Dynein regulatory complex subunit 3

Overview
NameDynein regulatory complex subunit 3
Smed IDSMED30022728
Length (bp)1914
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynein regulatory complex subunit 3 (SMED30022728) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynein regulatory complex subunit 3 (SMED30022728) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022728

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30022728h1SMcG0017112 Contig44047newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30022728h1SMcG0017112 Contig44047uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30022728h1SMcG0017113 Contig44047newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30022728h1SMcG0017113 Contig44047uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30022728h1SMcG0017112 Contig44047newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30022728h1SMcG0017112 Contig44047uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30022728h1SMcG0017113 Contig44047newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30022728h1SMcG0017113 Contig44047uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Human
Match: DRC3 (dynein regulatory complex subunit 3 [Source:HGNC Symbol;Acc:HGNC:25384])

HSP 1 Score: 339.732 bits (870), Expect = 5.549e-109
Identity = 195/494 (39.47%), Postives = 306/494 (61.94%), Query Frame = 1
Query:  334 MKRLYNTLEPNIISNKLLTQVVYEQGPKDEAGKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQACYEKYLIRVEQYXXXXXXXXXXXXXXXXXXXSRKVHTLAFVELLDTDLLYNQMIHDDPEKEKIFSITGIEDLANSYLEKFMFISTELFHKGLNELEKRQRDGTLFYTCINAAKSDNNQRAIDLLEEFNIFKVEIMQEINKSAVISENDMKKLKEMTY-------DLWSNLMSLEVQLFDQLEETIRDYLRNLTEMIDGFLEIVHAYFAQMRELETSLNERISESAVIVYDKIIKGDMEEDRVTNFKKTDIFNDKDTLANCIATSHDHRVLKIDNWEDGIRIKTKSWLHETCDSI 1794
            M +  N++EP ++ + +L   V +QGP++EAG++AK EGI F  VLSL+LDF+NIL+I+NLW F++L KLQL NNIIEKIE L+ L HL WLDLSFN IE IEGL+ LV L DLSL+ NRI+ I+++D L +L V S G N + ++ N++YLR+FK L++L+LS NPI  +++Y  FI A+ P+LM+LDY+ +     +    K+   +++ K +E  ++ +  DE+   E  + H  AFVE L+   L++ M  +D E   +  + G+ +L  +Y +KF+ I   +F  GL + EKR+ +   F  C+  A  +N ++      +  I K E     + SA+  E ++  +++M         +L+  LM+LE+QL +QLEETI  + RN+ +M+  F+E V +  AQ R+LE   +E++ E ++   +KI++GD++ED   + +   +F DKDT+ N +  SHD  +LKIDN ED +  +  SW     D I
Sbjct:    1 MNQPCNSMEPRVMDDDMLKLAVGDQGPQEEAGQLAKQEGILFKDVLSLQLDFRNILRIDNLWQFENLRKLQLDNNIIEKIEGLENLAHLVWLDLSFNNIETIEGLDTLVNLEDLSLFNNRISKIDSLDALVKLQVLSLGNNRIDNMMNIIYLRRFKCLRTLSLSRNPISEAEDYKMFICAYLPDLMYLDYRRIDDHTKKLAEAKHQYSIDELKHQENLMQAQLEDEQAQREELEKHKTAFVEHLNGSFLFDSMYAEDSEGNNLSYLPGVGELLETYKDKFVIICVNIFEYGLKQQEKRKTELDTFSECVREAIQENQEQG-----KRKIAKFEEKHLSSLSAIREELELPNIEKMILECSADISELFDALMTLEMQLVEQLEETINMFERNIVDMVGLFIENVQSLMAQCRDLENHHHEKLLEISISTLEKIVEGDLDEDLPNDLRA--LFVDKDTIVNAVGASHDIHLLKIDNREDELVTRINSWCTRLIDRI 487          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Human
Match: DRC3 (dynein regulatory complex subunit 3 [Source:HGNC Symbol;Acc:HGNC:25384])

