +VDP  ++ V+  +G G+FG+V+K  NK +  ++A   +   ++E+E+ED   EI +L+ CD P +     ++    KLWI +E+  GG+  A+ L     L E  I ++ +++L+ L+YLH+ + +HRD+KA N+LL+  GDVKLADFGV+ + T T  +R +F+GTP+WMAPEV+     K + YD+KADIWSLGIT IELA+ EPP+  L+PMRV+  I KN  P L     +S  F DF+  CL+K P+ R +A +LL H FI        L+ELI
Sbjct:   17 PKQYDHVRRDVDPAELWSVIGELGDGAFGKVYKAQNK-ESGVLAAAKVIETKSEEELEDYMVEIEILALCDHPNIVGLLNAFYYENKLWIFIEFCPGGAVDAIMLELERGLAEPQIRVVCKQMLEALNYLHTHRIIHRDLKAGNILLTFEGDVKLADFGVSAKNTRTLQRRDSFIGTPYWMAPEVVMCETMKDAPYDYKADIWSLGITLIELAQMEPPNHELNPMRVMLKIAKNDPPSLSFPSKWSAEFTDFLKKCLDKNPETRWNALQLLQHSFISGVDSNKPLRELI 304          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000169.1 (pep scaffold:Pmarinus_7.0:GL478331:850:46844:1 gene:ENSPMAG00000000147.1 transcript:ENSPMAT00000000169.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 216.853 bits (551), Expect = 7.124e-61
Identity = 107/234 (45.73%), Postives = 151/234 (64.53%), Query Frame = 1
Query:  346 VTKYFGSYLKVT------KLWIIMEYLGGGSAMDLMKP---GPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIK-----QSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDG-SFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKKAKKTA----YLQELIDRYQKWKAE 990
            +  Y+G+++K +      +LW++ME+ G GS  DL+K      L E +IA I REIL+GL +LH+ + +HRDIK  NVLL+EN +VKL DFGV+ QL  T  +R TF+GTP+WMAPEVI       + YD+++D+WSLG+TAIE+A+G PP  ++HPMR LFLIP+NP P+L    +SK F  F + CL K    R    +LL H FI++          L++ IDR +K + E
Sbjct:   42 IATYYGAFIKKSPPGHDDQLWLVMEFCGAGSVTDLVKNTKGNSLKEDWIAYICREILRGLSHLHAHRVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSLGVTAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKRFLSFAESCLVKNYLQRLPTEQLLKHPFIREQPNERQVRIQLKDHIDRTRKKRGE 275          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010511.1 (pep scaffold:Pmarinus_7.0:GL476756:358747:414819:1 gene:ENSPMAG00000009510.1 transcript:ENSPMAT00000010511.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 216.083 bits (549), Expect = 2.869e-60
Identity = 107/225 (47.56%), Postives = 152/225 (67.56%), Query Frame = 1
Query:  319 VLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMK-PGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVI---KQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKN----PSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKKAKKTAYLQELIDR 969
            ++ +C    +  YFGSYL+  KLWI MEY GGGS  D+    GPL+E  IA + RE LKGL YLHS+ K+HRDIK AN+LL+++G+VKLADFGV+ Q+T T  KR++F+GTP+WMAPEV    ++  Y+ + D+W++GITAIELA+ +PP  +LHPMR LFL+ K+    P  +    +S +F +F+   L K P  RP+A +LL   F+ +    +   EL+D+
Sbjct:   34 MMQECQHINIVAYFGSYLRWDKLWICMEYCGGGSLQDIYHVTGPLSERQIAYVSRETLKGLAYLHSKCKMHRDIKGANILLTDHGEVKLADFGVSAQITATIAKRMSFIGTPYWMAPEVAAVERKGGYNQQCDVWAVGITAIELAELQPPMFDLHPMRALFLMSKSNFQPPRLKDKVKWSGIFHNFIKQSLIKNPKKRPTADKLLQDPFVIQPLNRSLATELLDQ 258          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: SPS1 (Putative protein serine/threonine kinase; localizes to the nucleus and cytoplasm; required for efficient spore packaging, prospore membrane development and closure and localization of enzymes involved in spore wall synthesis; interacts with and required for Ssp1p phosphorylation and turnover; member of the GCKIII subfamily of STE20 kinases; multiply phosphorylated on S/T residues; interacts with 14-3-3 proteins, Bmh1p and Bmh2p; expressed at the end of meiosis [Source:SGD;Acc:S000002931])

HSP 1 Score: 237.269 bits (604), Expect = 4.298e-71
Identity = 133/274 (48.54%), Postives = 185/274 (67.52%), Query Frame = 1
Query:  121 MPDRNMNIRSNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLN---ETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVI--KQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIK 927
            M  + ++IRS   P  +Y +   IG+G+FG+V+K V+++ + IVAIK+++LE ++++IE + QEI  L++  SP +T Y  + L+   +WI+MEY GGGS  DL+K   +N   E  ++ I+ E+  GL YLH Q+K+HRDIKAAN+LL+E G VKL DFGV+G + +T  KR TFVGTP+WMAPEV+  +   Y+ KADIWSLGIT  EL KG PP S   PM+V+  +PK   P+L G FS   +DFV  CL K P +RPSA  LL   F+K
Sbjct:    1 MESKEISIRSRTPPSKLYSIQSCIGRGNFGDVYKAVDRVTQEIVAIKVVNLEHSDEDIELLAQEIFFLAELKSPLITNYIATMLEDVSMWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRKIHRDIKAANILLNEEGMVKLGDFGVSGHIRSTL-KRDTFVGTPYWMAPEVVCCEVDGYNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGPFSDAAKDFVAGCLVKTPADRPSAYNLLSFEFVK 273          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: KIC1 (Protein kinase of the PAK/Ste20 family, required for cell integrity; physically interacts with Cdc31p (centrin), which is a component of the spindle pole body; part of the RAM network that regulates cellular polarity and morphogenesis [Source:SGD;Acc:S000001144])

