Gamma-aminobutyric acid receptor subunit beta-2

Overview
NameGamma-aminobutyric acid receptor subunit beta-2
Smed IDSMED30022746
Length (bp)1250
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Gamma-aminobutyric acid receptor subunit beta-2 (SMED30022746) t-SNE clustered cells

Violin plots show distribution of expression levels for Gamma-aminobutyric acid receptor subunit beta-2 (SMED30022746) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Gamma-aminobutyric acid receptor subunit beta-2 (SMED30022746) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Gamma-aminobutyric acid receptor subunit beta-2 (SMED30022746) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022746

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30022746SMESG000041912.1 dd_Smed_v4_16116_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022746SMESG000041912.1 dd_Smed_v4_16116_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30022746SMESG000041912.1 dd_Smed_v4_16116_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30022746SMESG000041912.1 dd_Smed_v4_16116_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Human
Match: GABRB2 (gamma-aminobutyric acid type A receptor beta2 subunit [Source:HGNC Symbol;Acc:HGNC:4082])

HSP 1 Score: 56.9954 bits (136), Expect = 2.192e-8
Identity = 62/271 (22.88%), Postives = 126/271 (46.49%), Query Frame = 2
Query:   83 IKILKVDTVNEL---YSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNI-FTENKITISNEISIAKETGRAY----IVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAITSLWF 868
            I I  +D V+E+   Y+  ++ Q  WR+  L Y+V   N+   +    +L + +  F  +K +  + +++     R +    ++   RI  T    ++L+ +P D Q+ ++ + S  ++ ++++      D    N V G+   E  L +   V+ K+I+ +          +  + +  R   YFI+  +M S L+ +L++ SF +    S  R+AL  T +LT  T    +   LPKIPY+  +D  + G  + +    + +A+ +  F
Sbjct:    3 IDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDD----NAVTGVTKIE--LPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYIF 267          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Human
Match: GABRB2 (gamma-aminobutyric acid type A receptor beta2 subunit [Source:HGNC Symbol;Acc:HGNC:4082])

HSP 1 Score: 55.4546 bits (132), Expect = 8.433e-8
Identity = 62/271 (22.88%), Postives = 126/271 (46.49%), Query Frame = 2
Query:   83 IKILKVDTVNEL---YSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNI-FTENKITISNEISIAKETGRAY----IVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAITSLWF 868
            I I  +D V+E+   Y+  ++ Q  WR+  L Y+V   N+   +    +L + +  F  +K +  + +++     R +    ++   RI  T    ++L+ +P D Q+ ++ + S  ++ ++++      D    N V G+   E  L +   V+ K+I+ +          +  + +  R   YFI+  +M S L+ +L++ SF +    S  R+AL  T +LT  T    +   LPKIPY+  +D  + G  + +    + +A+ +  F
Sbjct:    3 IDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDD----NAVTGVTKIE--LPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYIF 267          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Human
Match: GABRB2 (gamma-aminobutyric acid type A receptor beta2 subunit [Source:HGNC Symbol;Acc:HGNC:4082])

HSP 1 Score: 55.8398 bits (133), Expect = 8.768e-8
Identity = 62/271 (22.88%), Postives = 126/271 (46.49%), Query Frame = 2
Query:   83 IKILKVDTVNEL---YSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNI-FTENKITISNEISIAKETGRAY----IVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAITSLWF 868
            I I  +D V+E+   Y+  ++ Q  WR+  L Y+V   N+   +    +L + +  F  +K +  + +++     R +    ++   RI  T    ++L+ +P D Q+ ++ + S  ++ ++++      D    N V G+   E  L +   V+ K+I+ +          +  + +  R   YFI+  +M S L+ +L++ SF +    S  R+AL  T +LT  T    +   LPKIPY+  +D  + G  + +    + +A+ +  F
Sbjct:   66 IDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDD----NAVTGVTKIE--LPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYIF 330          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Human
Match: GABRB2 (gamma-aminobutyric acid type A receptor beta2 subunit [Source:HGNC Symbol;Acc:HGNC:4082])

HSP 1 Score: 55.8398 bits (133), Expect = 8.768e-8
Identity = 62/271 (22.88%), Postives = 126/271 (46.49%), Query Frame = 2
Query:   83 IKILKVDTVNEL---YSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNI-FTENKITISNEISIAKETGRAY----IVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAITSLWF 868
            I I  +D V+E+   Y+  ++ Q  WR+  L Y+V   N+   +    +L + +  F  +K +  + +++     R +    ++   RI  T    ++L+ +P D Q+ ++ + S  ++ ++++      D    N V G+   E  L +   V+ K+I+ +          +  + +  R   YFI+  +M S L+ +L++ SF +    S  R+AL  T +LT  T    +   LPKIPY+  +D  + G  + +    + +A+ +  F
Sbjct:   66 IDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDD----NAVTGVTKIE--LPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYIF 330          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Human
Match: GABRB2 (gamma-aminobutyric acid type A receptor beta2 subunit [Source:HGNC Symbol;Acc:HGNC:4082])

HSP 1 Score: 55.4546 bits (132), Expect = 1.132e-7
Identity = 62/271 (22.88%), Postives = 126/271 (46.49%), Query Frame = 2
Query:   83 IKILKVDTVNEL---YSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNI-FTENKITISNEISIAKETGRAY----IVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAITSLWF 868
            I I  +D V+E+   Y+  ++ Q  WR+  L Y+V   N+   +    +L + +  F  +K +  + +++     R +    ++   RI  T    ++L+ +P D Q+ ++ + S  ++ ++++      D    N V G+   E  L +   V+ K+I+ +          +  + +  R   YFI+  +M S L+ +L++ SF +    S  R+AL  T +LT  T    +   LPKIPY+  +D  + G  + +    + +A+ +  F
Sbjct:   66 IDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDD----NAVTGVTKIE--LPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYIF 330          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Fly
Match: pHCl-2 (gene:FBgn0039840 transcript:FBtr0347502)

HSP 1 Score: 51.2174 bits (121), Expect = 1.070e-6
Identity = 60/260 (23.08%), Postives = 116/260 (44.62%), Query Frame = 2
Query:   59 DIYLRCVFIKILKVDTVNELYSGEIFLQAKWREPLLDYSVETKNIDF---------SHYWNPKLSISNIFTENKITISNEISIAKETGRAYIVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLN---ECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKRE----VMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLT 787
            DIY R     +  +D+ +  ++ +  LQ ++ +P L +S    N               W P + ++N      +  S +  +        ++   R++AT    +  Q FPFD Q    ++ S  ++   V+L+   + P    K      +   E+NL   +  ES  +SNE  +     E    ++ FT   TR+  Y++I+YF+ S ++  +++ SF + +  +  R  L  T LL+ +T  ++  +NL K+ Y+T
Sbjct:  104 DIYARFYIYVMKNLDSSDLQFTVQGLLQLRYLDPRLAFSSYLPNRRQPIMGESELKKMLWVPHIFLTNEQASTVLGTSAKDELTSIYPNGTVLTSTRLQATLYCWMNFQKFPFDEQKCKTTLESWMYNTTLVQLHWETDNPVSFDK-----QLQLTEYNLIGSLYNESIRVSNESYMSHGSLEGNYSIISFTVLLTREVGYYVIDYFLPSIMIVTISWVSFWLQADQTPARTTLGCTTLLSFITLSLSQENNLMKVSYVT 358          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Fly
Match: pHCl-2 (gene:FBgn0039840 transcript:FBtr0085766)

HSP 1 Score: 51.2174 bits (121), Expect = 1.070e-6
Identity = 60/260 (23.08%), Postives = 116/260 (44.62%), Query Frame = 2
Query:   59 DIYLRCVFIKILKVDTVNELYSGEIFLQAKWREPLLDYSVETKNIDF---------SHYWNPKLSISNIFTENKITISNEISIAKETGRAYIVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLN---ECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKRE----VMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLT 787
            DIY R     +  +D+ +  ++ +  LQ ++ +P L +S    N               W P + ++N      +  S +  +        ++   R++AT    +  Q FPFD Q    ++ S  ++   V+L+   + P    K      +   E+NL   +  ES  +SNE  +     E    ++ FT   TR+  Y++I+YF+ S ++  +++ SF + +  +  R  L  T LL+ +T  ++  +NL K+ Y+T
Sbjct:  104 DIYARFYIYVMKNLDSSDLQFTVQGLLQLRYLDPRLAFSSYLPNRRQPIMGESELKKMLWVPHIFLTNEQASTVLGTSAKDELTSIYPNGTVLTSTRLQATLYCWMNFQKFPFDEQKCKTTLESWMYNTTLVQLHWETDNPVSFDK-----QLQLTEYNLIGSLYNESIRVSNESYMSHGSLEGNYSIISFTVLLTREVGYYVIDYFLPSIMIVTISWVSFWLQADQTPARTTLGCTTLLSFITLSLSQENNLMKVSYVT 358          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Zebrafish
Match: gabrb4 (gamma-aminobutyric acid type A receptor beta4 subunit [Source:ZFIN;Acc:ZDB-GENE-070424-211])

HSP 1 Score: 58.9214 bits (141), Expect = 6.056e-9
Identity = 63/271 (23.25%), Postives = 125/271 (46.13%), Query Frame = 2
Query:   83 IKILKVDTVNEL---YSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNI-FTENKITISNEISIAKETGRAY----IVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAITSLWF 868
            I I  +D+++E+   Y+  ++ Q  WR+  L Y+    N+   +    +L + +  F  +K +  + +++     R +    ++   RI  T    ++L+ +P D Q+ ++ + S  ++ +++       D    N V G+D  E  L +   VE +++S E          +  + R  R   YFI+  +M S L+ +L++ SF +    S  R+AL  T +LT  T    +   LPKIPY+  +D  + G  + +    + +A  +  F
Sbjct:   68 INIASIDSISEVNMDYTITMYFQQSWRDKRLAYAEMALNLTLDNRVADQLWLPDTYFLNDKKSFLHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIVFFWQGGD----NAVTGVDKLE--LPQFSIVELRLVSREVRFTTGSYPRLSLSFRIKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGVTTVLTMTTINTHLRETLPKIPYVKAIDVYLMGCFVFVFLALLEYAFVNYVF 332          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Zebrafish
Match: gabrb4 (gamma-aminobutyric acid type A receptor beta4 subunit [Source:ZFIN;Acc:ZDB-GENE-070424-211])

