ETS domain-containing protein

Overview
NameETS domain-containing protein
Smed IDSMED30022748
Length (bp)1380
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ETS domain-containing protein (SMED30022748) t-SNE clustered cells

Violin plots show distribution of expression levels for ETS domain-containing protein (SMED30022748) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ETS domain-containing protein (SMED30022748) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ETS domain-containing protein (SMED30022748) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022748

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30022748SMESG000078333.1 SmedASXL_006465SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30022748SMESG000078333.1 dd_Smed_v4_11113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30022748SMESG000078333.1 dd_Smed_v4_11113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30022748SMESG000078333.1 dd_Smed_v6_11113_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30022748SMESG000078333.1 OX_Smed_1.0.05850ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ETS domain-containing protein vs. Ensembl Human
Match: ERG (ETS transcription factor ERG [Source:HGNC Symbol;Acc:HGNC:3446])

HSP 1 Score: 197.978 bits (502), Expect = 1.815e-57
Identity = 107/186 (57.53%), Postives = 121/186 (65.05%), Query Frame = 1
Query:  235 GLSSVIFPDSSYYTNKSNWMCKQDVGQ-----NPYPYSPLGSCSPCYSLGSTNKSQTNTNQWRPQGSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDL 777
            G ++ IFP++S Y   +  +  +   Q      P          P   LG T+    N       GSGQIQLWQFLLELLSDS N++ ITWEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP  P            E S+YKY  DL
Sbjct:  225 GGAAFIFPNTSVYPEATQRITTRPAAQPSPSTVPKTEDQRPQLDPYQILGPTSSRLANP------GSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPP------------ESSLYKYPSDL 392          
BLAST of ETS domain-containing protein vs. Ensembl Human
Match: FLI1 (Fli-1 proto-oncogene, ETS transcription factor [Source:HGNC Symbol;Acc:HGNC:3749])

HSP 1 Score: 191.815 bits (486), Expect = 1.847e-57
Identity = 94/121 (77.69%), Postives = 100/121 (82.64%), Query Frame = 1
Query:  415 GSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDL 777
            GSGQIQLWQFLLELLSDS N + ITWEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP  PT           E S+YKY  D+
Sbjct:   84 GSGQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQP-HPT-----------ESSMYKYPSDI 192          
BLAST of ETS domain-containing protein vs. Ensembl Human
Match: ERG (ETS transcription factor ERG [Source:HGNC Symbol;Acc:HGNC:3446])

HSP 1 Score: 197.978 bits (502), Expect = 1.895e-57
Identity = 107/186 (57.53%), Postives = 121/186 (65.05%), Query Frame = 1
Query:  235 GLSSVIFPDSSYYTNKSNWMCKQDVGQN-----PYPYSPLGSCSPCYSLGSTNKSQTNTNQWRPQGSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDL 777
            G ++ IFP++S Y   +  +  +   Q      P          P   LG T+    N       GSGQIQLWQFLLELLSDS N++ ITWEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP  P            E S+YKY  DL
Sbjct:  232 GGAAFIFPNTSVYPEATQRITTRPAAQPSPSTVPKTEDQRPQLDPYQILGPTSSRLANP------GSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPP------------ESSLYKYPSDL 399          
BLAST of ETS domain-containing protein vs. Ensembl Human
Match: ERG (ETS transcription factor ERG [Source:HGNC Symbol;Acc:HGNC:3446])

HSP 1 Score: 194.126 bits (492), Expect = 4.565e-57
Identity = 94/121 (77.69%), Postives = 100/121 (82.64%), Query Frame = 1
Query:  415 GSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDL 777
            GSGQIQLWQFLLELLSDS N++ ITWEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP  P            E S+YKY  DL
Sbjct:  191 GSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPP------------ESSLYKYPSDL 299          
BLAST of ETS domain-containing protein vs. Ensembl Human
Match: ERG (ETS transcription factor ERG [Source:HGNC Symbol;Acc:HGNC:3446])

HSP 1 Score: 194.512 bits (493), Expect = 6.850e-57
Identity = 94/121 (77.69%), Postives = 100/121 (82.64%), Query Frame = 1
Query:  415 GSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDL 777
            GSGQIQLWQFLLELLSDS N++ ITWEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP  P            E S+YKY  DL
Sbjct:  215 GSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPP------------ESSLYKYPSDL 323          
BLAST of ETS domain-containing protein vs. Ensembl Celegans
Match: ets-5 (ETS domain-containing transcription factor ets-5 [Source:UniProtKB/Swiss-Prot;Acc:Q18579])

HSP 1 Score: 184.111 bits (466), Expect = 1.362e-55
Identity = 90/132 (68.18%), Postives = 101/132 (76.52%), Query Frame = 1
Query:  415 GSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSG-PGASPTSFEPSIYKYQHDLFNSGVNPFLA 807
            G+GQIQLWQFLLELL+D+ N   I WEG+NGEFKL+DPDEVAR+WGERKSKPNMNYDKLSRALRYYYDKNIMTKV GKRYAYKFDF GLAQA Q A  T  G P    +S   S+  Y + +   GV   L+
Sbjct:   31 GTGQIQLWQFLLELLADAVNAHCIAWEGSNGEFKLVDPDEVARKWGERKSKPNMNYDKLSRALRYYYDKNIMTKVQGKRYAYKFDFQGLAQACQSAILTNGGNPNGDLSSTVHSLSPYTNQVLPIGVTSRLS 162          
BLAST of ETS domain-containing protein vs. Ensembl Celegans
Match: ets-5 (ETS domain-containing transcription factor ets-5 [Source:UniProtKB/Swiss-Prot;Acc:Q18579])

HSP 1 Score: 184.496 bits (467), Expect = 3.467e-55
Identity = 90/132 (68.18%), Postives = 101/132 (76.52%), Query Frame = 1
Query:  415 GSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSG-PGASPTSFEPSIYKYQHDLFNSGVNPFLA 807
            G+GQIQLWQFLLELL+D+ N   I WEG+NGEFKL+DPDEVAR+WGERKSKPNMNYDKLSRALRYYYDKNIMTKV GKRYAYKFDF GLAQA Q A  T  G P    +S   S+  Y + +   GV   L+
Sbjct:   69 GTGQIQLWQFLLELLADAVNAHCIAWEGSNGEFKLVDPDEVARKWGERKSKPNMNYDKLSRALRYYYDKNIMTKVQGKRYAYKFDFQGLAQACQSAILTNGGNPNGDLSSTVHSLSPYTNQVLPIGVTSRLS 200          
BLAST of ETS domain-containing protein vs. Ensembl Celegans
Match: ast-1 (Axon STeering defect [Source:UniProtKB/TrEMBL;Acc:Q22355])

HSP 1 Score: 187.963 bits (476), Expect = 6.625e-55
Identity = 97/154 (62.99%), Postives = 105/154 (68.18%), Query Frame = 1
Query:  262 SSYYTNKSNWMCKQDVGQNPYPYSPLGSCSPCYSLGSTNKSQTNTNQWRPQGSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGP 723
            SSYYT     +       NP PY  LG  S   +                 GSGQ QLWQFLLELLSD R +  ITWEGT GEFKL+DPDEVAR+WGERKSKPNMNYDK+SRALRYYYDKNIM KVHGKRYAYKFDF G+AQA+QP  PT S P
Sbjct:  175 SSYYTGALK-LSNSTSFANPDPYQILGPTSKNLA---------------HSGSGQTQLWQFLLELLSDKRYSEVITWEGTQGEFKLVDPDEVARKWGERKSKPNMNYDKMSRALRYYYDKNIMAKVHGKRYAYKFDFQGIAQALQP--PTASHP 310          
BLAST of ETS domain-containing protein vs. Ensembl Celegans
Match: lin-1 (LIN-1 [Source:UniProtKB/TrEMBL;Acc:G5EDL0])

HSP 1 Score: 122.865 bits (307), Expect = 9.827e-31
Identity = 53/81 (65.43%), Postives = 66/81 (81.48%), Query Frame = 1
Query:  427 IQLWQFLLELLSDSRNTTFITW-EGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF 666
            I LWQFLLELL   +N   I W  GT+GEF+LID + VAR+WG+RK+KP+MNYDKLSRALRYYY+KNI+ KV GK++ Y+F
Sbjct:   24 ITLWQFLLELLQQDQNGDIIEWTRGTDGEFRLIDAEAVARKWGQRKAKPHMNYDKLSRALRYYYEKNIIKKVIGKKFVYRF 104          
BLAST of ETS domain-containing protein vs. Ensembl Celegans
Match: lin-1 (LIN-1 [Source:UniProtKB/TrEMBL;Acc:G5EDL0])