HSP 1 Score: 228.024 bits (580), Expect = 5.180e-64
Identity = 120/278 (43.17%), Postives = 176/278 (63.31%), Query Frame = 1
Query:  154 VDPETVYDVLERIGKGSFGEVHKGVN-KIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSA-YDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQL-DGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIK--KAKKTAYLQELIDRY 972
            +D  +++   E IG+G FG V+KG N K  +      +    ++++  +  ++   + S      +T+Y+GSYLK T LWIIME+  GGS   L++PG ++E YI +I+RE+L  L  +H    +HRDIKAANVL++  G+VKL DFGVA Q+  T+ +R T  GTP+WMAPEVI +   YD K DIWSLGIT  E+A G PP+ ++  +R + LI K+  P+L D S+S   ++F+  CL+++P  R SA +LL   FI+  KA  T+ L+ELI RY
Sbjct:   17 MDVSSLFKRTEVIGRGKFGVVYKGYNVKTGRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQISNITRYYGSYLKDTSLWIIMEHCAGGSLRSLLRPGKIDEKYIGVIMRELLVALKCIHKDNVIHRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRRQTMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLEDRSYSTSLKEFIALCLDEDPKERLSADDLLKSKFIRAHKATPTSILKELISRY 294          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: STE20 (Cdc42p-activated signal transducing kinase; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p; member of the PAK (p21-activated kinase) family [Source:SGD;Acc:S000000999])

HSP 1 Score: 202.601 bits (514), Expect = 1.340e-55
Identity = 116/277 (41.88%), Postives = 161/277 (58.12%), Query Frame = 1
Query:  142 IRSNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLD--GSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKK-AKKTAYLQELI 963
            I S+ DP T Y  L +IG+G+ G V+    +I   +         E + + E I  EI V+     P +  +  SY+    LW+IMEY+ GGS  D++    L E  I  + RE L GL++LHS+  LHRDIK+ N+LLS  GD+KL DFG   Q+     KR T VGTP+WMAPEV+ +  Y  K DIWSLGI  IE+ +GEPP+ N  P+R L+LI  N +P+L    + S   + F+D CL  EP++R SA ELLH  +I + A+  + L  L+
Sbjct:  610 ICSDGDPSTKYANLVKIGQGASGGVYTAY-EIGTNVSVAIKQMNLEKQPKKELIINEILVMKGSKHPNIVNFIDSYVLKGDLWVIMEYMEGGSLTDVVTHCILTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQINELNLKRTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATELLHDEYITEIAEANSSLAPLV 885          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: CLA4 (Cdc42p-activated signal transducing kinase; member of the PAK (p21-activated kinase) family, along with Ste20p and Skm1p; involved in septin ring assembly, vacuole inheritance, cytokinesis, sterol uptake regulation; phosphorylates Cdc3p and Cdc10p; CLA4 has a paralog, SKM1, that arose from the whole genome duplication [Source:SGD;Acc:S000005242])

HSP 1 Score: 190.274 bits (482), Expect = 1.035e-51
Identity = 113/307 (36.81%), Postives = 164/307 (53.42%), Query Frame = 1
Query:  151 NVDPETVYDVLERIGKGSFGEVHKGV---------------NKIDKTIVXXXXXXXXXXXXXXXXXXXXXN-VLSQCDSPY--VTKYFGSYLKVTK-LWIIMEYLGGGSAMDLMKPGPLN--------ETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLD--GSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKKAKKTAYLQELIDRYQKWK 984
            N DP   + V+E+ G+G+ G V+                  N ID+  V  K+   +    +    +  +N +L   DS +  +  +  +YL+    LW++ME++ GGS  D+++  P N        E  IA I+RE  +GL +LH +  +HRDIK+ NVLL     VK+ DFG   +LT+  +KR T VGTP+WMAPEV+KQ  YD K D+WSLGI  IE+ +GEPP+ N  P++ L+LI  N +P+L    S S   + F+  CL  +   R S  ELLHHGF   A     L  L++    WK
Sbjct:  539 NADPSQCFKVIEKAGQGASGSVYLAERTHIPTESNMIELINNDIDEPHVGDKVAIKQMVLSKQPRKELIVNEILVMKDSRHKNIVNFLEAYLRTDDDLWVVMEFMEGGSLTDIIENSPTNDNSHSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRARVKITDFGFCARLTDKRSKRATMVGTPYWMAPEVVKQREYDEKIDVWSLGIMTIEMLEGEPPYLNEDPLKALYLIATNGTPKLKHPESLSLEIKRFLSVCLCVDVRYRASTEELLHHGFFNMACDPKDLTSLLE----WK 841          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: SKM1 (Member of the PAK family of serine/threonine protein kinases; similar to Ste20p; involved in down-regulation of sterol uptake; proposed to be a downstream effector of Cdc42p during polarized growth; SKM1 has a paralog, CLA4, that arose from the whole genome duplication [Source:SGD;Acc:S000005473])

HSP 1 Score: 182.57 bits (462), Expect = 9.989e-50
Identity = 88/196 (44.90%), Postives = 124/196 (63.27%), Query Frame = 1
Query:  382 KLWIIMEYLGGGSAMDLMK----------PGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLD--GSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKKA 933
            +LW+IMEY+ GG   D++             PLNE  +A I++E  +GL +LH++K +HRDIK+ N+LL+  G VK+ DFG   +LT   +KR T VGTP+WMAPE++ Q  YD K D+WSLGI  IE+ +GEPP+ N  P++ L+LI  N SP+L    S SK  + F+D CL    ++R S R+LL   F+  A
Sbjct:  447 ELWVIMEYMEGGCLTDILDAVARSNTGEHSSPLNENQMAYIVKETCQGLKFLHNKKIIHRDIKSDNILLNSQGLVKITDFGFCVELTEKRSKRATMVGTPYWMAPEIVNQKGYDEKVDVWSLGIMLIEMIEGEPPYLNEDPLKALYLIANNGSPKLRHPESVSKQTKQFLDACLQVNVESRASVRKLLTFEFLSMA 642          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO31934 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWI4])