HSP 1 Score: 58.151 bits (139), Expect = 8.853e-9
Identity = 63/271 (23.25%), Postives = 125/271 (46.13%), Query Frame = 2
Query:   83 IKILKVDTVNEL---YSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNI-FTENKITISNEISIAKETGRAY----IVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAITSLWF 868
            I I  +D+++E+   Y+  ++ Q  WR+  L Y+    N+   +    +L + +  F  +K +  + +++     R +    ++   RI  T    ++L+ +P D Q+ ++ + S  ++ +++       D    N V G+D  E  L +   VE +++S E          +  + R  R   YFI+  +M S L+ +L++ SF +    S  R+AL  T +LT  T    +   LPKIPY+  +D  + G  + +    + +A  +  F
Sbjct:   68 INIASIDSISEVNMDYTITMYFQQSWRDKRLAYAEMALNLTLDNRVADQLWLPDTYFLNDKKSFLHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIVFFWQGGD----NAVTGVDKLE--LPQFSIVELRLVSREVRFTTGSYPRLSLSFRIKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGVTTVLTMTTINTHLRETLPKIPYVKAIDVYLMGCFVFVFLALLEYAFVNYVF 332          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Zebrafish
Match: gabrb2a (gamma-aminobutyric acid type A receptor beta2 subunit a [Source:ZFIN;Acc:ZDB-GENE-030131-8196])

HSP 1 Score: 50.0618 bits (118), Expect = 2.479e-6
Identity = 57/256 (22.27%), Postives = 115/256 (44.92%), Query Frame = 2
Query:  119 YSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNI-FTENKITISNEISIAKETGRAY----IVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAITSLWF 868
            Y+  ++ Q  WR+  L YS    N+   +    +L + +  F  +K +  + +++     R +    ++   RI  T    ++L+ +P D Q+ ++ + S  ++ ++++      D      V G++  E  L +   V+ K+IS            +  + +  R   YFI+  +M S L+ +L++ SF +    S  R+AL  T +LT  T    +   LPKIPY+  +D  + G  + +    + +A  +  F
Sbjct:   14 YTLTMYFQQAWRDKRLSYSEIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGD----GAVSGVERIE--LPQFSIVDYKLISKNVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIF 263          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Zebrafish
Match: gabrb1 (gamma-aminobutyric acid type A receptor beta1 subunit [Source:ZFIN;Acc:ZDB-GENE-090313-230])

HSP 1 Score: 49.6766 bits (117), Expect = 4.549e-6
Identity = 57/252 (22.62%), Postives = 120/252 (47.62%), Query Frame = 2
Query:   83 IKILKVDTVNEL---YSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNI-FTENKITISNEISIAKETGRAY----IVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYG 811
            I I  +D V+E+   Y+  ++ Q  WR+  L Y+    N+   +    +L + +  F  +K +  + +++     R +    ++   RI  T    ++L+ +P D Q+ ++ + S  ++ ++++        S +  VD ++  ++++  +  +  K++      G   R  + F  +  R   YFI+  +M S+L+ +L++ SF +    S  R+AL  T +LT  T    +   LPKIPY+  +D  + G
Sbjct:   75 IDISSIDMVSEVNMDYTITMYFQQSWRDKRLSYTGIPLNLTLDNRVADQLWVPDTYFINDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYW--QGGSSVTGVDNIELPQFSIIDYKTLSKKVV---FATGSYPRLSLSFKLK--RNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDIYLMG 319          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Xenopus
Match: ENSXETT00000004017.1 (gamma-aminobutyric acid (GABA) A receptor, beta 1 [Source:NCBI gene;Acc:100489344])

HSP 1 Score: 53.9138 bits (128), Expect = 3.356e-7
Identity = 58/252 (23.02%), Postives = 117/252 (46.43%), Query Frame = 2
Query:   83 IKILKVDTVNEL---YSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNI-FTENKITISNEISIAKETGRAY----IVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYG 811
            I +  +D V+E+   Y+  ++ Q  WR+  L YS    N+   +    +L + +  F  +K +  + +++     R +    ++   RI  T    ++L+ +P D Q+ ++ + S  ++ +++K      D      + G++  E  L +   ++ K++S            +  + R  R   YFI+  +M S+L+ +L++ SF +    S  R+AL  T +LT  T    +   LPKIPY+  +D  + G
Sbjct:   67 IDVASIDMVSEVNMDYTLTMYFQQSWRDKRLSYSGIPLNLTLDNRVADQLWVPDTYFLNDKRSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIKFYWNGGD----KAITGVEKIE--LPQFSIIDYKMVSRNVIFSTGAYPRLSLSFRLKRNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGITTVLTMTTISTHLRETLPKIPYVKAIDIYLMG 312          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Xenopus
Match: gabrb2 (gamma-aminobutyric acid (GABA) A receptor, beta 2 [Source:NCBI gene;Acc:100125027])

HSP 1 Score: 53.5286 bits (127), Expect = 4.023e-7
Identity = 64/273 (23.44%), Postives = 127/273 (46.52%), Query Frame = 2
Query:   83 IKILKVDTVNEL---YSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNI-FTENKITISNEISIAKETGRAY----IVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNEC--NIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAITSLWF 868
            I I  +D V+E+   Y+  ++ Q  WR+  L YSV   N+   +    +L + +  F  +K +  + +++     R +    ++   RI  T    ++L+ +P D Q+ ++ + S  ++ +++      +     N V G++  E  L +   ++  ++S     + G   R  + F  R  R   YFI+  +M S L+ +L++ SF +    S  R+AL  T +LT  T    +   LPKIPY+  +D  + G  + +    + +A+ +  F
Sbjct:   49 IDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYSVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIGF----YWRGGNNAVTGVERLE--LPQFSIIDYNLLSRNVVFSTGSYPRLSLSFKLR--RNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYIF 313          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Xenopus
Match: ENSXETT00000020832.1 (gamma-aminobutyric acid type A receptor theta subunit [Source:NCBI gene;Acc:100496398])

HSP 1 Score: 53.5286 bits (127), Expect = 4.381e-7
Identity = 54/252 (21.43%), Postives = 118/252 (46.83%), Query Frame = 2
Query:   83 IKILKVDTVNEL---YSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNI-FTENKITISNEISIAKETGRAY----IVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYG 811
            I I  +D ++E+   Y+  ++ Q  WR+  L Y+    N+   +    +L + +  F  +K +  + +++     R +    ++   RI  T    ++L+ +P D Q+ ++ + S  ++ +++K      + + +  V  ++  ++ +     +E++++S            +  + R  R   YFI+  +M S L+ +L++ SF +    S  R+AL  T +LT  T    +   LPKIPY+  +D  + G
Sbjct:   72 IHISSIDQISEVNMDYTITMYFQQSWRDKRLAYTALPLNLTLDNRVADQLWLPDTYFLNDKKSFLHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDQQNCTLEIESYGYTIDDIKFFWQGGEEAAVTGVSALELPQFTI-----IETRLVSKNVVFTTGSYPRLSLSFRIKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGVTTVLTMTTINTHLRETLPKIPYVKAIDVYLMG 318          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Xenopus
Match: gabrb2 (gamma-aminobutyric acid (GABA) A receptor, beta 2 [Source:NCBI gene;Acc:100125027])

HSP 1 Score: 53.5286 bits (127), Expect = 4.391e-7
Identity = 64/273 (23.44%), Postives = 127/273 (46.52%), Query Frame = 2
Query:   83 IKILKVDTVNEL---YSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNI-FTENKITISNEISIAKETGRAY----IVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNEC--NIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAITSLWF 868
            I I  +D V+E+   Y+  ++ Q  WR+  L YSV   N+   +    +L + +  F  +K +  + +++     R +    ++   RI  T    ++L+ +P D Q+ ++ + S  ++ +++      +     N V G++  E  L +   ++  ++S     + G   R  + F  R  R   YFI+  +M S L+ +L++ SF +    S  R+AL  T +LT  T    +   LPKIPY+  +D  + G  + +    + +A+ +  F
Sbjct:   66 IDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYSVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIGF----YWRGGNNAVTGVERLE--LPQFSIIDYNLLSRNVVFSTGSYPRLSLSFKLR--RNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYIF 330          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Xenopus
Match: ENSXETT00000020814.1 (gamma-aminobutyric acid type A receptor theta subunit [Source:NCBI gene;Acc:100496398])

HSP 1 Score: 53.5286 bits (127), Expect = 4.435e-7
Identity = 56/271 (20.66%), Postives = 125/271 (46.13%), Query Frame = 2
Query:   83 IKILKVDTVNEL---YSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNI-FTENKITISNEISIAKETGRAY----IVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAITSLWF 868
            I I  +D ++E+   Y+  ++ Q  WR+  L Y+    N+   +    +L + +  F  +K +  + +++     R +    ++   RI  T    ++L+ +P D Q+ ++ + S  ++ +++K      + + +  V  ++  ++ +     +E++++S            +  + R  R   YFI+  +M S L+ +L++ SF +    S  R+AL  T +LT  T    +   LPKIPY+  +D  + G  + +    + +A  +  F
Sbjct:   55 IHISSIDQISEVNMDYTITMYFQQSWRDKRLAYTALPLNLTLDNRVADQLWLPDTYFLNDKKSFLHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDQQNCTLEIESYGYTIDDIKFFWQGGEEAAVTGVSALELPQFTI-----IETRLVSKNVVFTTGSYPRLSLSFRIKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGVTTVLTMTTINTHLRETLPKIPYVKAIDVYLMGCFVFVFLALLEYAFVNYVF 320          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Mouse
Match: Gabrb2 (gamma-aminobutyric acid (GABA) A receptor, subunit beta 2 [Source:MGI Symbol;Acc:MGI:95620])