HSP 1 Score: 122.865 bits (307), Expect = 9.827e-31
Identity = 53/81 (65.43%), Postives = 66/81 (81.48%), Query Frame = 1
Query:  427 IQLWQFLLELLSDSRNTTFITW-EGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF 666
            I LWQFLLELL   +N   I W  GT+GEF+LID + VAR+WG+RK+KP+MNYDKLSRALRYYY+KNI+ KV GK++ Y+F
Sbjct:   24 ITLWQFLLELLQQDQNGDIIEWTRGTDGEFRLIDAEAVARKWGQRKAKPHMNYDKLSRALRYYYEKNIIKKVIGKKFVYRF 104          
BLAST of ETS domain-containing protein vs. Ensembl Fly
Match: Ets65A (gene:FBgn0005658 transcript:FBtr0077055)

HSP 1 Score: 206.453 bits (524), Expect = 2.019e-63
Identity = 127/239 (53.14%), Postives = 145/239 (60.67%), Query Frame = 1
Query:  187 MHSMKQEDYYRACSFGGLS--SVIFPDSSYYTNKSNWMCKQDVGQNPY----------PYSPLGSCSPCYSLGSTNKSQTNTNQWRPQGSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDLFNSGVNPFLAPAWQHH---ISAGMSPTNGL 858
            M  +K    Y + S G  S  S++F DSSY   KS+W          Y          P+S L    P    G T+    ++      GSGQIQLWQFLLELLSDS N + ITWEGTNGEFKL DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF GLA A QPA+       + PT      YKYQ DLF   + P+      HH   +S+ MSP +G+
Sbjct:    1 MLDIKSSADYLSRSTGSFSNFSMLFADSSY---KSSWGSHSSTQSQGYSSNALGIKHDPHSQLRQPDPYQMFGPTSSRLASS------GSGQIQLWQFLLELLSDSNNASCITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFQGLAAATQPAA-------SDPT------YKYQSDLF---MTPY------HHSAKLSSFMSPHHGM 208          
BLAST of ETS domain-containing protein vs. Ensembl Fly
Match: Ets65A (gene:FBgn0005658 transcript:FBtr0077054)

HSP 1 Score: 203.371 bits (516), Expect = 1.302e-59
Identity = 105/151 (69.54%), Postives = 114/151 (75.50%), Query Frame = 1
Query:  415 GSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDLFNSGVNPFLAPAWQHH---ISAGMSPTNGL 858
            GSGQIQLWQFLLELLSDS N + ITWEGTNGEFKL DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF GLA A QPA+       + PT      YKYQ DLF   + P+      HH   +S+ MSP +G+
Sbjct:  313 GSGQIQLWQFLLELLSDSNNASCITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFQGLAAATQPAA-------SDPT------YKYQSDLF---MTPY------HHSAKLSSFMSPHHGM 441          
BLAST of ETS domain-containing protein vs. Ensembl Fly
Match: Ets65A (gene:FBgn0005658 transcript:FBtr0273355)

HSP 1 Score: 203.371 bits (516), Expect = 1.833e-59
Identity = 105/151 (69.54%), Postives = 114/151 (75.50%), Query Frame = 1
Query:  415 GSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDLFNSGVNPFLAPAWQHH---ISAGMSPTNGL 858
            GSGQIQLWQFLLELLSDS N + ITWEGTNGEFKL DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF GLA A QPA+       + PT      YKYQ DLF   + P+      HH   +S+ MSP +G+
Sbjct:  313 GSGQIQLWQFLLELLSDSNNASCITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFQGLAAATQPAA-------SDPT------YKYQSDLF---MTPY------HHSAKLSSFMSPHHGM 441          
BLAST of ETS domain-containing protein vs. Ensembl Fly
Match: Ets65A (gene:FBgn0005658 transcript:FBtr0347000)

HSP 1 Score: 203.756 bits (517), Expect = 2.164e-58
Identity = 105/151 (69.54%), Postives = 114/151 (75.50%), Query Frame = 1
Query:  415 GSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDLFNSGVNPFLAPAWQHH---ISAGMSPTNGL 858
            GSGQIQLWQFLLELLSDS N + ITWEGTNGEFKL DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF GLA A QPA+       + PT      YKYQ DLF   + P+      HH   +S+ MSP +G+
Sbjct:  313 GSGQIQLWQFLLELLSDSNNASCITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFQGLAAATQPAA-------SDPT------YKYQSDLF---MTPY------HHSAKLSSFMSPHHGM 441          
BLAST of ETS domain-containing protein vs. Ensembl Fly
Match: Ets65A (gene:FBgn0005658 transcript:FBtr0347001)

HSP 1 Score: 202.986 bits (515), Expect = 1.092e-57
Identity = 105/151 (69.54%), Postives = 114/151 (75.50%), Query Frame = 1
Query:  415 GSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDLFNSGVNPFLAPAWQHH---ISAGMSPTNGL 858
            GSGQIQLWQFLLELLSDS N + ITWEGTNGEFKL DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF GLA A QPA+       + PT      YKYQ DLF   + P+      HH   +S+ MSP +G+
Sbjct:  313 GSGQIQLWQFLLELLSDSNNASCITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFQGLAAATQPAA-------SDPT------YKYQSDLF---MTPY------HHSAKLSSFMSPHHGM 441          
BLAST of ETS domain-containing protein vs. Ensembl Zebrafish
Match: fev (FEV transcription factor, ETS family member [Source:NCBI gene;Acc:791175])

HSP 1 Score: 193.356 bits (490), Expect = 1.670e-58
Identity = 98/136 (72.06%), Postives = 104/136 (76.47%), Query Frame = 1
Query:  370 STNKSQTNTNQWRPQGSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDL 777
            S + S T  N    +GSGQIQLWQFLLELLSDS N T I WEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF GLAQ  QP+S             E +IYK+Q + 
Sbjct:   39 SKSPSWTPINTGVQKGSGQIQLWQFLLELLSDSANMTCIAWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFNGLAQVCQPSST------------EQAIYKFQSNF 162          
BLAST of ETS domain-containing protein vs. Ensembl Zebrafish
Match: fev (FEV transcription factor, ETS family member [Source:NCBI gene;Acc:791175])

HSP 1 Score: 192.2 bits (487), Expect = 2.528e-58
Identity = 98/136 (72.06%), Postives = 104/136 (76.47%), Query Frame = 1
Query:  370 STNKSQTNTNQWRPQGSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDL 777
            S + S T  N    +GSGQIQLWQFLLELLSDS N T I WEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF GLAQ  QP+S             E +IYK+Q + 
Sbjct:   19 SKSPSWTPINTGVQKGSGQIQLWQFLLELLSDSANMTCIAWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFNGLAQVCQPSST------------EQAIYKFQSNF 142          
BLAST of ETS domain-containing protein vs. Ensembl Zebrafish
Match: erg (ETS transcription factor ERG [Source:ZFIN;Acc:ZDB-GENE-041212-40])

HSP 1 Score: 191.815 bits (486), Expect = 9.793e-56
Identity = 92/117 (78.63%), Postives = 98/117 (83.76%), Query Frame = 1
Query:  415 GSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKY 765
            GSGQIQLWQFLLELLSDS N++ ITWEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP  P            + SIYKY
Sbjct:  253 GSGQIQLWQFLLELLSDSCNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPP------------DSSIYKY 357          
BLAST of ETS domain-containing protein vs. Ensembl Zebrafish
Match: fli1a (Fli-1 proto-oncogene, ETS transcription factor a [Source:ZFIN;Acc:ZDB-GENE-980526-426])

HSP 1 Score: 189.504 bits (480), Expect = 1.741e-54
Identity = 93/121 (76.86%), Postives = 99/121 (81.82%), Query Frame = 1
Query:  415 GSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDL 777
            GSGQIQLWQFLLELLSDS N   ITWEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP  PT           E ++YKY  +L
Sbjct:  285 GSGQIQLWQFLLELLSDSANAGCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQP-HPT-----------ESTMYKYPSEL 393          
BLAST of ETS domain-containing protein vs. Ensembl Zebrafish
Match: fli1a (Fli-1 proto-oncogene, ETS transcription factor a [Source:ZFIN;Acc:ZDB-GENE-980526-426])