HSP 1 Score: 404.831 bits (1039), Expect = 2.844e-136
Identity = 217/276 (78.62%), Postives = 243/276 (88.04%), Query Frame = 1
Query:  157 DPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKKAKKTAYLQELIDRYQKWK 984
            DPE ++  LERIGKGSFGEV KG++     +VAIKIIDLEEAEDEIEDIQQEI VLSQCDS YVTKY GSYLK TKLWIIMEYLGGGSA+DLMK G + E YIA ILRE+LKGLDYLH++KKLHRDIKAANVL+SE GDVKLADFGVAGQLT+T NKR TFVGTPFWMAPEVIKQSAYD KADIWSLGITAIELAKGEPP+S+LHPMRVLFLIPKN  P+L G+FSK F++FV  CLNK+P++RP+A+ELL H FIK AKK AYL ELI+R++KWK
Sbjct:    6 DPEKLFSKLERIGKGSFGEVFKGIDNRTNEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSLYVTKYHGSYLKGTKLWIIMEYLGGGSALDLMKAGNIEEFYIATILREVLKGLDYLHTEKKLHRDIKAANVLMSETGDVKLADFGVAGQLTDTLNKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNNPPELTGNFSKAFKEFVSLCLNKDPNDRPTAKELLKHRFIKTAKKNAYLVELIERHKKWK 281          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO42845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0A9])

HSP 1 Score: 286.96 bits (733), Expect = 1.604e-91
Identity = 144/272 (52.94%), Postives = 191/272 (70.22%), Query Frame = 1
Query:  160 PETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMK--PGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLD--GSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKKAKKTAYLQELI 963
            PE V+DVLE++G+GS+G V K ++K    +VAIK + ++    EI       +++ QCDSPYV KY+GSY K T LWI+MEY G GS  DLMK     L E  I  +L+  LKGL+YLH ++K+HRDIKA N+LL+  G  KLADFGVAGQLT+T  KR T +GTPFWMAPEVI++  YD  ADIWSLGITA+E+A+G+PP++++HPMR +F+IP  P P     G +S+ F+DFV  CL K P+ R +A ELL H FI+ AK+ + L  +I
Sbjct:   20 PEEVFDVLEKLGEGSYGSVFKAMHKESGQVVAIKQVPVDTDLQEIIKEI---SMMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDLMKIRNKTLTEEEIKCVLKYTLKGLEYLHLRRKIHRDIKAGNILLNSEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEVGYDCLADIWSLGITAMEMAEGKPPYADIHPMRAIFMIPTKPPPTFRDPGQWSEDFKDFVSKCLVKNPEERATATELLQHSFIQGAKQISILSSMI 288          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO49047 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHW1])

HSP 1 Score: 226.098 bits (575), Expect = 1.678e-68
Identity = 126/289 (43.60%), Postives = 181/289 (62.63%), Query Frame = 1
Query:  148 SNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDL-MKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPE---VIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKN----PSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKKAKKTAYLQELIDRYQKWKAE 990
            S  +P+ V+D++E++G G++G+V K    I    +A   +   E  D+ E IQQEI ++ QC    +  Y G+Y++  KLWI MEY GGGS  D+    GP +ET I+ +  E LKGL YLH +  +HRDIK AN+LL+ NG+VKLADFG++ ++T T  KR +F+GTP+WMAPE   V +   YD K DIW++GITAIE+A+ +PP  +LHPMR L++I K     P+ +    +S     F+   L K P  RPSA ++L H F  +    A LQ+L+DRY++   E
Sbjct:   10 SRGNPDKVFDLIEKVGGGTYGDVFKA-RVIATGDLAAVKVVKVEPGDDFELIQQEIAMMQQCRHNNIINYIGAYMRRDKLWIGMEYCGGGSIQDVYCVTGPCSETQISFVTVETLKGLAYLHEKSLMHRDIKGANILLTTNGEVKLADFGISARITETMKKRKSFIGTPYWMAPEMAAVERTGGYDLKCDIWAVGITAIEMAELQPPMFDLHPMRALYIIGKKSFIPPTLKEKDKWSNEMHHFIKVALIKNPKKRPSADKMLTHPFCCRHLTKAVLQDLLDRYRRKSQE 297          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO40961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5T6])

HSP 1 Score: 222.246 bits (565), Expect = 4.493e-67
Identity = 129/301 (42.86%), Postives = 193/301 (64.12%), Query Frame = 1
Query:  157 DPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQ-CDSPYVTKYFGSYLKVT------KLWIIMEYLGGGSAMDLMKPG---PLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIK-----QSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKN--PSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKKAKKTAY-----LQELIDRYQKWKAEA 993
            DP  ++D++E +G G++G+VHKG +K  +T     I  ++  EDE E+I+ EINVL +  +   +  Y+G+++K +      +LW++ME+ G GS  DL+K      L E +I+ I RE+L G+ +LH    +HRDIK  NVLL+E+ +VKL DFGV+ QL  T  +R TF+GTP+WMAPEVI       + YD + D+WS+GITAIE+A+ +PP  ++HPMR LFLIP++  P  +   S+SK F  FV+ CL K+  +RP+A +LL H FIK  + +       L++ IDR +K K E+
Sbjct:   15 DPAGIFDLVEVVGNGTYGQVHKGRHK--RTGQLTAIKIMDVTEDEEEEIKLEINVLRKFSNHRNIATYYGAFIKKSLQGQDDQLWLVMEFCGAGSVTDLVKTARNKALKEEWISYICREVLNGVSHLHMNHVIHRDIKGQNVLLTESAEVKLVDFGVSAQLDRTIGRRNTFIGTPYWMAPEVIACDEQPDATYDNRCDMWSIGITAIEMAESQPPLCDMHPMRALFLIPRSDPPKLKSKKSWSKRFHHFVNTCLIKDYQHRPTADQLLQHEFIKDVRSSERKIRIELKDFIDRMRKKKGES 313          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO33667 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRJ0])