HSP 1 Score: 56.225 bits (134), Expect = 4.661e-8
Identity = 62/271 (22.88%), Postives = 126/271 (46.49%), Query Frame = 2
Query:   83 IKILKVDTVNEL---YSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNI-FTENKITISNEISIAKETGRAY----IVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAITSLWF 868
            I I  +D V+E+   Y+  ++ Q  WR+  L Y+V   N+   +    +L + +  F  +K +  + +++     R +    ++   RI  T    ++L+ +P D Q+ ++ + S  ++ ++++      D    N V G+   E  L +   V+ K+I+ +          +  + +  R   YFI+  +M S L+ +L++ SF +    S  R+AL  T +LT  T    +   LPKIPY+  +D  + G  + +    + +A+ +  F
Sbjct:   66 IDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDD----NAVTGVTKIE--LPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYIF 330          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Mouse
Match: Gabrb2 (gamma-aminobutyric acid (GABA) A receptor, subunit beta 2 [Source:MGI Symbol;Acc:MGI:95620])

HSP 1 Score: 55.8398 bits (133), Expect = 6.516e-8
Identity = 62/271 (22.88%), Postives = 126/271 (46.49%), Query Frame = 2
Query:   83 IKILKVDTVNEL---YSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNI-FTENKITISNEISIAKETGRAY----IVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAITSLWF 868
            I I  +D V+E+   Y+  ++ Q  WR+  L Y+V   N+   +    +L + +  F  +K +  + +++     R +    ++   RI  T    ++L+ +P D Q+ ++ + S  ++ ++++      D    N V G+   E  L +   V+ K+I+ +          +  + +  R   YFI+  +M S L+ +L++ SF +    S  R+AL  T +LT  T    +   LPKIPY+  +D  + G  + +    + +A+ +  F
Sbjct:   66 IDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDD----NAVTGVTKIE--LPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYIF 330          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Mouse
Match: Gabrb3 (gamma-aminobutyric acid (GABA) A receptor, subunit beta 3 [Source:MGI Symbol;Acc:MGI:95621])

HSP 1 Score: 54.299 bits (129), Expect = 1.983e-7
Identity = 60/252 (23.81%), Postives = 116/252 (46.03%), Query Frame = 2
Query:   83 IKILKVDTVNEL---YSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNI-FTENKITISNEISIAKETGRAY----IVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYG 811
            I I  +D V+E+   Y+  ++ Q  WR+  L YS    N+   +    +L + +  F  +K +  + +++     R +    ++   RI  T    ++L+ +P D Q+ ++ + S  ++ ++++      D      V G++  E  L +   VE +++S            +  + R  R   YFI+  +M S L+ +L++ SF +    S  R+AL  T +LT  T    +   LPKIPY+  +D  + G
Sbjct:   89 IDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGD----KAVTGVERIE--LPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMG 334          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Mouse
Match: Gabrb3 (gamma-aminobutyric acid (GABA) A receptor, subunit beta 3 [Source:MGI Symbol;Acc:MGI:95621])

HSP 1 Score: 53.9138 bits (128), Expect = 2.195e-7
Identity = 60/252 (23.81%), Postives = 116/252 (46.03%), Query Frame = 2
Query:   83 IKILKVDTVNEL---YSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNI-FTENKITISNEISIAKETGRAY----IVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYG 811
            I I  +D V+E+   Y+  ++ Q  WR+  L YS    N+   +    +L + +  F  +K +  + +++     R +    ++   RI  T    ++L+ +P D Q+ ++ + S  ++ ++++      D      V G++  E  L +   VE +++S            +  + R  R   YFI+  +M S L+ +L++ SF +    S  R+AL  T +LT  T    +   LPKIPY+  +D  + G
Sbjct:   67 IDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGD----KAVTGVERIE--LPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMG 312          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Mouse
Match: Gabrb3 (gamma-aminobutyric acid (GABA) A receptor, subunit beta 3 [Source:MGI Symbol;Acc:MGI:95621])

HSP 1 Score: 53.9138 bits (128), Expect = 2.195e-7
Identity = 60/252 (23.81%), Postives = 116/252 (46.03%), Query Frame = 2
Query:   83 IKILKVDTVNEL---YSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNI-FTENKITISNEISIAKETGRAY----IVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYG 811
            I I  +D V+E+   Y+  ++ Q  WR+  L YS    N+   +    +L + +  F  +K +  + +++     R +    ++   RI  T    ++L+ +P D Q+ ++ + S  ++ ++++      D      V G++  E  L +   VE +++S            +  + R  R   YFI+  +M S L+ +L++ SF +    S  R+AL  T +LT  T    +   LPKIPY+  +D  + G
Sbjct:   67 IDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGD----KAVTGVERIE--LPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMG 312          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. UniProt/SwissProt
Match: sp|P63138|GBRB2_RAT (Gamma-aminobutyric acid receptor subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Gabrb2 PE=1 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 3.261e-7
Identity = 62/271 (22.88%), Postives = 126/271 (46.49%), Query Frame = 2
Query:   83 IKILKVDTVNEL---YSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNI-FTENKITISNEISIAKETGRAY----IVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAITSLWF 868
            I I  +D V+E+   Y+  ++ Q  WR+  L Y+V   N+   +    +L + +  F  +K +  + +++     R +    ++   RI  T    ++L+ +P D Q+ ++ + S  ++ ++++      D    N V G+   E  L +   V+ K+I+ +          +  + +  R   YFI+  +M S L+ +L++ SF +    S  R+AL  T +LT  T    +   LPKIPY+  +D  + G  + +    + +A+ +  F
Sbjct:   66 IDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDD----NAVTGVTKIE--LPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYIF 330          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. UniProt/SwissProt
Match: sp|P63137|GBRB2_MOUSE (Gamma-aminobutyric acid receptor subunit beta-2 OS=Mus musculus OX=10090 GN=Gabrb2 PE=1 SV=2)

HSP 1 Score: 55.8398 bits (133), Expect = 4.558e-7
Identity = 62/271 (22.88%), Postives = 126/271 (46.49%), Query Frame = 2
Query:   83 IKILKVDTVNEL---YSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNI-FTENKITISNEISIAKETGRAY----IVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAITSLWF 868
            I I  +D V+E+   Y+  ++ Q  WR+  L Y+V   N+   +    +L + +  F  +K +  + +++     R +    ++   RI  T    ++L+ +P D Q+ ++ + S  ++ ++++      D    N V G+   E  L +   V+ K+I+ +          +  + +  R   YFI+  +M S L+ +L++ SF +    S  R+AL  T +LT  T    +   LPKIPY+  +D  + G  + +    + +A+ +  F
Sbjct:   66 IDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDD----NAVTGVTKIE--LPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYIF 330          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. UniProt/SwissProt
Match: sp|P0C2W5|GBRB2_BOVIN (Gamma-aminobutyric acid receptor subunit beta-2 (Fragment) OS=Bos taurus OX=9913 GN=GABRB2 PE=1 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 5.052e-7
Identity = 62/271 (22.88%), Postives = 126/271 (46.49%), Query Frame = 2
Query:   83 IKILKVDTVNEL---YSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNI-FTENKITISNEISIAKETGRAY----IVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAITSLWF 868
            I I  +D V+E+   Y+  ++ Q  WR+  L Y+V   N+   +    +L + +  F  +K +  + +++     R +    ++   RI  T    ++L+ +P D Q+ ++ + S  ++ ++++      D    N V G+   E  L +   V+ K+I+ +          +  + +  R   YFI+  +M S L+ +L++ SF +    S  R+AL  T +LT  T    +   LPKIPY+  +D  + G  + +    + +A+ +  F
Sbjct:   64 IDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTTACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDD----NAVTGVTKIE--LPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYIF 328          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. UniProt/SwissProt
Match: sp|D1LYT2|GBRB2_MACMU (Gamma-aminobutyric acid receptor subunit beta-2 OS=Macaca mulatta OX=9544 GN=GABRB2 PE=2 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 5.434e-7
Identity = 62/271 (22.88%), Postives = 126/271 (46.49%), Query Frame = 2
Query:   83 IKILKVDTVNEL---YSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNI-FTENKITISNEISIAKETGRAY----IVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAITSLWF 868
            I I  +D V+E+   Y+  ++ Q  WR+  L Y+V   N+   +    +L + +  F  +K +  + +++     R +    ++   RI  T    ++L+ +P D Q+ ++ + S  ++ ++++      D    N V G+   E  L +   V+ K+I+ +          +  + +  R   YFI+  +M S L+ +L++ SF +    S  R+AL  T +LT  T    +   LPKIPY+  +D  + G  + +    + +A+ +  F
Sbjct:   66 IDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDD----NAVTGVTKIE--LPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYIF 330          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. UniProt/SwissProt
Match: sp|P47870|GBRB2_HUMAN (Gamma-aminobutyric acid receptor subunit beta-2 OS=Homo sapiens OX=9606 GN=GABRB2 PE=1 SV=2)