HSP 1 Score: 189.119 bits (479), Expect = 1.914e-54
Identity = 93/121 (76.86%), Postives = 99/121 (81.82%), Query Frame = 1
Query:  415 GSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDL 777
            GSGQIQLWQFLLELLSDS N   ITWEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP  PT           E ++YKY  +L
Sbjct:  276 GSGQIQLWQFLLELLSDSANAGCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQP-HPT-----------ESTMYKYPSEL 384          
BLAST of ETS domain-containing protein vs. Ensembl Xenopus
Match: erg (v-ets avian erythroblastosis virus E26 oncogene homolog [Source:NCBI gene;Acc:100216056])

HSP 1 Score: 201.06 bits (510), Expect = 1.009e-58
Identity = 109/186 (58.60%), Postives = 123/186 (66.13%), Query Frame = 1
Query:  235 GLSSVIFPDSSYYTNKSNWMCKQDVG-----QNPYPYSPLGSCSPCYSLGSTNKSQTNTNQWRPQGSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDL 777
            G +S IFP++S Y + S  +  + V        P P   L    P   LG T+    N       GSGQIQLWQFLLELLSDS N+  ITWEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP  P            E ++YKY  +L
Sbjct:  228 GGASFIFPNTSVYQDASQRITSRQVKFAVCVTGPKPVYLLFVLDPYQILGPTSSRLANP------GSGQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPP------------ESTMYKYPSEL 395          
BLAST of ETS domain-containing protein vs. Ensembl Xenopus
Match: erg (v-ets avian erythroblastosis virus E26 oncogene homolog [Source:NCBI gene;Acc:100216056])

HSP 1 Score: 201.06 bits (510), Expect = 1.382e-58
Identity = 109/186 (58.60%), Postives = 123/186 (66.13%), Query Frame = 1
Query:  235 GLSSVIFPDSSYYTNKSNWMCKQDVG-----QNPYPYSPLGSCSPCYSLGSTNKSQTNTNQWRPQGSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDL 777
            G +S IFP++S Y + S  +  + V        P P   L    P   LG T+    N       GSGQIQLWQFLLELLSDS N+  ITWEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP  P            E ++YKY  +L
Sbjct:  234 GGASFIFPNTSVYQDASQRITSRQVKFAVCVTGPKPVYLLFVLDPYQILGPTSSRLANP------GSGQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPP------------ESTMYKYPSEL 401          
BLAST of ETS domain-containing protein vs. Ensembl Xenopus
Match: erg (v-ets avian erythroblastosis virus E26 oncogene homolog [Source:NCBI gene;Acc:100216056])

HSP 1 Score: 196.823 bits (499), Expect = 6.058e-57
Identity = 107/200 (53.50%), Postives = 129/200 (64.50%), Query Frame = 1
Query:  235 GLSSVIFPDSSYYTNKSNWMC-KQDVGQNP--------YPYSPLGSCSPCYSLGSTNKSQTNTNQWRPQG----------SGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDL 777
            G +S IFP++S Y + S  +  +QD+   P        +P  P  +  P  ++  T   +   + ++  G          SGQIQLWQFLLELLSDS N+  ITWEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP  P            E ++YKY  +L
Sbjct:  225 GGASFIFPNTSVYQDASQRITSRQDLSYEPSRRSAWTNHPAPPTKASQPPATVPKTEDPRPQLDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPP------------ESTMYKYPSEL 412          
BLAST of ETS domain-containing protein vs. Ensembl Xenopus
Match: erg (v-ets avian erythroblastosis virus E26 oncogene homolog [Source:NCBI gene;Acc:100216056])

HSP 1 Score: 196.823 bits (499), Expect = 6.914e-57
Identity = 107/200 (53.50%), Postives = 129/200 (64.50%), Query Frame = 1
Query:  235 GLSSVIFPDSSYYTNKSNWMC-KQDVGQNP--------YPYSPLGSCSPCYSLGSTNKSQTNTNQWRPQG----------SGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDL 777
            G +S IFP++S Y + S  +  +QD+   P        +P  P  +  P  ++  T   +   + ++  G          SGQIQLWQFLLELLSDS N+  ITWEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP  P            E ++YKY  +L
Sbjct:  234 GGASFIFPNTSVYQDASQRITSRQDLSYEPSRRSAWTNHPAPPTKASQPPATVPKTEDPRPQLDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPP------------ESTMYKYPSEL 421          
BLAST of ETS domain-containing protein vs. Ensembl Xenopus
Match: erg (v-ets avian erythroblastosis virus E26 oncogene homolog [Source:NCBI gene;Acc:100216056])

HSP 1 Score: 195.282 bits (495), Expect = 1.599e-56
Identity = 106/198 (53.54%), Postives = 128/198 (64.65%), Query Frame = 1
Query:  241 SSVIFPDSSYYTNKSNWMC-KQDVGQNP--------YPYSPLGSCSPCYSLGSTNKSQTNTNQWRPQG----------SGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDL 777
            +S IFP++S Y + S  +  +QD+   P        +P  P  +  P  ++  T   +   + ++  G          SGQIQLWQFLLELLSDS N+  ITWEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP  P            E ++YKY  +L
Sbjct:  209 ASFIFPNTSVYQDASQRITSRQDLSYEPSRRSAWTNHPAPPTKASQPPATVPKTEDPRPQLDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPP------------ESTMYKYPSEL 394          
BLAST of ETS domain-containing protein vs. Ensembl Mouse
Match: Erg (ETS transcription factor [Source:MGI Symbol;Acc:MGI:95415])

HSP 1 Score: 197.593 bits (501), Expect = 1.998e-57
Identity = 107/186 (57.53%), Postives = 120/186 (64.52%), Query Frame = 1
Query:  235 GLSSVIFPDSSYYTNKSNWMCKQDVGQ-----NPYPYSPLGSCSPCYSLGSTNKSQTNTNQWRPQGSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDL 777
            G ++ IFP++S Y   +  +  +   Q      P          P   LG T+    N       GSGQIQLWQFLLELLSDS N+  ITWEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP  P            E S+YKY  DL
Sbjct:  232 GGAAFIFPNTSVYPEATQRITTRPAAQPSPSAVPKTEDQRPQLDPYQILGPTSSRLANP------GSGQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPP------------ESSLYKYPSDL 399          
BLAST of ETS domain-containing protein vs. Ensembl Mouse
Match: Erg (ETS transcription factor [Source:MGI Symbol;Acc:MGI:95415])

HSP 1 Score: 197.208 bits (500), Expect = 2.171e-57
Identity = 107/186 (57.53%), Postives = 120/186 (64.52%), Query Frame = 1
Query:  235 GLSSVIFPDSSYYTNKSNWMCKQDVGQ-----NPYPYSPLGSCSPCYSLGSTNKSQTNTNQWRPQGSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDL 777
            G ++ IFP++S Y   +  +  +   Q      P          P   LG T+    N       GSGQIQLWQFLLELLSDS N+  ITWEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP  P            E S+YKY  DL
Sbjct:  225 GGAAFIFPNTSVYPEATQRITTRPAAQPSPSAVPKTEDQRPQLDPYQILGPTSSRLANP------GSGQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPP------------ESSLYKYPSDL 392          
BLAST of ETS domain-containing protein vs. Ensembl Mouse
Match: Erg (ETS transcription factor [Source:MGI Symbol;Acc:MGI:95415])

HSP 1 Score: 194.126 bits (492), Expect = 6.943e-57
Identity = 94/121 (77.69%), Postives = 99/121 (81.82%), Query Frame = 1
Query:  415 GSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDL 777
            GSGQIQLWQFLLELLSDS N+  ITWEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP  P            E S+YKY  DL
Sbjct:  215 GSGQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPP------------ESSLYKYPSDL 323          
BLAST of ETS domain-containing protein vs. Ensembl Mouse
Match: Erg (ETS transcription factor [Source:MGI Symbol;Acc:MGI:95415])

HSP 1 Score: 195.282 bits (495), Expect = 9.000e-57
Identity = 94/121 (77.69%), Postives = 99/121 (81.82%), Query Frame = 1
Query:  415 GSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDL 777
            GSGQIQLWQFLLELLSDS N+  ITWEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP  P            E S+YKY  DL
Sbjct:  267 GSGQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPP------------ESSLYKYPSDL 375          
BLAST of ETS domain-containing protein vs. Ensembl Mouse
Match: Erg (ETS transcription factor [Source:MGI Symbol;Acc:MGI:95415])