HSP 1 Score: 210.69 bits (535), Expect = 1.165e-60
Identity = 115/271 (42.44%), Postives = 166/271 (61.25%), Query Frame = 1
Query:  157 DPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLD--GSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKKAKKTAYLQELI 963
            DP+  Y   E+IG+G+ G V+  +       VAIK ++L +   +   I + + V+ +   P +  Y  SYL   +LW++MEYL GGS  D++    ++E  IA + RE L+ L++LHS   +HRDIK+ N+LL  +G VKL DFG    +T   NKR T VGTP+WMAPEV+ +  Y  + D+WSLGI AIE+ +GEPP+ N +P+R L+LI  N +P+L      S +F+DF+   L  + + R SARELL H F+K+AK  A L  LI
Sbjct:  221 DPKKKYTKFEKIGQGASGTVYTAIEVATGHEVAIKQMNLSQQPKKELIINEIL-VMRENKHPNIVNYVDSYLVGEELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNGVIHRDIKSDNILLGMDGQVKLTDFGFCATITPEQNKRSTMVGTPYWMAPEVVTRKQYGPRVDVWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELAHPEKLSPVFKDFLAQSLEMDVEKRSSARELLQHPFLKQAKPLASLVPLI 490          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: stk25b (serine/threonine kinase 25 [Source:NCBI gene;Acc:101157729])

HSP 1 Score: 418.698 bits (1075), Expect = 1.012e-140
Identity = 224/290 (77.24%), Postives = 255/290 (87.93%), Query Frame = 1
Query:  130 RNM-NIRSNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKK-AKKTAYLQELIDRYQKWKAEA 993
            R+M N  +++DPE  +   ERIGKGSFGEV+KG+N   K +VAIKIIDLEEAEDEIEDIQQEI VLSQCDSPYVTKY+GSYLK TKLWIIMEYLGGGSA+DL++PGPL ETYIA ILREILKGL+YLHS++K+HRDIKAANVLLSE GDVKLADFGVAGQLT+T  KR TFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPP+S+LHPMRVLFLIPKN  P L+G +SK F++FV+ CLNK+P  RP+A+ELL H FI +  KKTAYL ELIDRY++WK+E 
Sbjct:    5 RDMQNQNTHLDPEEYFTKQERIGKGSFGEVYKGINNRTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKGTKLWIIMEYLGGGSALDLLRPGPLEETYIATILREILKGLEYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNTPPTLEGPYSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTAYLTELIDRYRRWKSEG 294          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: stk25b (serine/threonine kinase 25 [Source:NCBI gene;Acc:101157729])

HSP 1 Score: 418.313 bits (1074), Expect = 1.101e-140
Identity = 224/290 (77.24%), Postives = 255/290 (87.93%), Query Frame = 1
Query:  130 RNM-NIRSNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKK-AKKTAYLQELIDRYQKWKAEA 993
            R+M N  +++DPE  +   ERIGKGSFGEV+KG+N   K +VAIKIIDLEEAEDEIEDIQQEI VLSQCDSPYVTKY+GSYLK TKLWIIMEYLGGGSA+DL++PGPL ETYIA ILREILKGL+YLHS++K+HRDIKAANVLLSE GDVKLADFGVAGQLT+T  KR TFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPP+S+LHPMRVLFLIPKN  P L+G +SK F++FV+ CLNK+P  RP+A+ELL H FI +  KKTAYL ELIDRY++WK+E 
Sbjct:    5 RDMQNQNTHLDPEEYFTKQERIGKGSFGEVYKGINNRTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKGTKLWIIMEYLGGGSALDLLRPGPLEETYIATILREILKGLEYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNTPPTLEGPYSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTAYLTELIDRYRRWKSEG 294          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: stk24b (serine/threonine kinase 24 [Source:NCBI gene;Acc:101160144])

HSP 1 Score: 407.142 bits (1045), Expect = 3.490e-136
Identity = 217/282 (76.95%), Postives = 249/282 (88.30%), Query Frame = 1
Query:  148 SNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFI-KKAKKTAYLQELIDRYQKWKAE 990
            + VDPE ++  LERIGKGSFGEV KG++   + +VAIKIIDLEEAEDEIEDIQQEI VLSQCDSP+VTKY+GSYLK TKLWIIMEYLGGGSA+DLM+PGPL+ET IA ILREILKGL+YLHS+KK+HRDIKAANVLLSE G+VKLADFGVAGQLT+T  KR TFVGTPFWMAPEVIKQSAYD KADIWSLGITAIELAKGEPPHS+LHPM+VLFLIPKN  P L+GS+ K  ++FV+ CLNKEP  RP+A+ELL H  I + AKKT+YL EL+D+Y++WKAE
Sbjct:   16 ARVDPEELFTKLERIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPFVTKYYGSYLKDTKLWIIMEYLGGGSALDLMEPGPLDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSDLHPMKVLFLIPKNNPPTLEGSYCKPLKEFVEACLNKEPSFRPTAKELLKHKLIVRYAKKTSYLTELVDKYKRWKAE 297          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: ENSORLT00000045138.1 (serine/threonine kinase 26 [Source:NCBI gene;Acc:101158974])

HSP 1 Score: 399.823 bits (1026), Expect = 8.737e-134
Identity = 209/283 (73.85%), Postives = 245/283 (86.57%), Query Frame = 1
Query:  148 SNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFI-KKAKKTAYLQELIDRYQKWKAEA 993
            S +DPE ++  L+RIGKGSFGEV KG++   +++VAIK IDLEEAEDEIEDIQQEI VLSQCDSPY+TKYFGSYLK +KLWIIMEYLGGGSA+DL++ GP +E+ IA +L+EILKGLDYLHS+KK+HRDIKAANVLLSE+G VKLADFGVAGQLT+T  KR TFVGTPFWMAPEVI+QSAYD KADIWSLGITAIELAKGEPP+S++HPMRVLF IPK+P P L G FSK F++F + CLNK+P  RP+A+ELL H FI K  KKT+YL ELIDRY++WK E 
Sbjct:    9 SQIDPEELFTKLDRIGKGSFGEVFKGIDNRSQSVVAIKTIDLEEAEDEIEDIQQEITVLSQCDSPYITKYFGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDESQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEHGQVKLADFGVAGQLTDTQIKRETFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFHIPKSPPPTLSGDFSKSFKEFTEACLNKDPAFRPTAKELLKHKFITKHCKKTSYLSELIDRYRRWKEEG 291          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: ENSORLT00000004137.2 (serine/threonine kinase 26 [Source:NCBI gene;Acc:101158974])