HSP 1 Score: 55.4546 bits (132), Expect = 5.434e-7
Identity = 62/271 (22.88%), Postives = 126/271 (46.49%), Query Frame = 2
Query:   83 IKILKVDTVNEL---YSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNI-FTENKITISNEISIAKETGRAY----IVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAITSLWF 868
            I I  +D V+E+   Y+  ++ Q  WR+  L Y+V   N+   +    +L + +  F  +K +  + +++     R +    ++   RI  T    ++L+ +P D Q+ ++ + S  ++ ++++      D    N V G+   E  L +   V+ K+I+ +          +  + +  R   YFI+  +M S L+ +L++ SF +    S  R+AL  T +LT  T    +   LPKIPY+  +D  + G  + +    + +A+ +  F
Sbjct:   66 IDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDD----NAVTGVTKIE--LPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYIF 330          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. TrEMBL
Match: A0A3R7CFX9 (Neuronal acetylcholine receptor subunit alpha-7 OS=Clonorchis sinensis OX=79923 GN=CHRNA7 PE=4 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 2.272e-64
Identity = 137/344 (39.83%), Postives = 192/344 (55.81%), Query Frame = 2
Query:   62 IYLRCVFIKILKVDTVNELYSGEIFLQAKWREPLLDYS----------------------------VETKNIDFSHYWNPKLSISNIFTENKITISNEISIAKETGRAYIVEKKRIRATFNETLELQHFPFDCQDLSVSVISDFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKRE--VMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAITSLWFTDPTVNTAIGMNNLKPTEMIVALTIASFYVLSVMIFGLTIYYDVG 1003
            + L  +F+KI +VDTVNE Y  +IFLQA+WREPLLD +                            + T  +    +WNP+L + N   E    +S+E+   +    AY+VEK+RI+  F+ETLEL+HFPFDCQDLSV+V  D +  EV+L   P ++S+++     DSQEW ++ HV + S  I    + G  KR    ++FT R+ R+  YF++N  +IS +L LL+F+ FSVP   +  RL L   +LLT+VTFK A S NLPKI YLTYLDK +  N  M++ + +WH I    F             LK  E  V  T+ S Y L  ++FGLT+Y D G
Sbjct:   39 VELMLIFVKIGQVDTVNERYQADIFLQARWREPLLDATWNTSRPRNNFRTFKMVENPVMELAPKRHLHTLKLQDDEFWNPRLLLDNAQGEPIEIVSHEVEFVEPDFEAYLVEKRRIKGVFHETLELKHFPFDCQDLSVTVTCDRTVEEVELVPSPTEVSQVDRRCAADSQEWKIFHHVDIASMEIQTAYSPGTCKRRHPGLVFTSRSARRAGYFMVNMALISCVLSLLSFSVFSVPVDGN--RLQLSLLLLLTTVTFKFAASQNLPKISYLTYLDKMVLANFFMLVILTVWHTIARSVFAK--------YPGLKDKEQYVVYTLLSAYCLGAVVFGLTVYLDAG 372          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. TrEMBL
Match: A0A4E0RSR9 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_005714 PE=4 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 1.109e-63
Identity = 136/339 (40.12%), Postives = 188/339 (55.46%), Query Frame = 2
Query:   77 VFIKILKVDTVNELYSGEIFLQAKWREPLLDYS----------------------------VETKNIDFSHYWNPKLSISNIFTENKITISNEISIAKETGRAYIVEKKRIRATFNETLELQHFPFDCQDLSVSVISDFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKRE--VMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAITSLWFTDPTVNTAIGMNNLKPTEMIVALTIASFYVLSVMIFGLTIYYDVG 1003
            +F+KI +VDTVNE Y  +IFLQA+WREPLLD +                            + T  +    +WNP+L + N   E    +S+E+   + T  AY+VEK+RI+  F+ETLEL+HFPFD QDLSV+V  D S +EV L   P ++S+++     DSQEW ++ HV VE   I    + G  KR    ++FT R+ R+  YF++N  +IS +L LL+F  FSVP   +  RL     +LLT+VTFK A S NLPKI YLTYLDK +  N  M++ + +WH I          + +     L   E  V  T+ S Y L  +IFGLT+Y D G
Sbjct:    3 IFVKIGQVDTVNERYQADIFLQARWREPLLDATWKSERAQKNWRGKSGVENPIQDLVPKRHLHTLGLQDDEFWNPRLLLDNAQGEPIEIVSHEVEFVEPTFEAYLVEKRRIKGVFHETLELKHFPFDVQDLSVTVTCDRSVDEVLLVPSPTEVSQVDRRGAADSQEWKIFHHVDVERMEIQTAYSPGTSKRRHPGLVFTSRSARRSGYFMVNMVLISCVLCLLSFCIFSVPVDGN--RLQQALLLLLTTVTFKFAASQNLPKISYLTYLDKVVLANFFMLVILTVWHTIAR--------SLSASYPKLLDNEKYVVYTLLSSYCLGAVIFGLTVYLDAG 331          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. TrEMBL
Match: A0A075A8W6 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_08254 PE=3 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 3.063e-62
Identity = 139/352 (39.49%), Postives = 196/352 (55.68%), Query Frame = 2
Query:   38 VKCPTTKDIYLRCVFIKILKVDTVNELYSGEIFLQAKWREPLLDYS----------------------------VETKNIDFSHYWNPKLSISNIFTENKITISNEISIAKETGRAYIVEKKRIRATFNETLELQHFPFDCQDLSVSVISDFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKRE--VMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAITSLWFTDPTVNTAIGMNNLKPTEMIVALTIASFYVLSVMIFGLTIYYDVG 1003
            V+ P  + + L  +F+KI +VDTVNE Y  +IFLQA+WREPLLD +                            + T  +    +WNP+L + N   E    +S+E+   +    AY+VEK+RI+  F+ETLEL+HFPFDCQDLSV+V  D +  EV+L   P ++S+++     DSQEW ++ HV + S  I    + G  KR    ++FT R+ R+  YF++N  +IS +L LL+F+ FSVP   +  RL L   +LLT+VTFK A S NLPKI YLTYLDK +  N  M++ + +WH I    F             LK  E  V  T+ S Y L  ++FGLT+Y D G
Sbjct:  232 VRHPPAR-VELMLIFVKIGQVDTVNERYQADIFLQARWREPLLDATWNTSRPRNNFRTFNMVENPVMELAPKRHLHTLKLQDDEFWNPRLLLDNAQGEPIEIVSHEVEFVEPDFEAYLVEKRRIKGIFHETLELKHFPFDCQDLSVTVTCDRTVEEVELVPSPTEVSQVDRRCAADSQEWKIFHHVDIASMEIQTAYSPGTCKRRHPGLVFTSRSARRAGYFMVNMALISCVLSLLSFSVFSVPVDGN--RLQLSLLLLLTTVTFKFAASQNLPKISYLTYLDKMVLANFFMLVILTVWHTIARSVFAK--------YPGLKDKEQYVVYTLLSAYCLGAVVFGLTVYLDAG 572          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. TrEMBL
Match: A0A2H1C9P4 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_08727 PE=4 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 6.282e-60
Identity = 137/358 (38.27%), Postives = 189/358 (52.79%), Query Frame = 2
Query:   77 VFIKILKVDTVNELYSGEIFLQAKWREPLLDYS----------------------------VETKNIDFSHYWNPKLSISNIFTENKITISNEISIAKETGRAYIVEKKRIRATFNETLELQHFPFDCQDLSVSVISDFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHV-------------------QVESKIISNECNIGPEKRE--VMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAITSLWFTDPTVNTAIGMNNLKPTEMIVALTIASFYVLSVMIFGLTIYYDVG 1003
            +F+KI +VDTVNE Y  +IFLQA+WREPLLD +                            + T  +    +WNP+L + N   E    +S+E+   + T  AY+VEK+RI+  F+ETLEL+HFPFD QDLSV+V  D S +EV L   P ++S+++     DSQEW ++ HV                   QVE   I    + G  KR    ++FT R+ R+  YF++N  +IS +L LL+F  FSVP   +  RL     +LLT+VTFK A S NLPKI YLTYLDK +  N  M++ + +WH I          + +     L   E  V  T+ S Y L  +IFGLT+Y D G
Sbjct:    3 IFVKIGQVDTVNERYQADIFLQARWREPLLDATWKSERAQKNWRGKSGVENPIQDLVPKRHLHTLGLQDDEFWNPRLLLDNAQGEPIEIVSHEVEFVEPTFEAYLVEKRRIKGVFHETLELKHFPFDVQDLSVTVTCDRSVDEVLLVPSPTEVSQVDRRGAADSQEWKIFHHVDFFRCLPTFPPRPPPRPLAQVERMEIQTAYSPGTSKRRHPGLVFTSRSARRSGYFMVNMVLISCVLCLLSFCIFSVPVDGN--RLQQALLLLLTTVTFKFAASQNLPKISYLTYLDKVVLANFFMLVILTVWHTIAR--------SLSASYPKLLDNEKYVVYTLLSSYCLGAVIFGLTVYLDAG 350          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. TrEMBL
Match: A0A5K4FCR6 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 9.333e-59
Identity = 147/370 (39.73%), Postives = 213/370 (57.57%), Query Frame = 2
Query:   62 IYLRCVFIKILKVDTVNELYSGEIFLQAKWREPLLDY-----------------SVETKNIDFS-------------HYWNPKLSISNIFTENKITISNEISIAKETGRAYIVEKKRIRATFNETLELQHFPFDCQDLSVSVISDFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKRE--VMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAITSLWFTDPTVNTAIGMNNLKPT----EMIVALTIASFYVLSVMIFGLTIYYDVGXXXXXXXXXXXXFENKIKQI 1063
            + L  +F+K+ +VDTVNE Y  +IFLQA+WREPLLD                  S+E    D +              +WNP+L I N   E    IS+E+   +    AY+VEK+RI+  F+ETLEL+HFPFDCQDLSV++  D + +EV+L   P ++S+++V    DSQEW ++ HV ++S  I    +    KR    ++FT R+ R+  YF++N  +IS +L LL+F++FSVP++    RL L   +LLT+VTFK A S NLPKI YLTYLDK +  N  M++ + +WHAI            A  ++  KP     E  V  ++ S Y +  ++FGLT+Y D G +RR MK+KD +F    +QI
Sbjct:  276 VELVLIFVKVGQVDTVNERYQADIFLQARWREPLLDAMWNKSSLKSKSSWQTNPSIENPFTDLTSKRQLNTLKLQDDEFWNPRLLIDNAEGEPIEIISHEVEFIEPDFEAYLVEKRRIKGIFHETLELRHFPFDCQDLSVTITCDRTTDEVELVASPTEVSQVDVRCAADSQEWKIFHHVDIKSIEIQTGYSPSTSKRHHPGLVFTSRSARRSGYFLVNMILISCVLCLLSFSAFSVPANE--NRLQLSLLLLLTTVTFKFAASQNLPKISYLTYLDKVVLVNFFMLVILTVWHAI------------ARAVSASKPKFLEYEHYVMYSLLSCYCIGSVLFGLTVYLDAGSRRRLMKRKDIEFNQYKQQI 631          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Cavefish
Match: gabrb4 (gamma-aminobutyric acid receptor subunit beta-4-like [Source:NCBI gene;Acc:103032374])