HSP 1 Score: 194.897 bits (494), Expect = 1.486e-56
Identity = 94/121 (77.69%), Postives = 99/121 (81.82%), Query Frame = 1
Query:  415 GSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDL 777
            GSGQIQLWQFLLELLSDS N+  ITWEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP  P            E S+YKY  DL
Sbjct:  283 GSGQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPP------------ESSLYKYPSDL 391          
BLAST of ETS domain-containing protein vs. UniProt/SwissProt
Match: sp|Q01414|ERG_LYTVA (Transcriptional regulator ERG homolog (Fragment) OS=Lytechinus variegatus OX=7654 GN=ERG PE=3 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 4.917e-60
Identity = 95/120 (79.17%), Postives = 99/120 (82.50%), Query Frame = 1
Query:  418 SGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDL 777
            SGQIQLWQFLLELLSDS N   ITWEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQP               +PS+Y+YQ DL
Sbjct:    1 SGQIQLWQFLLELLSDSSNANCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPVQA------------DPSMYRYQSDL 108          
BLAST of ETS domain-containing protein vs. UniProt/SwissProt
Match: sp|P29774|ETS3_DROME (DNA-binding protein D-ETS-3 OS=Drosophila melanogaster OX=7227 GN=Ets65A PE=2 SV=3)

HSP 1 Score: 203.371 bits (516), Expect = 1.305e-58
Identity = 105/151 (69.54%), Postives = 114/151 (75.50%), Query Frame = 1
Query:  415 GSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDLFNSGVNPFLAPAWQHH---ISAGMSPTNGL 858
            GSGQIQLWQFLLELLSDS N + ITWEGTNGEFKL DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF GLA A QPA+       + PT      YKYQ DLF   + P+      HH   +S+ MSP +G+
Sbjct:  313 GSGQIQLWQFLLELLSDSNNASCITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFQGLAAATQPAA-------SDPT------YKYQSDLF---MTPY------HHSAKLSSFMSPHHGM 441          
BLAST of ETS domain-containing protein vs. UniProt/SwissProt
Match: sp|A3FEM2|FEV_DANRE (Protein FEV OS=Danio rerio OX=7955 GN=fev PE=2 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 1.261e-57
Identity = 98/136 (72.06%), Postives = 104/136 (76.47%), Query Frame = 1
Query:  370 STNKSQTNTNQWRPQGSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDL 777
            S + S T  N    +GSGQIQLWQFLLELLSDS N T I WEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF GLAQ  QP+S             E +IYK+Q + 
Sbjct:   39 SKSPSWTPINTGVQKGSGQIQLWQFLLELLSDSANMTCIAWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFNGLAQVCQPSST------------EQAIYKFQSNF 162          
BLAST of ETS domain-containing protein vs. UniProt/SwissProt
Match: sp|P11308|ERG_HUMAN (Transcriptional regulator ERG OS=Homo sapiens OX=9606 GN=ERG PE=1 SV=2)

HSP 1 Score: 195.667 bits (496), Expect = 1.142e-55
Identity = 94/121 (77.69%), Postives = 100/121 (82.64%), Query Frame = 1
Query:  415 GSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDL 777
            GSGQIQLWQFLLELLSDS N++ ITWEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP  P            E S+YKY  DL
Sbjct:  314 GSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPP------------ESSLYKYPSDL 422          
BLAST of ETS domain-containing protein vs. UniProt/SwissProt
Match: sp|Q90837|ERG_CHICK (Transcriptional regulator Erg OS=Gallus gallus OX=9031 GN=ERG PE=2 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 1.329e-55
Identity = 94/121 (77.69%), Postives = 99/121 (81.82%), Query Frame = 1
Query:  415 GSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDL 777
            GSGQIQLWQFLLELLSDS N+  ITWEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP  P            E S+YKY  DL
Sbjct:  306 GSGQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPP------------ESSMYKYPSDL 414          
BLAST of ETS domain-containing protein vs. TrEMBL
Match: K1R5Y9 (Retroviral integration site protein Fli-1-like protein OS=Crassostrea gigas OX=29159 GN=CGI_10013593 PE=3 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 1.300e-74
Identity = 132/228 (57.89%), Postives = 150/228 (65.79%), Query Frame = 1
Query:  196 MKQEDYYRACSFGGLSSVIFPDSSYYTNKSNWMCKQDVGQNPYPYSPLGSCSPCYSLGSTNKSQTNTNQWRPQGSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDLFNSGVNPFLAPAWQH-------HISAGMSPTNGL 858
            MKQ+DYYRACSF   S ++FPD +Y   KS W  +       YP+   G+       G         + WRPQGSGQIQLWQFLLELLSDS N+ +ITWEGTNGEFKL+DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPA+             +P+ YKYQ D        F  PA+ H       +  + M PT G+
Sbjct:    1 MKQQDYYRACSFPAFSGMVFPDPAY--GKSAWSPQSSPASPGYPHP--GTLPAITKPGFDGPH----SHWRPQGSGQIQLWQFLLELLSDSSNSNYITWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPAA-------------DPTAYKYQQD--------FFMPAYHHSSKFNFMNAHSPMPPTTGI 199          
BLAST of ETS domain-containing protein vs. TrEMBL
Match: A0A3Q8PZR7 (Transcriptional regulator ERG-like protein, isoform 2 OS=Crepidula fornicata OX=176853 PE=2 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 3.001e-73
Identity = 136/236 (57.63%), Postives = 158/236 (66.95%), Query Frame = 1
Query:  187 MHSMKQEDYYRACSFGGLS-SVIFPDSSYYTNKSNWMCKQDVGQNPYPYS------------PLGSCSPCYSLGSTNKSQTNTNQ--WRPQGSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDLFNSGVNPFLAPAWQHHISAGMSPT 849
            M ++ Q++YYRAC+F  +  S++FPD SY   K+ W   Q   Q+  P S            P  S  P  SL +  KS  ++    WRPQGSGQIQLWQFLLELLSDS N   ITWEGTNGEFKL+DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQ            P+S +P+ YKYQ D+F S  +P   PA Q  ++   SP+
Sbjct:    1 MQTITQQEYYRACTFTSIPPSMMFPDPSY--GKTAW-TPQSSPQSQVPLSGAEIPPRSIQKHPFPSYHPN-SLPAITKSTLDSAHAPWRPQGSGQIQLWQFLLELLSDSANAGSITWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQ------------PSSTDPTAYKYQQDIFMSPYHPH-HPAHQVTVTGPTSPS 219          
BLAST of ETS domain-containing protein vs. TrEMBL
Match: A0A267GH30 (ETS domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011985g3 PE=3 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 6.565e-71
Identity = 132/231 (57.14%), Postives = 153/231 (66.23%), Query Frame = 1
Query:  181 QAMHSMKQEDYYRACSFGG---LSSVIFPDSSYYTNKSNWMCKQDVGQNPYPYSPLGSCSPCYSLGSTNKSQTNT----------------------NQ---WRPQGSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDLFNSG 789
            Q M ++KQE+YYRACS      L+ V+FPD++Y  +K+ W  +Q      Y  SPL S    YS     +   +                       NQ   WRPQGSGQIQLWQFLLELLSDSRN++ I WEGTNGEFKL DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDFAGLAQAMQPA+       A P +++   Y+YQ DL +SG
Sbjct:    2 QTMQNIKQEEYYRACSLAAGAPLAPVMFPDNAY--SKTGW-GRQSTPTPGYGSSPLASSLTPYSTQQKEQGGGSISGGCGGGGGSGGGGGGGGGGAGNQPAHWRPQGSGQIQLWQFLLELLSDSRNSSCIIWEGTNGEFKLSDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFAGLAQAMQPAT-------ADPAAYK---YQYQQDLLSSG 219          
BLAST of ETS domain-containing protein vs. TrEMBL
Match: A0A3Q8PZT1 (Transcriptional regulator ERG-like protein, isoform 1 OS=Crepidula fornicata OX=176853 PE=2 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 7.662e-71
Identity = 130/215 (60.47%), Postives = 148/215 (68.84%), Query Frame = 1
Query:  187 MHSMKQEDYYRACSFGGLS-SVIFPDSSYYTNKSNWMCKQDVGQNPYPYS------------PLGSCSPCYSLGSTNKSQTNTNQ--WRPQGSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDLFNS 786
            M ++ Q++YYRAC+F  +  S++FPD SY   K+ W   Q   Q+  P S            P  S  P  SL +  KS  ++    WRPQGSGQIQLWQFLLELLSDS N   ITWEGTNGEFKL+DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQ            P+S +P+ YKYQ D+F S
Sbjct:    1 MQTITQQEYYRACTFTSIPPSMMFPDPSY--GKTAW-TPQSSPQSQVPLSGAEIPPRSIQKHPFPSYHPN-SLPAITKSTLDSAHAPWRPQGSGQIQLWQFLLELLSDSANAGSITWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQ------------PSSTDPTAYKYQQDIFMS 199          
BLAST of ETS domain-containing protein vs. TrEMBL
Match: A0A267EC85 (ETS domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011985g1 PE=3 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 9.544e-71
Identity = 132/232 (56.90%), Postives = 153/232 (65.95%), Query Frame = 1
Query:  181 QAMHSMKQEDYYRACSFGG---LSSVIFPDSSYYTNKSNWMCKQDVGQNPYPYSPLGSCSPCYSLGSTNKSQTNT-----------------------NQ---WRPQGSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDLFNSG 789
            Q M ++KQE+YYRACS      L+ V+FPD++Y  +K+ W  +Q      Y  SPL S    YS     +   +                        NQ   WRPQGSGQIQLWQFLLELLSDSRN++ I WEGTNGEFKL DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDFAGLAQAMQPA+       A P +++   Y+YQ DL +SG
Sbjct:    2 QTMQNIKQEEYYRACSLAAGAPLAPVMFPDNAY--SKTGW-GRQSTPTPGYGSSPLASSLTPYSTQQKEQGGGSISGGCGGGGGSGGGGGGGGGGGAGNQPAHWRPQGSGQIQLWQFLLELLSDSRNSSCIIWEGTNGEFKLSDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFAGLAQAMQPAT-------ADPAAYK---YQYQQDLLSSG 220          
BLAST of ETS domain-containing protein vs. Ensembl Cavefish
Match: fev (protein FEV [Source:NCBI gene;Acc:103022914])