HSP 1 Score: 339.732 bits (870), Expect = 5.549e-109
Identity = 195/494 (39.47%), Postives = 306/494 (61.94%), Query Frame = 1
Query:  334 MKRLYNTLEPNIISNKLLTQVVYEQGPKDEAGKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQACYEKYLIRVEQYXXXXXXXXXXXXXXXXXXXSRKVHTLAFVELLDTDLLYNQMIHDDPEKEKIFSITGIEDLANSYLEKFMFISTELFHKGLNELEKRQRDGTLFYTCINAAKSDNNQRAIDLLEEFNIFKVEIMQEINKSAVISENDMKKLKEMTY-------DLWSNLMSLEVQLFDQLEETIRDYLRNLTEMIDGFLEIVHAYFAQMRELETSLNERISESAVIVYDKIIKGDMEEDRVTNFKKTDIFNDKDTLANCIATSHDHRVLKIDNWEDGIRIKTKSWLHETCDSI 1794
            M +  N++EP ++ + +L   V +QGP++EAG++AK EGI F  VLSL+LDF+NIL+I+NLW F++L KLQL NNIIEKIE L+ L HL WLDLSFN IE IEGL+ LV L DLSL+ NRI+ I+++D L +L V S G N + ++ N++YLR+FK L++L+LS NPI  +++Y  FI A+ P+LM+LDY+ +     +    K+   +++ K +E  ++ +  DE+   E  + H  AFVE L+   L++ M  +D E   +  + G+ +L  +Y +KF+ I   +F  GL + EKR+ +   F  C+  A  +N ++      +  I K E     + SA+  E ++  +++M         +L+  LM+LE+QL +QLEETI  + RN+ +M+  F+E V +  AQ R+LE   +E++ E ++   +KI++GD++ED   + +   +F DKDT+ N +  SHD  +LKIDN ED +  +  SW     D I
Sbjct:    1 MNQPCNSMEPRVMDDDMLKLAVGDQGPQEEAGQLAKQEGILFKDVLSLQLDFRNILRIDNLWQFENLRKLQLDNNIIEKIEGLENLAHLVWLDLSFNNIETIEGLDTLVNLEDLSLFNNRISKIDSLDALVKLQVLSLGNNRIDNMMNIIYLRRFKCLRTLSLSRNPISEAEDYKMFICAYLPDLMYLDYRRIDDHTKKLAEAKHQYSIDELKHQENLMQAQLEDEQAQREELEKHKTAFVEHLNGSFLFDSMYAEDSEGNNLSYLPGVGELLETYKDKFVIICVNIFEYGLKQQEKRKTELDTFSECVREAIQENQEQG-----KRKIAKFEEKHLSSLSAIREELELPNIEKMILECSADISELFDALMTLEMQLVEQLEETINMFERNIVDMVGLFIENVQSLMAQCRDLENHHHEKLLEISISTLEKIVEGDLDEDLPNDLRA--LFVDKDTIVNAVGASHDIHLLKIDNREDELVTRINSWCTRLIDRI 487          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Human
Match: DRC3 (dynein regulatory complex subunit 3 [Source:HGNC Symbol;Acc:HGNC:25384])

HSP 1 Score: 306.22 bits (783), Expect = 7.013e-97
Identity = 178/452 (39.38%), Postives = 282/452 (62.39%), Query Frame = 1
Query:  334 MKRLYNTLEPNIISNKLLTQVVYEQGPKDEAGKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQACYEKYLIRVEQYXXXXXXXXXXXXXXXXXXXSRKVHTLAFVELLDTDLLYNQMIHDDPEKEKIFSITGIEDLANSYLEKFMFISTELFHKGLNELEKRQRDGTLFYTCINAAKSDNNQRAIDLLEEFNIFKVEIMQEINKSAVISENDMKKLKEMTY-------DLWSNLMSLEVQLFDQLEETIRDYLRNLTEMIDGFLEIVHAYFAQMRELETSLNERISESAVIVYDKIIKGDMEED-----RVTNFKK 1653
            M +  N++EP ++ + +L   V +QGP++EAG++AK EGI F  VLSL+LDF+NIL+I+NLW F++L KLQL NNIIEKIE L+ L HL WLDLSFN IE IEGL+ LV L DLSL+ NRI+ I+++D L +L V S G N + ++ N++YLR+FK L++L+LS NPI  +++Y  FI A+ P+LM+LDY+ +     +    K+   +++ K +E  ++ +  DE+   E  + H  AFVE L+   L++ M  +D E   +  + G+ +L  +Y +KF+ I   +F  GL + EKR+ +   F  C+  A  +N ++      +  I K E     + SA+  E ++  +++M         +L+  LM+LE+QL +QLEETI  + RN+ +M+  F+E V +  AQ R+LE   +E++ E ++   +KI++GD++ED     R   F+K
Sbjct:    1 MNQPCNSMEPRVMDDDMLKLAVGDQGPQEEAGQLAKQEGILFKDVLSLQLDFRNILRIDNLWQFENLRKLQLDNNIIEKIEGLENLAHLVWLDLSFNNIETIEGLDTLVNLEDLSLFNNRISKIDSLDALVKLQVLSLGNNRIDNMMNIIYLRRFKCLRTLSLSRNPISEAEDYKMFICAYLPDLMYLDYRRIDDHTKKLAEAKHQYSIDELKHQENLMQAQLEDEQAQREELEKHKTAFVEHLNGSFLFDSMYAEDSEGNNLSYLPGVGELLETYKDKFVIICVNIFEYGLKQQEKRKTELDTFSECVREAIQENQEQG-----KRKIAKFEEKHLSSLSAIREELELPNIEKMILECSADISELFDALMTLEMQLVEQLEETINMFERNIVDMVGLFIENVQSLMAQCRDLENHHHEKLLEISISTLEKIVEGDLDEDLPNDLRAGRFQK 447          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Human
Match: DRC3 (dynein regulatory complex subunit 3 [Source:HGNC Symbol;Acc:HGNC:25384])