HSP 1 Score: 53.5286 bits (127), Expect = 2.192e-7
Identity = 60/252 (23.81%), Postives = 115/252 (45.63%), Query Frame = 2
Query:   83 IKILKVDTVNEL---YSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNI-FTENKITISNEISIAKETGRAY----IVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYG 811
            I I  +D+++E+   Y+  ++ Q  WR+  L Y     N+   +    +L + +  F  +K +  + +++     R +    ++   RI  T    ++L+ +P D Q+ ++ + S  ++ +++            N V G+D  E  L +   VE  ++S E          +  + R  R   YFI+  +M S L+ +L++ SF +    S  R+AL  T +LT  T    +   LPKIPY+  +D  + G
Sbjct:   67 INIASIDSISEVNMDYTITMYFQQSWRDKRLAYVEMPLNLTLDNRVADQLWLPDTYFLNDKKSFLHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIVF----FWQGGKNAVTGVDKLE--LPQFSIVELHLVSREVRFTTGSYPRLSLSFRIKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGVTTVLTMTTINTHLRETLPKIPYVKAIDVYLMG 312          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Cavefish
Match: gabrb4 (gamma-aminobutyric acid receptor subunit beta-4-like [Source:NCBI gene;Acc:103032374])

HSP 1 Score: 53.1434 bits (126), Expect = 3.471e-7
Identity = 62/271 (22.88%), Postives = 122/271 (45.02%), Query Frame = 2
Query:   83 IKILKVDTVNEL---YSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNI-FTENKITISNEISIAKETGRAY----IVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAITSLWF 868
            I I  +D+++E+   Y+  ++ Q  WR+  L Y     N+   +    +L + +  F  +K +  + +++     R +    ++   RI  T    ++L+ +P D Q+ ++ + S  ++ +++            N V G+D  E  L +   VE  ++S E          +  + R  R   YFI+  +M S L+ +L++ SF +    S  R+AL  T +LT  T    +   LPKIPY+  +D  + G  + +    + +A  +  F
Sbjct:   67 INIASIDSISEVNMDYTITMYFQQSWRDKRLAYVEMPLNLTLDNRVADQLWLPDTYFLNDKKSFLHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIVF----FWQGGKNAVTGVDKLE--LPQFSIVELHLVSREVRFTTGSYPRLSLSFRIKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGVTTVLTMTTINTHLRETLPKIPYVKAIDVYLMGCFVFVFLALLEYAFVNYVF 331          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Cavefish
Match: gabrb2a (gamma-aminobutyric acid type A receptor beta2 subunit [Source:NCBI gene;Acc:103045154])

HSP 1 Score: 52.373 bits (124), Expect = 5.087e-7
Identity = 60/252 (23.81%), Postives = 116/252 (46.03%), Query Frame = 2
Query:   83 IKILKVDTVNEL---YSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNI-FTENKITISNEISIAKETGRAY----IVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYG 811
            I I  +D V+E+   Y+  ++ Q  WR+  L YS    N+   +    +L + +  F  +K +  + +++     R +    ++   RI  T    ++L+ +P D Q+ ++ + S  ++ ++++      D      V G++  E  L +   V+ K+IS            +  + +  R   YFI+  +M S L+ +L++ SF +    S  R+AL  T +LT  T    +   LPKIPY+  +D  + G
Sbjct:   65 IDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYSEIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGD----GAVSGVERIE--LPQFSIVDYKLISKNVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMG 310          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Cavefish
Match: gabrb2a (gamma-aminobutyric acid type A receptor beta2 subunit [Source:NCBI gene;Acc:103045154])

HSP 1 Score: 52.373 bits (124), Expect = 6.094e-7
Identity = 60/252 (23.81%), Postives = 116/252 (46.03%), Query Frame = 2
Query:   83 IKILKVDTVNEL---YSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNI-FTENKITISNEISIAKETGRAY----IVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYG 811
            I I  +D V+E+   Y+  ++ Q  WR+  L YS    N+   +    +L + +  F  +K +  + +++     R +    ++   RI  T    ++L+ +P D Q+ ++ + S  ++ ++++      D      V G++  E  L +   V+ K+IS            +  + +  R   YFI+  +M S L+ +L++ SF +    S  R+AL  T +LT  T    +   LPKIPY+  +D  + G
Sbjct:   65 IDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYSEIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGD----GAVSGVERIE--LPQFSIVDYKLISKNVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMG 310          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Cavefish
Match: GABRB2 (gamma-aminobutyric acid receptor subunit beta-2 [Source:NCBI gene;Acc:103038806])

HSP 1 Score: 51.6026 bits (122), Expect = 9.451e-7
Identity = 61/271 (22.51%), Postives = 125/271 (46.13%), Query Frame = 2
Query:   83 IKILKVDTVNEL---YSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNI-FTENKITISNEISIAKETGRAY----IVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAITSLWF 868
            I I  +D V+E+   Y+  ++ Q  WR+  L YS    N+   +    +L + +  F  +K +  + +++     R +    ++   RI  T    ++L+ +P D Q+ ++ + S  ++ ++++     +     + V G++  E  L +   V+ K+IS            +  + +  R   YFI+  +M S L+ +L++ SF +    S  R+AL  T +LT  T    +   LPKIPY+  +D  + G  + +    + +A+ +  F
Sbjct:   68 IDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYSEIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEF----YWRGGNHAVTGVERIE--LPQFSIVDYKLISKNVVFSTGAYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYALVNYIF 332          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Nematostella
Match: EDO32790 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU26])

HSP 1 Score: 109.383 bits (272), Expect = 1.787e-26
Identity = 78/270 (28.89%), Postives = 137/270 (50.74%), Query Frame = 2
Query:   62 IYLRCVFIKILKVDTVNELYSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNIFTENKITISNEISIAKETGRAYIVEKKRIRATFNETLELQHFPFDCQDLSVSVISDFSANEVKLNECPHDLSKLNVVDGM---DSQEWNLYKHVQVESKIISNECNIGPEKRE--VMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAIT 856
            + +RC    +  +D + + ++ E+++ A WREP L    + + + + + W+PK+S SN    +++     +   + +      E  +IR TF E   L+ FP D Q+LS+ + SD+S   V   +   D++K + +        ++W LY HV  ++     E  +GP  R   V I T    R+  ++  N  ++ S+L  L+F SF++P   +  RL +   +LL SV +K   S +LP+  YLT+LDK   GN+L I  I + + I 
Sbjct:   18 VLIRCGISFLGDIDVIRQQFTCELWMTASWREPKLA-GKKNEEVKWDNEWSPKISFSNSLLLDRVYKGRRLYYEENSTVPLAQEVYKIRGTFKEQFSLEQFPVDLQELSIIISSDWSDRTVTFEK---DMAKPDYLRQQTFSSPRDWVLYPHVHTDTATQEGE-GLGPNDRSYPVYIITAHVRRRAVHYFWNTAVVMSVLTALSFASFAIPPQQTADRLTVTLLLLLISVAYKFVTSLHLPRTSYLTFLDKYQLGNLLFISFIAVLNTIA 282          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Nematostella
Match: EDO26859 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAV8])

HSP 1 Score: 55.4546 bits (132), Expect = 3.373e-9
Identity = 43/126 (34.13%), Postives = 67/126 (53.17%), Query Frame = 2
Query:  485 QEWNLYKHVQVESKIISNECNIGPEKRE--VMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAIT 856
            ++W LY HV  ++     E  +GP  R   V I T    R+  ++  N  ++ S+L  L+F SF++P   +  RL +   +LL SV +K   S +LP+  YLT+LDK   GN+L I  I + + I 
Sbjct:   16 RDWVLYPHVHTDTATQEGE-GLGPNDRSYPVYIITAHVRRRAVHYFWNTAVVMSVLTALSFASFAIPPQQTADRLTVTLLLLLISVAYKFVTSLHLPRTSYLTFLDKYQLGNLLFISFIAVLNTIA 140          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Nematostella
Match: EDO48848 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHH0])

HSP 1 Score: 53.9138 bits (128), Expect = 3.766e-8
Identity = 63/261 (24.14%), Postives = 121/261 (46.36%), Query Frame = 2
Query:  119 YSGEIFLQAKWREPLLDYSVET----KNIDFSHYWNPKLSISNI--FTENKITISNEISIAKETGRAYIVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLNECPHDLSKLNVVD---GMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAITSLWFT 871
            Y+ +IFL+  W +  L + + T     N      W P     N    + +K+T  N + + +  G+     +  IRA+    + L+ FP D Q   +++ S  +S++ +       D   L  V     M  Q    YK  +V    + NE  +G       +FT    R ++YF+I+ +   +L+ ++++ SF +P   +  R+ L  T +LT VT    +++++PK+ Y+  +DK + G  L + +  + +++  LW T
Sbjct:    8 YTLDIFLRQSWVDERLSHDLNTTMFLSNTVMDKIWLPDSYFVNAKQGSFHKVTKDNMMVMIQPDGQVQYNARVTIRASC--PMNLRKFPMDTQHCPLTLESYGYSSDHIVFKWEIEDGDGLGFVPESLKMLPQ----YKLARVHLSTLHNEYVVGNWSGIKALFTFE--RMYSYFVIHVYGPCALIVVVSWVSFLLPKEQAPARITLGVTSVLTVVTILNMLNNSMPKVNYVKTIDKYLIGCFLFVFATLVEYSLV-LWLT 259          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Nematostella
Match: EDO30047 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1W8])