HSP 1 Score: 189.889 bits (481), Expect = 1.568e-57
Identity = 95/133 (71.43%), Postives = 103/133 (77.44%), Query Frame = 1
Query:  388 TNTNQWRP------QGSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQ 768
            T T+ W P      +GSGQIQLWQFLLELLSDS NT+ I WEGTNGEFKL+DPDEVARRWGERKSKP+MNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF GLAQ  Q            PTS E ++YK Q
Sbjct:   27 TKTSSWSPINTGVQKGSGQIQLWQFLLELLSDSSNTSCIAWEGTNGEFKLLDPDEVARRWGERKSKPSMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFHGLAQVCQ------------PTSTEQALYKLQ 147          
BLAST of ETS domain-containing protein vs. Ensembl Cavefish
Match: erg (ETS transcription factor ERG [Source:NCBI gene;Acc:103046049])

HSP 1 Score: 194.897 bits (494), Expect = 5.208e-57
Identity = 97/136 (71.32%), Postives = 105/136 (77.21%), Query Frame = 1
Query:  415 GSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDLFNSGVNPFLAPAWQH 822
            GSGQIQLWQFLLELLSDS N+  ITWEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP  P            E S+YKY  DL      P+++P   H
Sbjct:  247 GSGQIQLWQFLLELLSDSTNSGCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPP------------ESSVYKYPTDL------PYMSPYHAH 364          
BLAST of ETS domain-containing protein vs. Ensembl Cavefish
Match: erg (ETS transcription factor ERG [Source:NCBI gene;Acc:103046049])

HSP 1 Score: 195.667 bits (496), Expect = 7.491e-57
Identity = 97/136 (71.32%), Postives = 105/136 (77.21%), Query Frame = 1
Query:  415 GSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDLFNSGVNPFLAPAWQH 822
            GSGQIQLWQFLLELLSDS N+  ITWEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP  P            E S+YKY  DL      P+++P   H
Sbjct:  299 GSGQIQLWQFLLELLSDSTNSGCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPP------------ESSVYKYPTDL------PYMSPYHAH 416          
BLAST of ETS domain-containing protein vs. Ensembl Cavefish
Match: erg (ETS transcription factor ERG [Source:NCBI gene;Acc:103046049])

HSP 1 Score: 196.052 bits (497), Expect = 9.599e-57
Identity = 97/136 (71.32%), Postives = 105/136 (77.21%), Query Frame = 1
Query:  415 GSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDLFNSGVNPFLAPAWQH 822
            GSGQIQLWQFLLELLSDS N+  ITWEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP  P            E S+YKY  DL      P+++P   H
Sbjct:  326 GSGQIQLWQFLLELLSDSTNSGCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPP------------ESSVYKYPTDL------PYMSPYHAH 443          
BLAST of ETS domain-containing protein vs. Ensembl Cavefish
Match: erg (ETS transcription factor ERG [Source:NCBI gene;Acc:103046049])

HSP 1 Score: 196.052 bits (497), Expect = 9.665e-57
Identity = 97/136 (71.32%), Postives = 105/136 (77.21%), Query Frame = 1
Query:  415 GSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDLFNSGVNPFLAPAWQH 822
            GSGQIQLWQFLLELLSDS N+  ITWEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP  P            E S+YKY  DL      P+++P   H
Sbjct:  316 GSGQIQLWQFLLELLSDSTNSGCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPP------------ESSVYKYPTDL------PYMSPYHAH 433          
BLAST of ETS domain-containing protein vs. Ensembl Sea Lamprey
Match: fli1a (Fli-1 proto-oncogene, ETS transcription factor a [Source:ZFIN;Acc:ZDB-GENE-980526-426])

HSP 1 Score: 192.971 bits (489), Expect = 1.409e-59
Identity = 98/131 (74.81%), Postives = 105/131 (80.15%), Query Frame = 1
Query:  415 GSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDLFNSGVNPFLA 807
            GSGQIQLWQFLLELLSDS N   ITWEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP  PT           E S+YKY  +L  S V+P+ A
Sbjct:   30 GSGQIQLWQFLLELLSDSSNANCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQP-HPT-----------ESSVYKYPSEL--SYVSPYHA 146          
BLAST of ETS domain-containing protein vs. Ensembl Sea Lamprey
Match: fev (FEV transcription factor, ETS family member [Source:NCBI gene;Acc:791175])

HSP 1 Score: 163.31 bits (412), Expect = 2.665e-48
Identity = 82/126 (65.08%), Postives = 90/126 (71.43%), Query Frame = 1
Query:  415 GSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGAS-----PTSFEPSIYKYQHDL 777
            GSGQIQLWQFLLELLSD+ N   I WEG  GEFKL DPDEVAR+WG+RK+KPNMNYDKLSRALRYYYDKNIM+KVHGKRYAY+FDF     A           G S     P S +P+ YK Q  L
Sbjct:    2 GSGQIQLWQFLLELLSDAANAHCIAWEGACGEFKLTDPDEVARQWGKRKAKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYRFDFQVHIHACTRGRTHTHTSGLSQACQAPVS-DPTAYKLQSAL 126          
BLAST of ETS domain-containing protein vs. Ensembl Sea Lamprey
Match: etv1 (ETS variant transcription factor 1 [Source:ZFIN;Acc:ZDB-GENE-070104-1])

HSP 1 Score: 119.783 bits (299), Expect = 6.919e-31
Identity = 53/85 (62.35%), Postives = 65/85 (76.47%), Query Frame = 1
Query:  412 QGSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF 666
            Q  G +QLWQFL+ LL D  N   ITW G   EFKL++P+EVAR+WG +K++P MNYDKLSR+LRYYY+K IM KV G+RY YKF
Sbjct:  160 QRRGSLQLWQFLVALLDDPANGHLITWTGRGMEFKLLEPEEVARKWGVQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKF 244          
BLAST of ETS domain-containing protein vs. Ensembl Sea Lamprey
Match: ETV3 (ETS variant transcription factor 3 [Source:HGNC Symbol;Acc:HGNC:3492])

HSP 1 Score: 115.546 bits (288), Expect = 1.326e-29
Identity = 52/90 (57.78%), Postives = 62/90 (68.89%), Query Frame = 1
Query:  415 GSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLA 684
            G  Q+QLW F+LELL        I W+G  GEF + +P+EVAR WG RK KP+MNYDKLSRALRYYY+K I+ K  GKRY YKF+   L 
Sbjct:   14 GCRQVQLWHFILELLGKREFRHVIAWQGDCGEFIIKNPEEVARLWGARKCKPHMNYDKLSRALRYYYNKRILYKTKGKRYTYKFNVNKLV 103          
BLAST of ETS domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002472.1 (pep scaffold:Pmarinus_7.0:GL476893:38150:62026:-1 gene:ENSPMAG00000002241.1 transcript:ENSPMAT00000002472.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 118.242 bits (295), Expect = 3.017e-29
Identity = 51/82 (62.20%), Postives = 62/82 (75.61%), Query Frame = 1
Query:  421 GQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF 666
            G +QLWQFL+ LL D  +   I W G   EFKL+DP+EVAR WG +K++P MNYDKLSR+LRYYY+K IM KV G+RY YKF
Sbjct:  375 GSLQLWQFLVALLEDPAHAGTIVWTGRGMEFKLLDPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKF 456          
BLAST of ETS domain-containing protein vs. Ensembl Nematostella
Match: EDO39973 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8F6])