HSP 1 Score: 398.282 bits (1022), Expect = 2.145e-133
Identity = 209/283 (73.85%), Postives = 245/283 (86.57%), Query Frame = 1
Query:  148 SNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFI-KKAKKTAYLQELIDRYQKWKAEA 993
            S +DPE ++  L+RIGKGSFGEV KG++   +++VAIK IDLEEAEDEIEDIQQEI VLSQCDSPY+TKYFGSYLK +KLWIIMEYLGGGSA+DL++ GP +E+ IA +L+EILKGLDYLHS+KK+HRDIKAANVLLSE+G VKLADFGVAGQLT+T  KR TFVGTPFWMAPEVI+QSAYD KADIWSLGITAIELAKGEPP+S++HPMRVLF IPK+P P L G FSK F++F + CLNK+P  RP+A+ELL H FI K  KKT+YL ELIDRY++WK E 
Sbjct:    3 SQIDPEELFTKLDRIGKGSFGEVFKGIDNRSQSVVAIKTIDLEEAEDEIEDIQQEITVLSQCDSPYITKYFGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDESQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEHGQVKLADFGVAGQLTDTQIKRETFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFHIPKSPPPTLSGDFSKSFKEFTEACLNKDPAFRPTAKELLKHKFITKHCKKTSYLSELIDRYRRWKEEG 285          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000010489.1 (SMESG000010489.1)

HSP 1 Score: 783.867 bits (2023), Expect = 0.000e+0
Identity = 461/462 (99.78%), Postives = 462/462 (100.00%), Query Frame = 1
Query:  121 MPDRNMNIRSNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKKAKKTAYLQELIDRYQKWKAEAXXXXXXXXXXXXXXXXXXHRPVTTQGARDKGTFKWNFDTVKASGAAVMATVMATNPEAVLMRAEGVTGVQIPRSSLVXXXXXXXXXXXXXXXXXXXRVPLSPSQGFMXXXXXXXXXXXXXXXVQVLPIVPGPRSSYVPAPVPAVHERPHGSSSGQASHTLRHQILPVLKDV 1506
            MPDRNMNIRSNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVAIKIIDLEEAEDEIEDIQQEINVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKKAKKTAYLQELIDRYQKWKAEADNQGDSDSDDDGLVPDDDHRPVTTQGARDKGTFKWNFDTVKASGAAVMATVMATNPEAVLMRAEGVTGVQIPRSSLVASTAGSPATAAPTAQGAPGRVPLSPSQGFMSSPPDARRSAPPAGSVQVLPIVPGPRSSYVPAPVPAVHERPHGSSSGQASHTLRHQILPVLKD+
Sbjct:    1 MPDRNMNIRSNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVAIKIIDLEEAEDEIEDIQQEINVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKKAKKTAYLQELIDRYQKWKAEADNQGDSDSDDDGLVPDDDHRPVTTQGARDKGTFKWNFDTVKASGAAVMATVMATNPEAVLMRAEGVTGVQIPRSSLVASTAGSPATAAPTAQGAPGRVPLSPSQGFMSSPPDARRSAPPAGSVQVLPIVPGPRSSYVPAPVPAVHERPHGSSSGQASHTLRHQILPVLKDL 462          

HSP 2 Score: 140.969 bits (354), Expect = 2.451e-35
Identity = 67/68 (98.53%), Postives = 67/68 (98.53%), Query Frame = 3
Query: 1545 QLEAVYSRVAGGRHQPIAELTAAFEMVDSISPTYTSQFLSELLYRVFDNCPRLSEAQKRRALNQIKGS 1748
             LEAVYSRVAGGRHQPIAELTAAFEMVDSISPTYTSQFLSELLYRVFDNCPRLSEAQKRRALNQIKGS
Sbjct:  461 DLEAVYSRVAGGRHQPIAELTAAFEMVDSISPTYTSQFLSELLYRVFDNCPRLSEAQKRRALNQIKGS 528          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000018196.1 (SMESG000018196.1)

HSP 1 Score: 251.136 bits (640), Expect = 1.060e-75
Identity = 125/255 (49.02%), Postives = 175/255 (68.63%), Query Frame = 1
Query:  157 DPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMK--PGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQL--DGSFSKLFRDFVDCCLNKEPDNRPSARELL 909
            +P  V+ +  ++GKGS+G V+K  +K +   VA K++ ++    +I       +++ QC S Y+ +Y+GS+     LWI+MEY G GS  D+M+      NE  IAIIL+  LKGL+Y+H  KK+HRDIKA N+LL+E+G+ KLADFGVAGQL++T  KR T +GTP+WMAPEVI++  Y + ADIWSLGITAIE+A G+PP++++HPMR LF+IP  P P L     +S  F +F+  CL K PD RPSA +LL
Sbjct:   12 EPSEVFQIESKLGKGSYGSVYKAKHKKNGFTVAAKLVPVDSELSDIVKEI---SIMQQCKSDYIVQYYGSFYDSHDLWIVMEYCGAGSVSDIMRLRNKTCNEEEIAIILQGSLKGLEYIHQLKKIHRDIKAGNILLTEDGNAKLADFGVAGQLSDTLAKRNTVIGTPYWMAPEVIQEIGYHYSADIWSLGITAIEMADGKPPYADIHPMRALFMIPSQPPPTLLNPSIWSPSFVNFITQCLVKNPDQRPSASQLL 263          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000029685.1 (SMESG000029685.1)