HSP 1 Score: 53.1434 bits (126), Expect = 6.223e-8
Identity = 65/274 (23.72%), Postives = 126/274 (45.99%), Query Frame = 2
Query:   89 ILKVDTVNEL---YSGEIFLQAKWREPLLDYSVET----KNIDFSHYWNPKLSISNI--FTENKITISNEISIAKETGRAYIVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLNECPHDLSKLNVVD---GMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAITSLWFT 871
            +L +DT+N +   Y+ +IFL+  W +  L + + T     N      W P     N    + +K+T  N + + +  G+     +  IRA+    + L+ FP D Q   +++ S  +S++ +       D   L  V     M  Q    YK    E +  S  C + P     +       R ++YF+I+ +   +L+ ++++ SF +P   +  R+ L  T +LT VT    +++++PK+ Y+  +DK + G  L + +  + +++  LW T
Sbjct:   35 VLSIDTINVVDMDYTLDIFLRQSWVDERLSHDLNTTMFLSNTVMDKIWLPDSYFVNAKQGSFHKVTKDNMMVMIQPDGQVQYNARVTIRASC--PMNLRKFPMDTQHCPLTLESYGYSSDHIVFKWEIEDGDGLGFVPESLKMLPQ----YKLAPNEPR--SELCFVIPGNWSGIKALFTFERMYSYFVIHVYGPCALIVVVSWVSFLLPKEQAPARITLGVTSVLTVVTILNMLNNSMPKVNYVKTIDKYLIGCFLFVFATLVEYSLV-LWLT 299          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Nematostella
Match: EDO37396 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFV7])

HSP 1 Score: 52.373 bits (124), Expect = 1.807e-7
Identity = 61/257 (23.74%), Postives = 116/257 (45.14%), Query Frame = 2
Query:   98 VDTVNELYSGEIFLQAKWREPLLDYSVETKNIDFSHY-----WNPKLSISNIFTE--NKITISNEISIAKETGRAYIVEKKRIRATFNE--TLELQHFPFDCQDLSV----------SVISDFSANEVK-LNECPHDLS---KLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDK 799
            +D VN  ++ ++FL+ +W +P LD+ +  + I   H      W P     N  T   + +T  N++++    G    V K   R T     T++L+ FP D Q+  +           ++  +  N    L   P+ +    + ++V    S+EW+ Y        II N   +      V +F+    R +TYF+ + +  S ++  +++  F +P   +  R+A+  T LLT VT    ++ ++PK+ Y+  +DK
Sbjct:   73 IDVVNMDFTVDLFLRQEWVDPRLDHGLN-ETIYLGHRVMQKIWTPDSYFLNAKTAKMHHVTTPNQMTLIAPMG----VVKYNTRVTVKAACTIDLRSFPMDQQNCPLVLESYGYDRSHIVYHWEGNATDGLPFVPNRMRIMPQYSLVRLTLSREWHQY--------IIGNFSAV------VAVFSIE--RSYTYFLTHVYGTSCVIVFISWMGFVIPPDQTAARIAVGVTTLLTQVTVINILNSSMPKVSYVKSIDK 308          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Medaka
Match: GABRB2 (gamma-aminobutyric acid receptor subunit beta-2 [Source:NCBI gene;Acc:101167169])

HSP 1 Score: 53.1434 bits (126), Expect = 3.098e-7
Identity = 59/252 (23.41%), Postives = 117/252 (46.43%), Query Frame = 2
Query:   83 IKILKVDTVNEL---YSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNI-FTENKITISNEISIAKETGRAY----IVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYG 811
            I I  +D V+E+   Y+  ++ Q  WR+  L YS    N+   +    +L + +  F  +K +  + +++     R +    ++   RI  T    ++L+ +P D Q+ ++ + S  ++ ++++     +    +  V G++  E  L +   V+ K+IS            +  + +  R   YFI+  +M S L+ +L++ SF +    S  R+AL  T +LT  T    +   LPKIPY+  +D  + G
Sbjct:   67 IDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYSEIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEF----YWRGGVGAVTGVERIE--LPQFSIVDHKLISKNVVFSTGAYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDVYLMG 312          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Medaka
Match: gabrb2a (gamma-aminobutyric acid type A receptor beta2 subunit [Source:NCBI gene;Acc:101165154])

HSP 1 Score: 53.1434 bits (126), Expect = 3.176e-7
Identity = 60/252 (23.81%), Postives = 116/252 (46.03%), Query Frame = 2
Query:   83 IKILKVDTVNEL---YSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNI-FTENKITISNEISIAKETGRAY----IVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYG 811
            I I  +D V+E+   Y+  ++ Q  WR+  L YS    N+   +    +L + +  F  +K +  + +++     R +    ++   RI  T    ++L+ +P D Q+ ++ + S  ++ ++++     +       V G+D  E  L +   V+ K+IS            +  + +  R   YFI+  +M S L+ +L++ SF +    S  R+AL  T +LT  T    +   LPKIPY+  +D  + G
Sbjct:   63 IDISSIDMVSEVNMDYTLTMYFQQAWRDKRLSYSEIAYNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEF----YWRGGEGAVSGVDRIE--LPQFSIVDYKLISKNVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMG 308          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Medaka
Match: GABRB2 (gamma-aminobutyric acid receptor subunit beta-2 [Source:NCBI gene;Acc:101167169])

HSP 1 Score: 53.1434 bits (126), Expect = 3.535e-7
Identity = 59/252 (23.41%), Postives = 117/252 (46.43%), Query Frame = 2
Query:   83 IKILKVDTVNEL---YSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNI-FTENKITISNEISIAKETGRAY----IVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYG 811
            I I  +D V+E+   Y+  ++ Q  WR+  L YS    N+   +    +L + +  F  +K +  + +++     R +    ++   RI  T    ++L+ +P D Q+ ++ + S  ++ ++++     +    +  V G++  E  L +   V+ K+IS            +  + +  R   YFI+  +M S L+ +L++ SF +    S  R+AL  T +LT  T    +   LPKIPY+  +D  + G
Sbjct:   62 IDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYSEIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEF----YWRGGVGAVTGVERIE--LPQFSIVDHKLISKNVVFSTGAYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDVYLMG 307          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Medaka
Match: gabrb2a (gamma-aminobutyric acid type A receptor beta2 subunit [Source:NCBI gene;Acc:101165154])

HSP 1 Score: 52.7582 bits (125), Expect = 4.236e-7
Identity = 60/252 (23.81%), Postives = 116/252 (46.03%), Query Frame = 2
Query:   83 IKILKVDTVNEL---YSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNI-FTENKITISNEISIAKETGRAY----IVEKKRIRATFNETLELQHFPFDCQDLSVSVIS-DFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYG 811
            I I  +D V+E+   Y+  ++ Q  WR+  L YS    N+   +    +L + +  F  +K +  + +++     R +    ++   RI  T    ++L+ +P D Q+ ++ + S  ++ ++++     +       V G+D  E  L +   V+ K+IS            +  + +  R   YFI+  +M S L+ +L++ SF +    S  R+AL  T +LT  T    +   LPKIPY+  +D  + G
Sbjct:   34 IDISSIDMVSEVNMDYTLTMYFQQAWRDKRLSYSEIAYNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEF----YWRGGEGAVSGVDRIE--LPQFSIVDYKLISKNVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMG 279          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Medaka
Match: gabrg1 (gamma-aminobutyric acid type A receptor gamma1 subunit [Source:NCBI gene;Acc:101155813])

HSP 1 Score: 52.373 bits (124), Expect = 4.835e-7
Identity = 70/296 (23.65%), Postives = 120/296 (40.54%), Query Frame = 2
Query:   89 ILKVDTVNELYSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNIFTENK-------ITISNEISIAKETGRAYIVEKKRIRATFNET--LELQHFPFDCQDLSVSVISDFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILM----IMSICIWHAITSLWFTDPTVNTAIGMNNLKPTEMIVAL 937
            I  VD +N  Y+ +IF    W +  L ++   K +  +     K+ I + F  N        IT  N +      GR        +R T N    L+L +FP D     +    +FS+     NE  +   +   V+  D + W LY+   V  +  S+  +    +  +M      +R+  YF I  ++  S++ +L++ SF +       R +L  T +LT  T       +LPK+ Y+T +D  +    +     +M     H  TS   T  T N    M NL+P   ++ +
Sbjct:   88 IGPVDPINMEYTIDIFFAQTWYDSRLKFNSSMKLLMLNSNMVGKIWIPDTFFRNSRKSDAHWITTPNRLLRLWSNGRVMYT----LRLTINAECYLKLHNFPMDEHSCPL----EFSSYGYPRNEIMYRWQR-RAVEVADQRYWRLYQFAFVGMRNTSDVAHTQSGEYVIMTIFFDLSRRMGYFTIQTYIPCSMIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTISRKSLPKVSYITAMDLFVSVCFIFTFAALMEYGTLHYFTSNRQTKKTKNKGSSMANLRPGTSLLQM 374          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Planmine SMEST
Match: SMESG000041912.1 (SMESG000041912.1)