HSP 1 Score: 179.874 bits (455), Expect = 1.144e-55
Identity = 82/97 (84.54%), Postives = 88/97 (90.72%), Query Frame = 1
Query:  415 GSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPAS 705
            GSGQIQLWQFLLELLSD +N   I WEGTNGEFKL+DPDEVARRWGERK+KPNMNYDKLSRALRYYYDKNIMTK+HGKRYAYK+DF GLAQ  QP +
Sbjct:   11 GSGQIQLWQFLLELLSDPKNANCIAWEGTNGEFKLVDPDEVARRWGERKNKPNMNYDKLSRALRYYYDKNIMTKIHGKRYAYKYDFQGLAQLNQPIT 107          
BLAST of ETS domain-containing protein vs. Ensembl Nematostella
Match: EDO43493 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYB7])

HSP 1 Score: 124.02 bits (310), Expect = 2.216e-34
Identity = 53/80 (66.25%), Postives = 65/80 (81.25%), Query Frame = 1
Query:  427 IQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF 666
            IQLWQFLLELL+D      I W G  GEFKL DP++VA++WG+RK+KP MNY+KLSRALRYYYD +++ KVHGKR+ YKF
Sbjct:    1 IQLWQFLLELLTDKTCRHLIMWVGEEGEFKLNDPEQVAQQWGKRKNKPAMNYEKLSRALRYYYDGDMIHKVHGKRFVYKF 80          
BLAST of ETS domain-containing protein vs. Ensembl Nematostella
Match: EDO37550 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFF5])

HSP 1 Score: 118.242 bits (295), Expect = 3.555e-32
Identity = 61/113 (53.98%), Postives = 74/113 (65.49%), Query Frame = 1
Query:  412 QGSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEP 750
            Q  G +QLWQFL+ LL +   ++FI W G   EFKLIDP+EVARRWG +K++P MNYDKLSR+LRYYY+K IM KV G+RY YKF  +  A     A P    P   P   EP
Sbjct:    2 QRRGSLQLWQFLVALLDEPECSSFIAWTGRGLEFKLIDPEEVARRWGLQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCSPEA-LFSMAFPDSQKPYIKPECREP 113          
BLAST of ETS domain-containing protein vs. Ensembl Nematostella
Match: EDO44339 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW27])

HSP 1 Score: 110.538 bits (275), Expect = 9.645e-30
Identity = 50/81 (61.73%), Postives = 63/81 (77.78%), Query Frame = 1
Query:  427 IQLWQFLLELLSDSRNTTFITWEG-TNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF 666
            I LW+FLL+LL+D R ++ I+W    +GEFKL++ +EVARRWG  K +P MNYDKLSRALRYYY K I+ KVHG+R  YKF
Sbjct:    3 IHLWEFLLDLLADGRYSSIISWTNRESGEFKLLNQEEVARRWGHLKHRPGMNYDKLSRALRYYYQKGIIKKVHGQRLVYKF 83          
BLAST of ETS domain-containing protein vs. Ensembl Nematostella
Match: EDO45310 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSZ6])

HSP 1 Score: 107.842 bits (268), Expect = 1.050e-28
Identity = 49/81 (60.49%), Postives = 62/81 (76.54%), Query Frame = 1
Query:  427 IQLWQFLLELLSDSRNTTFITW-EGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF 666
            + LW+FLLELL+D    + I+W +   GEFKL + +EVARRWG+ K +P MNYDKLSRALRYYY KNI+ KV+G+R  YKF
Sbjct:    3 VHLWEFLLELLADESCASMISWTKKEEGEFKLRNQEEVARRWGDLKQRPGMNYDKLSRALRYYYQKNIIKKVNGQRLVYKF 83          
BLAST of ETS domain-containing protein vs. Ensembl Medaka
Match: fev (protein FEV [Source:NCBI gene;Acc:111946795])

HSP 1 Score: 191.045 bits (484), Expect = 5.898e-58
Identity = 93/119 (78.15%), Postives = 98/119 (82.35%), Query Frame = 1
Query:  412 QGSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQ 768
            +GSGQIQLWQFLLELLSDS N + I WEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF GLAQ  Q            PT+ E +IYK+Q
Sbjct:   40 KGSGQIQLWQFLLELLSDSTNVSCIAWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGLAQVCQ------------PTTTEQAIYKFQ 146          
BLAST of ETS domain-containing protein vs. Ensembl Medaka
Match: fev (protein FEV [Source:NCBI gene;Acc:111946795])

HSP 1 Score: 191.815 bits (486), Expect = 7.420e-58
Identity = 93/119 (78.15%), Postives = 98/119 (82.35%), Query Frame = 1
Query:  412 QGSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQ 768
            +GSGQIQLWQFLLELLSDS N + I WEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF GLAQ  Q            PT+ E +IYK+Q
Sbjct:   68 KGSGQIQLWQFLLELLSDSTNVSCIAWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGLAQVCQ------------PTTTEQAIYKFQ 174          
BLAST of ETS domain-containing protein vs. Ensembl Medaka
Match: fli1a (Fli-1 proto-oncogene, ETS transcription factor [Source:NCBI gene;Acc:101160089])

HSP 1 Score: 192.586 bits (488), Expect = 4.399e-56
Identity = 95/121 (78.51%), Postives = 100/121 (82.64%), Query Frame = 1
Query:  415 GSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDL 777
            GSGQIQLWQFLLELLSDS N + ITWEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP  PT           E S+YKY  DL
Sbjct:  247 GSGQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQP-HPT-----------ESSMYKYPSDL 355          
BLAST of ETS domain-containing protein vs. Ensembl Medaka
Match: fli1a (Fli-1 proto-oncogene, ETS transcription factor [Source:NCBI gene;Acc:101160089])

HSP 1 Score: 192.971 bits (489), Expect = 5.530e-56
Identity = 95/121 (78.51%), Postives = 100/121 (82.64%), Query Frame = 1
Query:  415 GSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDL 777
            GSGQIQLWQFLLELLSDS N + ITWEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP  PT           E S+YKY  DL
Sbjct:  276 GSGQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQP-HPT-----------ESSMYKYPSDL 384          
BLAST of ETS domain-containing protein vs. Ensembl Medaka
Match: fli1a (Fli-1 proto-oncogene, ETS transcription factor [Source:NCBI gene;Acc:101160089])

HSP 1 Score: 192.971 bits (489), Expect = 6.201e-56
Identity = 95/121 (78.51%), Postives = 100/121 (82.64%), Query Frame = 1
Query:  415 GSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDL 777
            GSGQIQLWQFLLELLSDS N + ITWEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF G+AQA+QP  PT           E S+YKY  DL
Sbjct:  283 GSGQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQP-HPT-----------ESSMYKYPSDL 391          
BLAST of ETS domain-containing protein vs. Planmine SMEST
Match: SMESG000078333.1 (SMESG000078333.1)

HSP 1 Score: 594.734 bits (1532), Expect = 0.000e+0
Identity = 364/364 (100.00%), Postives = 364/364 (100.00%), Query Frame = 1
Query:  187 MHSMKQEDYYRACSFGGLSSVIFPDSSYYTNKSNWMCKQDVGQNPYPYSPLGSCSPCYSLGSTNKSQTNTNQWRPQGSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDLFNSGVNPFLAPAWQHHISAGMSPTNGLPXXXXXXXXXXXXXXXXXXXXXTFNPINKPATSPTSSVAPINSSGIPLVGVPNPMVAAYWSAATNACXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYXXXXXXXXXXXXXXXAIARVPVNPYATMAGLANNSILPSNYYD 1278
            MHSMKQEDYYRACSFGGLSSVIFPDSSYYTNKSNWMCKQDVGQNPYPYSPLGSCSPCYSLGSTNKSQTNTNQWRPQGSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDLFNSGVNPFLAPAWQHHISAGMSPTNGLPSSNLFTSSSSVGQNQMSSNSSTFNPINKPATSPTSSVAPINSSGIPLVGVPNPMVAAYWSAATNACNHGINQIQQSQIQPPQQQPQHHSNSMSSSYFSMPPTPLFSTPFSTAIARVPVNPYATMAGLANNSILPSNYYD
Sbjct:    1 MHSMKQEDYYRACSFGGLSSVIFPDSSYYTNKSNWMCKQDVGQNPYPYSPLGSCSPCYSLGSTNKSQTNTNQWRPQGSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDLFNSGVNPFLAPAWQHHISAGMSPTNGLPSSNLFTSSSSVGQNQMSSNSSTFNPINKPATSPTSSVAPINSSGIPLVGVPNPMVAAYWSAATNACNHGINQIQQSQIQPPQQQPQHHSNSMSSSYFSMPPTPLFSTPFSTAIARVPVNPYATMAGLANNSILPSNYYD 364          
BLAST of ETS domain-containing protein vs. Planmine SMEST
Match: SMESG000078333.1 (SMESG000078333.1)