HSP 1 Score: 229.95 bits (585), Expect = 2.829e-64
Identity = 125/274 (45.62%), Postives = 173/274 (63.14%), Query Frame = 1
Query:  157 DPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKP--GPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVI---KQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIP----KNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKKAKKTAYL 951
            DP+  Y +++ IG G++GEV+K +++ + T V+   I   + +D+I+ I QEI+ L  C+   + KYFGSYL+  KLWI ME+ GG S  D+      PL E  IA + R+ L GL Y+H Q K+HRDIK AN+LL+E+G VK+ADFGVA Q+T T  KR +F+GTP+WMAPEV    ++  YD K DIW++GITAIE A+ +PP  +LHPM+ L L+     K P  Q    +S+ F  F+  CLNK    RP A  LL H F+ +   T  L
Sbjct:   22 DPKEDYKLIKNIGSGTYGEVYKAIHRRNNT-VSAVKIVKVDIKDDIKAIAQEIHTLRDCNHKNIVKYFGSYLRKNKLWICMEFCGGFSIQDIYTNIRRPLEENCIAYVTRDTLDGLAYMHKQGKIHRDIKGANILLTEDGQVKIADFGVAAQITQTIQKRCSFIGTPYWMAPEVAAVERKGGYDEKCDIWAVGITAIEYAELQPPMFDLHPMKALHLLSMRNYKAPVLQNKTKWSQKFHSFLKICLNKNEKRRPDAMTLLQHDFVTQKNLTISL 294          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000029685.1 (SMESG000029685.1)

HSP 1 Score: 229.95 bits (585), Expect = 2.921e-64
Identity = 125/274 (45.62%), Postives = 173/274 (63.14%), Query Frame = 1
Query:  157 DPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKP--GPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVI---KQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIP----KNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKKAKKTAYL 951
            DP+  Y +++ IG G++GEV+K +++ + T V+   I   + +D+I+ I QEI+ L  C+   + KYFGSYL+  KLWI ME+ GG S  D+      PL E  IA + R+ L GL Y+H Q K+HRDIK AN+LL+E+G VK+ADFGVA Q+T T  KR +F+GTP+WMAPEV    ++  YD K DIW++GITAIE A+ +PP  +LHPM+ L L+     K P  Q    +S+ F  F+  CLNK    RP A  LL H F+ +   T  L
Sbjct:   20 DPKEDYKLIKNIGSGTYGEVYKAIHRRNNT-VSAVKIVKVDIKDDIKAIAQEIHTLRDCNHKNIVKYFGSYLRKNKLWICMEFCGGFSIQDIYTNIRRPLEENCIAYVTRDTLDGLAYMHKQGKIHRDIKGANILLTEDGQVKIADFGVAAQITQTIQKRCSFIGTPYWMAPEVAAVERKGGYDEKCDIWAVGITAIEYAELQPPMFDLHPMKALHLLSMRNYKAPVLQNKTKWSQKFHSFLKICLNKNEKRRPDAMTLLQHDFVTQKNLTISL 292          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000029685.1 (SMESG000029685.1)