HSP 1 Score: 664.07 bits (1712), Expect = 0.000e+0
Identity = 351/351 (100.00%), Postives = 351/351 (100.00%), Query Frame = 2
Query:   17 MDLDSVEVKCPTTKDIYLRCVFIKILKVDTVNELYSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNIFTENKITISNEISIAKETGRAYIVEKKRIRATFNETLELQHFPFDCQDLSVSVISDFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAITSLWFTDPTVNTAIGMNNLKPTEMIVALTIASFYVLSVMIFGLTIYYDVGXXXXXXXXXXXXFENKIKQILD 1069
            MDLDSVEVKCPTTKDIYLRCVFIKILKVDTVNELYSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNIFTENKITISNEISIAKETGRAYIVEKKRIRATFNETLELQHFPFDCQDLSVSVISDFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMISSLLFLLTFTSFSVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAITSLWFTDPTVNTAIGMNNLKPTEMIVALTIASFYVLSVMIFGLTIYYDVGKQRRKMKQKDKDFENKIKQILD
Sbjct:    1 MDLDSVEVKCPTTKDIYLRCVFIKILKVDTVNELYSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNIFTENKITISNEISIAKETGRAYIVEKKRIRATFNETLELQHFPFDCQDLSVSVISDFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMISSLLFLLTFTSFSVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAITSLWFTDPTVNTAIGMNNLKPTEMIVALTIASFYVLSVMIFGLTIYYDVGKQRRKMKQKDKDFENKIKQILD 351          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Planmine SMEST
Match: SMESG000041796.1 (SMESG000041796.1)

HSP 1 Score: 418.313 bits (1074), Expect = 1.147e-144
Identity = 206/330 (62.42%), Postives = 261/330 (79.09%), Query Frame = 2
Query:   17 MDLDSVEVKCPTTKDIYLRCVFIKILKVDTVNELYSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNIFTENKITISNEISIAK-ETGRAYIVEKKRIRATFNETLELQHFPFDCQDLSVSVISDFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAITSLWFTDPTVNTAIGMNNLKPTEMIVALTIASFYVLSVMIFGLTIYYDVG 1003
            M+ +S   +  T + +YLRCVFIKI KVDTVNE YSGEIFL AKWREPLLD   + K+I  S +WNPKLSI NIF   K T S E+S  +    RA++VEK RI+A F ETLELQHFPFDCQDLS+SV +++S  E+++ E P+D+SKLN +DG++SQEWNLY+HV+VE+KI+ N+CN GP++R++M FTCRATR+F YF+IN+FMISS+ FLLTF+SFS+ S+N+YGRLALC T LLTSVTFKVAVS NLPKIPYLTYLDKTI GNILMIM +CIWHA+TS WF DP+ NT + M++L   E I+  T+  FY+++++ F   IYYD G
Sbjct:   54 MENNSKSNQIKTKRKVYLRCVFIKIYKVDTVNEFYSGEIFLHAKWREPLLDNKSDLKDISLSTFWNPKLSIENIFQITKSTTSLEVSFDEGNNKRAFVVEKTRIKAAFRETLELQHFPFDCQDLSISVGTEYSIEELEMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTCRATRRFKYFLINHFMISSMFFLLTFSSFSIISTNTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILMIMLLCIWHAVTSFWFIDPSTNTTVAMSSLTNIENILIPTLLGFYLIAILTFAFIIYYDAG 383          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Planmine SMEST
Match: SMESG000041914.1 (SMESG000041914.1)

HSP 1 Score: 409.838 bits (1052), Expect = 3.407e-142
Identity = 214/350 (61.14%), Postives = 272/350 (77.71%), Query Frame = 2
Query:   17 MDLDSVEVKCPTTKDIYLRCVFIKILKVDTVNELYSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNIFTENKITISNEISIAKETGRAYIVEKKRIRATFNETLELQHFPFDCQDLSVSVISDFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAITSLWFTDPTVNTAIGMNNLKPTEMIVALTIASFYVLSVMIFGLTIYYDVGXXXXXXXXXXXXFENKIKQIL 1066
            M+  +  ++ P  + IYL+CVF+KILK+DTVNE+YSGEIFL+AKWREPLLD S    N D S YWNPK++ISNIF E K  +S E+  A ++G AYI EK+++RATF ETLELQHFPFDCQDLSV+V +D S +EVK+ ECPH+ S +N +DGMDSQEW+L+ HVQVESKII N+ NIG ++R++++FTCRA RQF YF+IN FMISS+ +LLTFTSF +  +N++GRL+LC TVLLTSVTFKVAVS NLPKIPYLTYLDKTI GNI+MIM  CIWHA+TSLW    + N A     LK  E  +   I  FY+++++IFGL IY+D GK+RR+MK KD +F   + +IL
Sbjct:    1 MENKAFVIEIPAPRQIYLKCVFLKILKIDTVNEVYSGEIFLEAKWREPLLDQSNYIDNQDLSSYWNPKIAISNIFVETKSLVSREVVFANKSGEAYISEKRKVRATFQETLELQHFPFDCQDLSVTVATDHSIDEVKMFECPHNKSTVNTIDGMDSQEWSLFNHVQVESKIILNDYNIGSKERQIIVFTCRAARQFKYFLINNFMISSMFYLLTFTSFGIQVTNTFGRLSLCMTVLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNIIMIMITCIWHALTSLWLFHLSNNEA--TTALKNIESGIIPAILIFYLIALLIFGLIIYFDAGKRRREMKGKDIEFNRALDKIL 348          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Planmine SMEST
Match: SMESG000041914.1 (SMESG000041914.1)

HSP 1 Score: 407.142 bits (1045), Expect = 8.879e-141
Identity = 212/338 (62.72%), Postives = 267/338 (78.99%), Query Frame = 2
Query:   53 TKDIYLRCVFIKILKVDTVNELYSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNIFTENKITISNEISIAKETGRAYIVEKKRIRATFNETLELQHFPFDCQDLSVSVISDFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAITSLWFTDPTVNTAIGMNNLKPTEMIVALTIASFYVLSVMIFGLTIYYDVGXXXXXXXXXXXXFENKIKQIL 1066
            ++ IYL+CVF+KILK+DTVNE+YSGEIFL+AKWREPLLD S    N D S YWNPK++ISNIF E K  +S E+  A ++G AYI EK+++RATF ETLELQHFPFDCQDLSV+V +D S +EVK+ ECPH+ S +N +DGMDSQEW+L+ HVQVESKII N+ NIG ++R++++FTCRA RQF YF+IN FMISS+ +LLTFTSF +  +N++GRL+LC TVLLTSVTFKVAVS NLPKIPYLTYLDKTI GNI+MIM  CIWHA+TSLW    + N A     LK  E  +   I  FY+++++IFGL IY+D GK+RR+MK KD +F   + +IL
Sbjct:   32 SRQIYLKCVFLKILKIDTVNEVYSGEIFLEAKWREPLLDQSNYIDNQDLSSYWNPKIAISNIFVETKSLVSREVVFANKSGEAYISEKRKVRATFQETLELQHFPFDCQDLSVTVATDHSIDEVKMFECPHNKSTVNTIDGMDSQEWSLFNHVQVESKIILNDYNIGSKERQIIVFTCRAARQFKYFLINNFMISSMFYLLTFTSFGIQVTNTFGRLSLCMTVLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNIIMIMITCIWHALTSLWLFHLSNNEA--TTALKNIESGIIPAILIFYLIALLIFGLIIYFDAGKRRREMKGKDIEFNRALDKIL 367          
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Planmine SMEST
Match: SMESG000064435.1 (SMESG000064435.1)