HSP 1 Score: 587.8 bits (1514), Expect = 0.000e+0
Identity = 361/361 (100.00%), Postives = 361/361 (100.00%), Query Frame = 1
Query:  196 MKQEDYYRACSFGGLSSVIFPDSSYYTNKSNWMCKQDVGQNPYPYSPLGSCSPCYSLGSTNKSQTNTNQWRPQGSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDLFNSGVNPFLAPAWQHHISAGMSPTNGLPXXXXXXXXXXXXXXXXXXXXXTFNPINKPATSPTSSVAPINSSGIPLVGVPNPMVAAYWSAATNACXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYXXXXXXXXXXXXXXXAIARVPVNPYATMAGLANNSILPSNYYD 1278
            MKQEDYYRACSFGGLSSVIFPDSSYYTNKSNWMCKQDVGQNPYPYSPLGSCSPCYSLGSTNKSQTNTNQWRPQGSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDLFNSGVNPFLAPAWQHHISAGMSPTNGLPSSNLFTSSSSVGQNQMSSNSSTFNPINKPATSPTSSVAPINSSGIPLVGVPNPMVAAYWSAATNACNHGINQIQQSQIQPPQQQPQHHSNSMSSSYFSMPPTPLFSTPFSTAIARVPVNPYATMAGLANNSILPSNYYD
Sbjct:    1 MKQEDYYRACSFGGLSSVIFPDSSYYTNKSNWMCKQDVGQNPYPYSPLGSCSPCYSLGSTNKSQTNTNQWRPQGSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDLFNSGVNPFLAPAWQHHISAGMSPTNGLPSSNLFTSSSSVGQNQMSSNSSTFNPINKPATSPTSSVAPINSSGIPLVGVPNPMVAAYWSAATNACNHGINQIQQSQIQPPQQQPQHHSNSMSSSYFSMPPTPLFSTPFSTAIARVPVNPYATMAGLANNSILPSNYYD 361          
BLAST of ETS domain-containing protein vs. Planmine SMEST
Match: SMESG000080027.1 (SMESG000080027.1)

HSP 1 Score: 210.305 bits (534), Expect = 1.005e-62
Identity = 105/151 (69.54%), Postives = 116/151 (76.82%), Query Frame = 1
Query:  304 DVGQNPYPYSPLGSCSPCYSLGSTNKSQTNTN--QWRPQGSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPAS--PTVSGPGASPTSF 744
            D   + Y  +P    S   +L  T + Q+N+   QWRPQGSGQIQLWQFLLELLSDSRN + I WEGTNGEFKL+DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF+GLAQAM P +   TVS    S   F
Sbjct:   95 DYCSSSYISTPFNQYSRSANLFQTKQHQSNSTNGQWRPQGSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTVSSASGSIPDF 245          
BLAST of ETS domain-containing protein vs. Planmine SMEST
Match: SMESG000036336.1 (SMESG000036336.1)

HSP 1 Score: 204.912 bits (520), Expect = 1.505e-62
Identity = 104/168 (61.90%), Postives = 117/168 (69.64%), Query Frame = 1
Query:  394 TNQWRPQGSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDLFNSGVNPFLAPA---------------WQHHISAGMSPTN 852
            T+ W+ QG+GQIQLWQFLLELL+DSRN+ FI+WEG NGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF GLAQAMQP   +             S  +Y  DLF+     +++ A               W HH  A +SP N
Sbjct:   45 TSCWKSQGTGQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGS------------ESFCRYTSDLFSHNDPNYISAAAVAMATRNSRCSSSIWPHH--ASLSPNN 198          
BLAST of ETS domain-containing protein vs. Planmine SMEST
Match: SMESG000036336.1 (SMESG000036336.1)