HSP 1 Score: 229.95 bits (585), Expect = 3.126e-64
Identity = 125/274 (45.62%), Postives = 173/274 (63.14%), Query Frame = 1
Query:  157 DPETVYDVLERIGKGSFGEVHKGVNKIDKTIVXXXXXXXXXXXXXXXXXXXXXNVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKP--GPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVI---KQSAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIP----KNPSPQLDGSFSKLFRDFVDCCLNKEPDNRPSARELLHHGFIKKAKKTAYL 951
            DP+  Y +++ IG G++GEV+K +++ + T V+   I   + +D+I+ I QEI+ L  C+   + KYFGSYL+  KLWI ME+ GG S  D+      PL E  IA + R+ L GL Y+H Q K+HRDIK AN+LL+E+G VK+ADFGVA Q+T T  KR +F+GTP+WMAPEV    ++  YD K DIW++GITAIE A+ +PP  +LHPM+ L L+     K P  Q    +S+ F  F+  CLNK    RP A  LL H F+ +   T  L
Sbjct:   22 DPKEDYKLIKNIGSGTYGEVYKAIHRRNNT-VSAVKIVKVDIKDDIKAIAQEIHTLRDCNHKNIVKYFGSYLRKNKLWICMEFCGGFSIQDIYTNIRRPLEENCIAYVTRDTLDGLAYMHKQGKIHRDIKGANILLTEDGQVKIADFGVAAQITQTIQKRCSFIGTPYWMAPEVAAVERKGGYDEKCDIWAVGITAIEYAELQPPMFDLHPMKALHLLSMRNYKAPVLQNKTKWSQKFHSFLKICLNKNEKRRPDAMTLLQHDFVTQKNLTISL 294          
The following BLAST results are available for this feature:
BLAST of Serine/threonine kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STK251.832e-14077.62serine/threonine kinase 25 [Source:HGNC Symbol;Acc... [more]
STK251.832e-14077.62serine/threonine kinase 25 [Source:HGNC Symbol;Acc... [more]
STK251.832e-14077.62serine/threonine kinase 25 [Source:HGNC Symbol;Acc... [more]
STK241.287e-13675.86serine/threonine kinase 24 [Source:HGNC Symbol;Acc... [more]
STK241.799e-13677.86serine/threonine kinase 24 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gck-11.798e-12672.50Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-11.115e-12572.66Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-11.490e-12572.66Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-13.482e-12472.50Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-17.733e-10767.26Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GckIII7.136e-13877.39gene:FBgn0266465 transcript:FBtr0083399[more]
hpo1.021e-8351.82gene:FBgn0261456 transcript:FBtr0331920[more]
hpo1.021e-8351.82gene:FBgn0261456 transcript:FBtr0086500[more]
hppy6.204e-6946.13gene:FBgn0263395 transcript:FBtr0340454[more]
hppy6.742e-6946.13gene:FBgn0263395 transcript:FBtr0340456[more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk25b1.031e-14176.87serine/threonine kinase 25b [Source:ZFIN;Acc:ZDB-G... [more]
stk25a6.747e-14076.19serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-G... [more]
stk24b6.849e-13476.70serine/threonine kinase 24b (STE20 homolog, yeast)... [more]
stk267.090e-13474.56serine/threonine protein kinase 26 [Source:ZFIN;Ac... [more]
stk24b9.470e-13476.70serine/threonine kinase 24b (STE20 homolog, yeast)... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk251.751e-13876.33serine/threonine kinase 25 [Source:NCBI gene;Acc:5... [more]
stk255.762e-13876.51serine/threonine kinase 25 [Source:NCBI gene;Acc:5... [more]
stk251.004e-13776.51serine/threonine kinase 25 [Source:NCBI gene;Acc:5... [more]
stk251.041e-13776.51serine/threonine kinase 25 [Source:NCBI gene;Acc:5... [more]
slc39a71.313e-13775.77solute carrier family 39 member 7 [Source:Xenbase;... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Stk251.154e-13978.09serine/threonine kinase 25 (yeast) [Source:MGI Sym... [more]
Stk242.362e-13677.86serine/threonine kinase 24 [Source:MGI Symbol;Acc:... [more]
Stk261.563e-13274.13serine/threonine kinase 26 [Source:MGI Symbol;Acc:... [more]
Stk262.056e-13274.13serine/threonine kinase 26 [Source:MGI Symbol;Acc:... [more]
Stk251.652e-11383.86serine/threonine kinase 25 (yeast) [Source:MGI Sym... [more]
back to top
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O00506|STK25_HUMAN8.796e-14077.62Serine/threonine-protein kinase 25 OS=Homo sapiens... [more]
sp|Q3SWY6|STK25_BOVIN7.243e-13977.27Serine/threonine-protein kinase 25 OS=Bos taurus O... [more]
sp|Q9Z2W1|STK25_MOUSE8.070e-13978.09Serine/threonine-protein kinase 25 OS=Mus musculus... [more]
sp|Q9Y6E0|STK24_HUMAN6.181e-13675.86Serine/threonine-protein kinase 24 OS=Homo sapiens... [more]
sp|Q99KH8|STK24_MOUSE1.652e-13577.86Serine/threonine-protein kinase 24 OS=Mus musculus... [more]
back to top
BLAST of Serine/threonine kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DF875.317e-14874.69Protein kinase domain-containing protein OS=Macros... [more]
A0A267G9F95.496e-14874.69Protein kinase domain-containing protein OS=Macros... [more]
A0A4Z2CU101.140e-14174.74Serine/threonine-protein kinase 25 isoform 2 OS=Sc... [more]
G4VR951.831e-14066.20Serine/threonine kinase OS=Schistosoma mansoni OX=... [more]
C1LFW73.536e-14064.62Serine/threonine kinase 25 OS=Schistosoma japonicu... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk25a3.229e-14276.87serine/threonine-protein kinase 25 [Source:NCBI ge... [more]
stk25b4.015e-14276.53serine/threonine-protein kinase 25-like [Source:NC... [more]
stk25b9.950e-14178.09serine/threonine-protein kinase 25-like [Source:NC... [more]
ENSAMXT00000008518.21.736e-13577.42pep primary_assembly:Astyanax_mexicanus-2.0:19:145... [more]
stk263.609e-13375.36serine/threonine kinase 26 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk25a1.230e-13776.35serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-G... [more]
MAP4K31.220e-6545.26mitogen-activated protein kinase kinase kinase kin... [more]
slka2.765e-6142.21STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-0504... [more]
ENSPMAT00000000169.17.124e-6145.73pep scaffold:Pmarinus_7.0:GL478331:850:46844:1 gen... [more]
ENSPMAT00000010511.12.869e-6047.56pep scaffold:Pmarinus_7.0:GL476756:358747:414819:1... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SPS14.298e-7148.54Putative protein serine/threonine kinase; localize... [more]
KIC15.180e-6443.17Protein kinase of the PAK/Ste20 family, required f... [more]
STE201.340e-5541.88Cdc42p-activated signal transducing kinase; involv... [more]
CLA41.035e-5136.81Cdc42p-activated signal transducing kinase; member... [more]
SKM19.989e-5044.90Member of the PAK family of serine/threonine prote... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO319342.844e-13678.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428451.604e-9152.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490471.678e-6843.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409614.493e-6742.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO336671.165e-6042.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk25b1.012e-14077.24serine/threonine kinase 25 [Source:NCBI gene;Acc:1... [more]
stk25b1.101e-14077.24serine/threonine kinase 25 [Source:NCBI gene;Acc:1... [more]
stk24b3.490e-13676.95serine/threonine kinase 24 [Source:NCBI gene;Acc:1... [more]
ENSORLT00000045138.18.737e-13473.85serine/threonine kinase 26 [Source:NCBI gene;Acc:1... [more]
ENSORLT00000004137.22.145e-13373.85serine/threonine kinase 26 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Serine/threonine kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010489.12.451e-3599.78SMESG000010489.1[more]
SMESG000018196.11.060e-7549.02SMESG000018196.1[more]
SMESG000029685.12.829e-6445.62SMESG000029685.1[more]
SMESG000029685.12.921e-6445.62SMESG000029685.1[more]
SMESG000029685.13.126e-6445.62SMESG000029685.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022758 ID=SMED30022758|Name=Serine/threonine kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=2017bp
CAACGGTTGTTTTACCACTCTACTTTTTTATTCATTAAACAAATTTTAAA
TTGTCCTAAAAATTAAAATTAATTCACTTGCAATTAATAAATTTGATTTA
TTTTATCTTTTTTTCATATTATGCCAGATCGAAATATGAATATACGATCT
AATGTCGATCCGGAAACTGTTTATGATGTGTTAGAACGAATCGGAAAAGG
TTCTTTCGGTGAAGTTCATAAGGGTGTTAATAAAATAGACAAAACGATAG
TTGCGATAAAGATTATTGATTTAGAAGAAGCCGAAGATGAGATTGAGGAT
ATTCAACAAGAAATTAATGTATTATCACAATGTGACAGTCCCTATGTTAC
GAAGTACTTTGGATCCTACCTCAAAGTGACAAAATTGTGGATTATTATGG
AGTATTTAGGAGGAGGATCAGCTATGGATCTAATGAAGCCTGGTCCATTG
AATGAAACATATATTGCAATTATTTTACGAGAAATCCTAAAAGGTCTCGA
TTATCTTCATTCACAAAAGAAACTACATCGCGATATTAAAGCTGCGAATG
TTTTGCTGTCAGAAAATGGGGATGTGAAATTGGCGGATTTCGGTGTAGCG
GGACAGTTAACAAACACCACCAACAAGCGAGTCACATTCGTCGGTACCCC
GTTTTGGATGGCCCCCGAAGTTATCAAGCAATCTGCGTACGATTTCAAGG
CGGACATTTGGTCCTTGGGCATCACAGCGATCGAGCTGGCCAAGGGCGAG
CCTCCACATTCTAATCTACACCCGATGCGAGTACTCTTCCTTATTCCGAA
AAATCCTTCACCGCAACTCGACGGATCTTTTTCGAAACTATTCCGAGACT
TTGTCGATTGCTGCCTGAATAAGGAGCCGGATAATAGGCCGTCGGCAAGG
GAGCTGCTCCATCACGGATTCATCAAGAAGGCAAAGAAAACCGCATATCT
GCAGGAGCTGATCGATCGGTACCAGAAATGGAAGGCGGAGGCGGATAACC
AGGGCGACAGCGATTCCGATGATGACGGACTGGTTCCCGATGACGACCAC
AGGCCGGTGACGACGCAAGGAGCCCGCGACAAGGGCACATTCAAATGGAA
CTTCGACACGGTCAAGGCAAGTGGAGCTGCAGTCATGGCAACGGTCATGG
CAACCAATCCCGAGGCGGTGCTGATGCGTGCTGAGGGCGTGACGGGCGTG
CAGATTCCCCGGTCGAGTCTCGTTGCTAGCACTGCCGGCAGCCCAGCAAC
GGCGGCACCGACGGCACAAGGAGCACCTGGCCGGGTTCCCCTGTCACCGT
CACAGGGATTCATGAGCTCCCCTCCGGATGCCAGGCGGAGCGCTCCACCA
GCCGGCAGCGTGCAAGTGCTCCCCATCGTTCCGGGGCCGCGTTCCAGCTA
TGTTCCAGCGCCAGTGCCAGCAGTCCACGAGCGTCCCCATGGCAGCAGCA
GCGGGCAGGCGTCACACACGTTGCGGCATCAGATCCTGCCCGTTCTCAAG
GACGTAATCAATATCAATATATTATCGATATCACCGATTGCATTCAGCTC
GAGGCTGTCTACTCGCGAGTTGCCGGAGGCCGCCATCAGCCAATCGCTGA
GCTCACCGCCGCATTTGAGATGGTCGACTCGATTTCCCCGACTTACACAT
CTCAATTCCTGTCCGAGCTCCTCTATCGGGTATTCGACAACTGCCCCAGG
CTGTCCGAGGCACAGAAACGCCGGGCGCTCAATCAGATCAAGGGCTCGTG
ACGCACCACCGCCCGCTGGTGATTATTATTCCAGTGATTCCTCCTCACAG
GGCTTTATCGTTATCATTTACTACTGTTGCTATCCGACGGTTGCTATGAC
TTTCTCTAATAAATATTCGTCATTTCTTTTCATTTTTATCACTAATATGT
TCATTGGTTGCCATGGTGATCATATGCTCCTTGGTTACTAGAGATTTTGT
TTTTACTGTTGCTATGAAAGGTTAAAATAAATACTCGTTCTCTATTTAAT
ACAAATATAGTGAGTTG
back to top