HSP 1 Score: 402.519 bits (1033), Expect = 3.261e-139
Identity = 204/349 (58.45%), Postives = 275/349 (78.80%), Query Frame = 2
Query:   17 MDLDSVEVKCPTTKDIYLRCVFIKILKVDTVNELYSGEIFLQAKWREPLLDYSVETKNIDFSHYWNPKLSISNIFTENKITISNEISIAKETGRAYIVEKKRIRATFNETLELQHFPFDCQDLSVSVISDFSANEVKLNECPHDLSKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQFTYFIINYFMIXXXXXXXXXXXXXVPSSNSYGRLALCKTVLLTSVTFKVAVSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAITSLWFTDPTVNTAIGMNNLKPTEMIVALTIASFYVLSVMIFGLTIYYDVGXXXXXXXXXXXXFENKIKQI 1063
            M+ DS   + P  K IYLRCVFIKI KVDTVNE Y  EIFLQAKWREPLLD   + KNID  ++WNPKL I NIFTENK+++S E+S +++ G AY++EK+R++A+F+E LEL+HFPFDCQDLS+ V +++S++ V L E PHD SKLNV DG++SQEW+LY HV+V    + N+CNIGPE+R ++IFTCRA+R+F YF+IN+F+ISS+ FLLTFTSFS+ S+N++GRL LC T LLTSVTFKVAVS +LPKIPYLTYLDKTI GNI MIM +C+WHA T++++ + +++T   +  ++  E+I+  +I SFY L+VM++ + IYYD G +RR+M  KD +FE   K++
Sbjct:    1 MEEDSESNQEPVQKKIYLRCVFIKIFKVDTVNENYYAEIFLQAKWREPLLDNECDYKNIDLKNFWNPKLRIENIFTENKVSVSLEVSYSEKEGVAYLMEKRRVKASFHEILELKHFPFDCQDLSIIVTTEYSSDYVDLMESPHDPSKLNVSDGIESQEWSLYSHVEVLKDRLKNDCNIGPEERSILIFTCRASRRFRYFLINHFLISSIFFLLTFTSFSIISTNAFGRLQLCMTTLLTSVTFKVAVSQSLPKIPYLTYLDKTILGNIFMIMCVCMWHAGTAIFYFNTSISTDATVERIRNVELILIPSILSFYGLAVMVYSIIIYYDAGTRRREMAVKDAEFEKAWKKV 349          
The following BLAST results are available for this feature:
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GABRB22.192e-822.88gamma-aminobutyric acid type A receptor beta2 subu... [more]
GABRB28.433e-822.88gamma-aminobutyric acid type A receptor beta2 subu... [more]
GABRB28.768e-822.88gamma-aminobutyric acid type A receptor beta2 subu... [more]
GABRB28.768e-822.88gamma-aminobutyric acid type A receptor beta2 subu... [more]
GABRB21.132e-722.88gamma-aminobutyric acid type A receptor beta2 subu... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pHCl-21.070e-623.08gene:FBgn0039840 transcript:FBtr0347502[more]
pHCl-21.070e-623.08gene:FBgn0039840 transcript:FBtr0085766[more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gabrb46.056e-923.25gamma-aminobutyric acid type A receptor beta4 subu... [more]
gabrb48.853e-923.25gamma-aminobutyric acid type A receptor beta4 subu... [more]
gabrb2a2.479e-622.27gamma-aminobutyric acid type A receptor beta2 subu... [more]
gabrb14.549e-622.62gamma-aminobutyric acid type A receptor beta1 subu... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000004017.13.356e-723.02gamma-aminobutyric acid (GABA) A receptor, beta 1 ... [more]
gabrb24.023e-723.44gamma-aminobutyric acid (GABA) A receptor, beta 2 ... [more]
ENSXETT00000020832.14.381e-721.43gamma-aminobutyric acid type A receptor theta subu... [more]
gabrb24.391e-723.44gamma-aminobutyric acid (GABA) A receptor, beta 2 ... [more]
ENSXETT00000020814.14.435e-720.66gamma-aminobutyric acid type A receptor theta subu... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gabrb24.661e-822.88gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Gabrb26.516e-822.88gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Gabrb31.983e-723.81gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Gabrb32.195e-723.81gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Gabrb32.195e-723.81gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P63138|GBRB2_RAT3.261e-722.88Gamma-aminobutyric acid receptor subunit beta-2 OS... [more]
sp|P63137|GBRB2_MOUSE4.558e-722.88Gamma-aminobutyric acid receptor subunit beta-2 OS... [more]
sp|P0C2W5|GBRB2_BOVIN5.052e-722.88Gamma-aminobutyric acid receptor subunit beta-2 (F... [more]
sp|D1LYT2|GBRB2_MACMU5.434e-722.88Gamma-aminobutyric acid receptor subunit beta-2 OS... [more]
sp|P47870|GBRB2_HUMAN5.434e-722.88Gamma-aminobutyric acid receptor subunit beta-2 OS... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3R7CFX92.272e-6439.83Neuronal acetylcholine receptor subunit alpha-7 OS... [more]
A0A4E0RSR91.109e-6340.12Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A075A8W63.063e-6239.49Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A2H1C9P46.282e-6038.27Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A5K4FCR69.333e-5939.73Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gabrb42.192e-723.81gamma-aminobutyric acid receptor subunit beta-4-li... [more]
gabrb43.471e-722.88gamma-aminobutyric acid receptor subunit beta-4-li... [more]
gabrb2a5.087e-723.81gamma-aminobutyric acid type A receptor beta2 subu... [more]
gabrb2a6.094e-723.81gamma-aminobutyric acid type A receptor beta2 subu... [more]
GABRB29.451e-722.51gamma-aminobutyric acid receptor subunit beta-2 [S... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO327901.787e-2628.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO268593.373e-934.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488483.766e-824.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO300476.223e-823.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373961.807e-723.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GABRB23.098e-723.41gamma-aminobutyric acid receptor subunit beta-2 [S... [more]
gabrb2a3.176e-723.81gamma-aminobutyric acid type A receptor beta2 subu... [more]
GABRB23.535e-723.41gamma-aminobutyric acid receptor subunit beta-2 [S... [more]
gabrb2a4.236e-723.81gamma-aminobutyric acid type A receptor beta2 subu... [more]
gabrg14.835e-723.65gamma-aminobutyric acid type A receptor gamma1 sub... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041912.10.000e+0100.00SMESG000041912.1[more]
SMESG000041796.11.147e-14462.42SMESG000041796.1[more]
SMESG000041914.13.407e-14261.14SMESG000041914.1[more]
SMESG000041914.18.879e-14162.72SMESG000041914.1[more]
SMESG000064435.13.261e-13958.45SMESG000064435.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022746 ID=SMED30022746|Name=Gamma-aminobutyric acid receptor subunit beta-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1250bp
GATCTTTTTAACAAAAATGGATCTTGATTCCGTAGAAGTCAAATGCCCAA
CTACAAAAGATATCTATCTTAGATGTGTGTTTATAAAAATTTTGAAAGTT
GATACGGTCAACGAGCTTTACTCTGGAGAAATATTTCTCCAAGCAAAGTG
GAGAGAACCCCTTCTCGATTATTCTGTGGAAACAAAGAATATAGATTTTT
CACATTATTGGAATCCTAAATTATCAATTTCAAATATTTTCACTGAAAAC
AAAATAACTATCTCAAATGAAATTTCCATTGCTAAAGAAACGGGTCGCGC
TTACATTGTTGAAAAGAAAAGGATTCGTGCTACCTTTAATGAAACATTAG
AACTTCAACATTTCCCATTTGATTGTCAAGATTTGTCGGTATCTGTTATT
TCAGATTTTTCAGCAAACGAAGTGAAACTGAATGAATGTCCCCATGACTT
AAGCAAGTTAAATGTTGTTGATGGAATGGATTCTCAAGAATGGAATTTGT
ATAAGCACGTTCAGGTTGAGAGCAAAATCATATCAAATGAATGTAACATT
GGTCCAGAAAAACGAGAAGTTATGATATTTACGTGTCGTGCGACACGACA
ATTTACATATTTTATTATAAATTATTTTATGATAAGCTCACTGCTATTTT
TATTAACATTCACCAGCTTTAGTGTGCCAAGTTCTAATTCATATGGCAGA
CTGGCATTATGTAAGACAGTATTATTAACAAGTGTTACATTCAAAGTAGC
GGTTAGTCACAATCTTCCGAAGATTCCTTATCTTACTTACTTGGACAAAA
CAATTTATGGAAATATCCTCATGATAATGTCAATTTGTATTTGGCATGCA
ATAACCTCGTTATGGTTCACCGACCCAACCGTAAATACGGCAATTGGAAT
GAACAATTTGAAACCAACGGAAATGATTGTAGCTCTGACGATCGCGTCAT
TTTATGTACTGTCAGTAATGATATTCGGACTTACCATCTACTATGACGTA
GGCAAGCAAAGGAGAAAGATGAAACAAAAAGATAAAGATTTTGAAAATAA
AATTAAACAAATCTTGGATGAAAATATTTTTTGTGAAATTTGCTGATTTA
TTAATATTTTCAAGACTGGTAAACTTAGTTTTTCATTTTTATCAGTTGAT
ATTTTTCTAAACGGCCACCACAAATACTATGATTGCAAAACTTTGAATGG
TTTATGTGTTTTATTTTTGAGTGAATAATATTTTTGAATAATTTTAAAAA
back to top

protein sequence of SMED30022746-orf-1

>SMED30022746-orf-1 ID=SMED30022746-orf-1|Name=SMED30022746-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=365bp
IFLTKMDLDSVEVKCPTTKDIYLRCVFIKILKVDTVNELYSGEIFLQAKW
REPLLDYSVETKNIDFSHYWNPKLSISNIFTENKITISNEISIAKETGRA
YIVEKKRIRATFNETLELQHFPFDCQDLSVSVISDFSANEVKLNECPHDL
SKLNVVDGMDSQEWNLYKHVQVESKIISNECNIGPEKREVMIFTCRATRQ
FTYFIINYFMISSLLFLLTFTSFSVPSSNSYGRLALCKTVLLTSVTFKVA
VSHNLPKIPYLTYLDKTIYGNILMIMSICIWHAITSLWFTDPTVNTAIGM
NNLKPTEMIVALTIASFYVLSVMIFGLTIYYDVGKQRRKMKQKDKDFENK
IKQILDENIFCEIC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR036734Neur_chan_lig-bd_sf
IPR006201Neur_channel
IPR036719Neuro-gated_channel_TM_sf
IPR006202Neur_chan_lig-bd
IPR006029Neurotrans-gated_channel_TM
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0005216ion channel activity
GO:0005230extracellular ligand-gated ion channel activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
GO:0034220ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 335..355
NoneNo IPR availableGENE3DG3DSA:1.20.58.390coord: 196..347
e-value: 6.7E-14
score: 53.8
NoneNo IPR availablePANTHERPTHR18945:SF768coord: 24..306
NoneNo IPR availableCDDcd19050LGIC_TM_bactcoord: 201..273
e-value: 2.57296E-10
score: 55.2922
NoneNo IPR availableCDDcd18988LGIC_ECD_bactcoord: 25..141
e-value: 2.46064E-14
score: 68.4734
NoneNo IPR availableTMHMMTMhelixcoord: 307..329
NoneNo IPR availableTMHMMTMhelixcoord: 231..253
NoneNo IPR availableTMHMMTMhelixcoord: 199..221
NoneNo IPR availableTMHMMTMhelixcoord: 265..287
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilyGENE3DG3DSA:2.70.170.10coord: 14..192
e-value: 1.9E-16
score: 62.1
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilySUPERFAMILYSSF63712Nicotinic receptor ligand binding domain-likecoord: 17..176
IPR006202Neurotransmitter-gated ion-channel ligand-binding domainPFAMPF02931Neur_chan_LBDcoord: 18..177
e-value: 2.2E-8
score: 33.8
IPR006201Neurotransmitter-gated ion-channelPANTHERPTHR18945NEUROTRANSMITTER GATED ION CHANNELcoord: 24..306
IPR036719Neurotransmitter-gated ion-channel transmembrane domain superfamilySUPERFAMILYSSF90112Neurotransmitter-gated ion-channel transmembrane porecoord: 200..290