HSP 1 Score: 205.682 bits (522), Expect = 1.873e-62
Identity = 104/168 (61.90%), Postives = 117/168 (69.64%), Query Frame = 1
Query:  394 TNQWRPQGSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDLFNSGVNPFLAPA---------------WQHHISAGMSPTN 852
            T+ W+ QG+GQIQLWQFLLELL+DSRN+ FI+WEG NGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF GLAQAMQP   +             S  +Y  DLF+     +++ A               W HH  A +SP N
Sbjct:   71 TSCWKSQGTGQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQPMVGS------------ESFCRYTSDLFSHNDPNYISAAAVAMATRNSRCSSSIWPHH--ASLSPNN 224          
The following BLAST results are available for this feature:
BLAST of ETS domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ERG1.815e-5757.53ETS transcription factor ERG [Source:HGNC Symbol;A... [more]
FLI11.847e-5777.69Fli-1 proto-oncogene, ETS transcription factor [So... [more]
ERG1.895e-5757.53ETS transcription factor ERG [Source:HGNC Symbol;A... [more]
ERG4.565e-5777.69ETS transcription factor ERG [Source:HGNC Symbol;A... [more]
ERG6.850e-5777.69ETS transcription factor ERG [Source:HGNC Symbol;A... [more]
back to top
BLAST of ETS domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ets-51.362e-5568.18ETS domain-containing transcription factor ets-5 ... [more]
ets-53.467e-5568.18ETS domain-containing transcription factor ets-5 ... [more]
ast-16.625e-5562.99Axon STeering defect [Source:UniProtKB/TrEMBL;Acc... [more]
lin-19.827e-3165.43LIN-1 [Source:UniProtKB/TrEMBL;Acc:G5EDL0][more]
lin-19.827e-3165.43LIN-1 [Source:UniProtKB/TrEMBL;Acc:G5EDL0][more]
back to top
BLAST of ETS domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ets65A2.019e-6353.14gene:FBgn0005658 transcript:FBtr0077055[more]
Ets65A1.302e-5969.54gene:FBgn0005658 transcript:FBtr0077054[more]
Ets65A1.833e-5969.54gene:FBgn0005658 transcript:FBtr0273355[more]
Ets65A2.164e-5869.54gene:FBgn0005658 transcript:FBtr0347000[more]
Ets65A1.092e-5769.54gene:FBgn0005658 transcript:FBtr0347001[more]
back to top
BLAST of ETS domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fev1.670e-5872.06FEV transcription factor, ETS family member [Sourc... [more]
fev2.528e-5872.06FEV transcription factor, ETS family member [Sourc... [more]
erg9.793e-5678.63ETS transcription factor ERG [Source:ZFIN;Acc:ZDB-... [more]
fli1a1.741e-5476.86Fli-1 proto-oncogene, ETS transcription factor a [... [more]
fli1a1.914e-5476.86Fli-1 proto-oncogene, ETS transcription factor a [... [more]
back to top
BLAST of ETS domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
erg1.009e-5858.60v-ets avian erythroblastosis virus E26 oncogene ho... [more]
erg1.382e-5858.60v-ets avian erythroblastosis virus E26 oncogene ho... [more]
erg6.058e-5753.50v-ets avian erythroblastosis virus E26 oncogene ho... [more]
erg6.914e-5753.50v-ets avian erythroblastosis virus E26 oncogene ho... [more]
erg1.599e-5653.54v-ets avian erythroblastosis virus E26 oncogene ho... [more]
back to top
BLAST of ETS domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Erg1.998e-5757.53ETS transcription factor [Source:MGI Symbol;Acc:MG... [more]
Erg2.171e-5757.53ETS transcription factor [Source:MGI Symbol;Acc:MG... [more]
Erg6.943e-5777.69ETS transcription factor [Source:MGI Symbol;Acc:MG... [more]
Erg9.000e-5777.69ETS transcription factor [Source:MGI Symbol;Acc:MG... [more]
Erg1.486e-5677.69ETS transcription factor [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of ETS domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q01414|ERG_LYTVA4.917e-6079.17Transcriptional regulator ERG homolog (Fragment) O... [more]
sp|P29774|ETS3_DROME1.305e-5869.54DNA-binding protein D-ETS-3 OS=Drosophila melanoga... [more]
sp|A3FEM2|FEV_DANRE1.261e-5772.06Protein FEV OS=Danio rerio OX=7955 GN=fev PE=2 SV=... [more]
sp|P11308|ERG_HUMAN1.142e-5577.69Transcriptional regulator ERG OS=Homo sapiens OX=9... [more]
sp|Q90837|ERG_CHICK1.329e-5577.69Transcriptional regulator Erg OS=Gallus gallus OX=... [more]
back to top
BLAST of ETS domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1R5Y91.300e-7457.89Retroviral integration site protein Fli-1-like pro... [more]
A0A3Q8PZR73.001e-7357.63Transcriptional regulator ERG-like protein, isofor... [more]
A0A267GH306.565e-7157.14ETS domain-containing protein OS=Macrostomum ligna... [more]
A0A3Q8PZT17.662e-7160.47Transcriptional regulator ERG-like protein, isofor... [more]
A0A267EC859.544e-7156.90ETS domain-containing protein OS=Macrostomum ligna... [more]
back to top
BLAST of ETS domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fev1.568e-5771.43protein FEV [Source:NCBI gene;Acc:103022914][more]
erg5.208e-5771.32ETS transcription factor ERG [Source:NCBI gene;Acc... [more]
erg7.491e-5771.32ETS transcription factor ERG [Source:NCBI gene;Acc... [more]
erg9.599e-5771.32ETS transcription factor ERG [Source:NCBI gene;Acc... [more]
erg9.665e-5771.32ETS transcription factor ERG [Source:NCBI gene;Acc... [more]
back to top
BLAST of ETS domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fli1a1.409e-5974.81Fli-1 proto-oncogene, ETS transcription factor a [... [more]
fev2.665e-4865.08FEV transcription factor, ETS family member [Sourc... [more]
etv16.919e-3162.35ETS variant transcription factor 1 [Source:ZFIN;Ac... [more]
ETV31.326e-2957.78ETS variant transcription factor 3 [Source:HGNC Sy... [more]
ENSPMAT00000002472.13.017e-2962.20pep scaffold:Pmarinus_7.0:GL476893:38150:62026:-1 ... [more]
back to top
BLAST of ETS domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ETS domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO399731.144e-5584.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434932.216e-3466.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375503.555e-3253.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO443399.645e-3061.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453101.050e-2860.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ETS domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fev5.898e-5878.15protein FEV [Source:NCBI gene;Acc:111946795][more]
fev7.420e-5878.15protein FEV [Source:NCBI gene;Acc:111946795][more]
fli1a4.399e-5678.51Fli-1 proto-oncogene, ETS transcription factor [So... [more]
fli1a5.530e-5678.51Fli-1 proto-oncogene, ETS transcription factor [So... [more]
fli1a6.201e-5678.51Fli-1 proto-oncogene, ETS transcription factor [So... [more]
back to top
BLAST of ETS domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078333.10.000e+0100.00SMESG000078333.1[more]
SMESG000078333.10.000e+0100.00SMESG000078333.1[more]
SMESG000080027.11.005e-6269.54SMESG000080027.1[more]
SMESG000036336.11.505e-6261.90SMESG000036336.1[more]
SMESG000036336.11.873e-6261.90SMESG000036336.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022748 ID=SMED30022748|Name=ETS domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1380bp
CTTCTCTAACCCGGCTGGTGTTTCTCGCTTGCAGCGGTAGCCCTAATAAG
AACCGCTACCGCTCGGGAAGTGTTCAGTTCGCTGCATCTTCCTGTACGTA
TTATTGACTGAGCCAGTTTACCAACATTCGGAAATCCAATTACAGACTCT
GTTCCTTCGAAATCGATTTATTATTATTACCAGGCAATGCACAGCATGAA
GCAAGAAGACTACTATAGAGCTTGCTCTTTTGGAGGACTGTCCTCAGTAA
TTTTCCCAGATTCGTCATATTATACAAACAAATCCAACTGGATGTGCAAG
CAAGACGTAGGACAAAATCCGTATCCTTATAGTCCATTAGGTTCTTGTTC
TCCATGTTATTCTCTCGGTTCGACAAATAAATCTCAAACTAACACAAACC
AATGGAGACCACAAGGATCAGGACAAATTCAATTGTGGCAATTTCTTCTA
GAACTCCTTTCAGACAGTCGAAATACGACGTTTATTACCTGGGAAGGAAC
GAATGGAGAATTCAAACTGATTGATCCCGATGAAGTAGCAAGACGGTGGG
GTGAAAGAAAGAGTAAACCAAATATGAATTATGACAAATTAAGTCGAGCA
TTGAGATATTACTATGACAAAAATATCATGACAAAAGTTCATGGAAAACG
ATACGCTTATAAATTTGATTTTGCCGGACTCGCGCAAGCCATGCAACCAG
CAAGTCCAACAGTTTCCGGTCCTGGTGCAAGTCCGACATCATTTGAACCA
AGCATTTATAAATATCAACACGATTTATTTAATTCTGGAGTCAATCCATT
TCTTGCTCCCGCATGGCAACATCATATCAGTGCTGGTATGTCTCCAACCA
ATGGACTACCATCCTCTAACCTTTTCACATCTTCCTCATCAGTTGGTCAG
AATCAAATGAGTTCTAATTCCAGTACTTTTAATCCTATTAACAAACCAGC
TACAAGTCCCACAAGTTCAGTAGCCCCGATTAACAGTTCTGGTATCCCAC
TAGTTGGAGTTCCTAATCCCATGGTAGCTGCATATTGGTCAGCTGCAACA
AATGCATGTAATCATGGTATTAATCAAATTCAACAATCCCAAATCCAGCC
TCCACAACAACAACCACAGCATCATTCCAATTCAATGTCATCTTCATATT
TCTCAATGCCTCCAACCCCCCTGTTCAGTACTCCATTTTCAACCGCTATT
GCCAGGGTACCGGTTAATCCGTATGCTACAATGGCGGGTCTCGCCAACAA
TTCAATTCTGCCATCAAATTACTATGATTAAATTTGATTATTTTGGGCCT
TATAGCCAATTTTGTTGACAGATTTGAATCGACGATTTCTTTGTTGTATA
AATATAGTTTCATACAAACATGATCTAGCG
back to top

protein sequence of SMED30022748-orf-1

>SMED30022748-orf-1 ID=SMED30022748-orf-1|Name=SMED30022748-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=365bp
MHSMKQEDYYRACSFGGLSSVIFPDSSYYTNKSNWMCKQDVGQNPYPYSP
LGSCSPCYSLGSTNKSQTNTNQWRPQGSGQIQLWQFLLELLSDSRNTTFI
TWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTK
VHGKRYAYKFDFAGLAQAMQPASPTVSGPGASPTSFEPSIYKYQHDLFNS
GVNPFLAPAWQHHISAGMSPTNGLPSSNLFTSSSSVGQNQMSSNSSTFNP
INKPATSPTSSVAPINSSGIPLVGVPNPMVAAYWSAATNACNHGINQIQQ
SQIQPPQQQPQHHSNSMSSSYFSMPPTPLFSTPFSTAIARVPVNPYATMA
GLANNSILPSNYYD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR036390WH_DNA-bd_sf
IPR000418Ets_dom
IPR011991WHTH_DNA-bd_dom
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0043565sequence-specific DNA binding
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000418Ets domainPRINTSPR00454ETSDOMAINcoord: 105..123
score: 54.74
coord: 143..161
score: 52.93
coord: 81..94
score: 66.06
coord: 124..142
score: 72.42
IPR000418Ets domainSMARTSM00413etsneu2coord: 80..165
e-value: 4.9E-56
score: 202.2
IPR000418Ets domainPFAMPF00178Etscoord: 82..160
e-value: 1.1E-35
score: 122.0
IPR000418Ets domainPROSITEPS00346ETS_DOMAIN_2coord: 127..142
IPR000418Ets domainPROSITEPS00345ETS_DOMAIN_1coord: 83..91
IPR000418Ets domainPROSITEPS50061ETS_DOMAIN_3coord: 81..161
score: 47.604
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 56..173
e-value: 5.0E-48
score: 164.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 298..322
NoneNo IPR availablePANTHERPTHR11849ETScoord: 60..242
NoneNo IPR availablePANTHERPTHR11849:SF274DNA-BINDING PROTEIN D-ETS-3coord: 60..242
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 78..210