protein sequence of SMED30022758-orf-1

>SMED30022758-orf-1 ID=SMED30022758-orf-1|Name=SMED30022758-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=607bp
MPDRNMNIRSNVDPETVYDVLERIGKGSFGEVHKGVNKIDKTIVAIKIID
LEEAEDEIEDIQQEINVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGS
AMDLMKPGPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENG
DVKLADFGVAGQLTNTTNKRVTFVGTPFWMAPEVIKQSAYDFKADIWSLG
ITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGSFSKLFRDFVDCCLN
KEPDNRPSARELLHHGFIKKAKKTAYLQELIDRYQKWKAEADNQGDSDSD
DDGLVPDDDHRPVTTQGARDKGTFKWNFDTVKASGAAVMATVMATNPEAV
LMRAEGVTGVQIPRSSLVASTAGSPATAAPTAQGAPGRVPLSPSQGFMSS
PPDARRSAPPAGSVQVLPIVPGPRSSYVPAPVPAVHERPHGSSSGQASHT
LRHQILPVLKDVININILSISPIAFSSRLSTRELPEAAISQSLSSPPHLR
WSTRFPRLTHLNSCPSSSIGYSTTAPGCPRHRNAGRSIRSRARDAPPPAG
DYYSSDSSSQGFIVIIYYCCYPTVAMTFSNKYSSFLFIFITNMFIGCHGD
HMLLGY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0006979response to oxidative stress
GO:0007163establishment or maintenance of cell polarity
GO:0007165signal transduction
GO:0016310phosphorylation
GO:0023014signal transduction by protein phosphorylation
GO:0032874positive regulation of stress-activated MAPK cascade
GO:0036481intrinsic apoptotic signaling pathway in response to hydrogen peroxide
GO:0042542response to hydrogen peroxide
GO:0045595regulation of cell differentiation
GO:0046777protein autophosphorylation
GO:0050772positive regulation of axonogenesis
GO:0051645Golgi localization
GO:0051683establishment of Golgi localization
GO:0090168Golgi reassembly
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0004702signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0005515protein binding
GO:0016301kinase activity
GO:0016740transferase activity
GO:0042803protein homodimerization activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0005737cytoplasm
GO:0005794Golgi apparatus
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 44..71
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 97..303
e-value: 2.3E-68
score: 231.5
NoneNo IPR availablePIRSFPIRSF000615TyrPK_CSF1-Rcoord: 118..328
e-value: 4.1E-16
score: 55.9
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 3..95
e-value: 4.4E-35
score: 122.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 523..552
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 290..318
NoneNo IPR availablePANTHERPTHR24361MITOGEN-ACTIVATED KINASE KINASE KINASEcoord: 7..306
NoneNo IPR availablePANTHERPTHR24361:SF698SERINE/THREONINE KINASE 25 (STE20 HOMOLOG, YEAST)-RELATEDcoord: 7..306
NoneNo IPR availableCDDcd06609STKc_MST3_likecoord: 18..288
e-value: 0.0
score: 526.043
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 18..268
e-value: 1.1E-95
score: 333.8
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 18..268
e-value: 3.9E-67
score: 226.4
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 18..268
score: 49.841
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 24..47
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 14..277