HSP 1 Score: 306.22 bits (783), Expect = 7.013e-97
Identity = 178/452 (39.38%), Postives = 282/452 (62.39%), Query Frame = 1
Query:  334 MKRLYNTLEPNIISNKLLTQVVYEQGPKDEAGKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQACYEKYLIRVEQYXXXXXXXXXXXXXXXXXXXSRKVHTLAFVELLDTDLLYNQMIHDDPEKEKIFSITGIEDLANSYLEKFMFISTELFHKGLNELEKRQRDGTLFYTCINAAKSDNNQRAIDLLEEFNIFKVEIMQEINKSAVISENDMKKLKEMTY-------DLWSNLMSLEVQLFDQLEETIRDYLRNLTEMIDGFLEIVHAYFAQMRELETSLNERISESAVIVYDKIIKGDMEED-----RVTNFKK 1653
            M +  N++EP ++ + +L   V +QGP++EAG++AK EGI F  VLSL+LDF+NIL+I+NLW F++L KLQL NNIIEKIE L+ L HL WLDLSFN IE IEGL+ LV L DLSL+ NRI+ I+++D L +L V S G N + ++ N++YLR+FK L++L+LS NPI  +++Y  FI A+ P+LM+LDY+ +     +    K+   +++ K +E  ++ +  DE+   E  + H  AFVE L+   L++ M  +D E   +  + G+ +L  +Y +KF+ I   +F  GL + EKR+ +   F  C+  A  +N ++      +  I K E     + SA+  E ++  +++M         +L+  LM+LE+QL +QLEETI  + RN+ +M+  F+E V +  AQ R+LE   +E++ E ++   +KI++GD++ED     R   F+K
Sbjct:    1 MNQPCNSMEPRVMDDDMLKLAVGDQGPQEEAGQLAKQEGILFKDVLSLQLDFRNILRIDNLWQFENLRKLQLDNNIIEKIEGLENLAHLVWLDLSFNNIETIEGLDTLVNLEDLSLFNNRISKIDSLDALVKLQVLSLGNNRIDNMMNIIYLRRFKCLRTLSLSRNPISEAEDYKMFICAYLPDLMYLDYRRIDDHTKKLAEAKHQYSIDELKHQENLMQAQLEDEQAQREELEKHKTAFVEHLNGSFLFDSMYAEDSEGNNLSYLPGVGELLETYKDKFVIICVNIFEYGLKQQEKRKTELDTFSECVREAIQENQEQG-----KRKIAKFEEKHLSSLSAIREELELPNIEKMILECSADISELFDALMTLEMQLVEQLEETINMFERNIVDMVGLFIENVQSLMAQCRDLENHHHEKLLEISISTLEKIVEGDLDEDLPNDLRAGRFQK 447          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Human
Match: DRC3 (dynein regulatory complex subunit 3 [Source:HGNC Symbol;Acc:HGNC:25384])

HSP 1 Score: 158.303 bits (399), Expect = 5.422e-45
Identity = 79/138 (57.25%), Postives = 105/138 (76.09%), Query Frame = 1
Query:  334 MKRLYNTLEPNIISNKLLTQVVYEQGPKDEAGKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSF 747
            M +  N++EP ++ + +L   V +QGP++EAG++AK EGI F  VLSL+LDF+NIL+I+NLW F++L KLQL NNIIEKIE L+ L HL WLDLSFN IE IEGL+ LV L DLSL+ NRI+ I+++D L +L V S 
Sbjct:    1 MNQPCNSMEPRVMDDDMLKLAVGDQGPQEEAGQLAKQEGILFKDVLSLQLDFRNILRIDNLWQFENLRKLQLDNNIIEKIEGLENLAHLVWLDLSFNNIETIEGLDTLVNLEDLSLFNNRISKIDSLDALVKLQVLSL 138          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Celegans
Match: C06A8.6 (pep chromosome:WBcel235:II:7772499:7773914:1 gene:WBGene00015516.1 transcript:C06A8.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C06A8.6)

HSP 1 Score: 80.1073 bits (196), Expect = 5.371e-16
Identity = 56/146 (38.36%), Postives = 79/146 (54.11%), Query Frame = 1
Query:  430 KIAKTEGI-AFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSF 864
            +I K E + +   + SL L F  I KI NL     L  L  V+N I KIE LD L  LE+L+L  N+I  IE L+N +KL  L L  N+I +IEN+D+LK+L V S   N +T ++N+  L   K++         +C  DE+   
Sbjct:   87 QITKVENLDSLVNLESLDLSFNRITKIENLEKLTKLKTLFFVHNKITKIEGLDTLTELEYLELGDNRIAKIENLDNNLKLDRLFLGANQIRLIENVDHLKKLTVLSLPANAITVVDNISGLHNLKEIYLAQNGIKYVCGIDEHLPL 232          

HSP 2 Score: 76.2554 bits (186), Expect = 1.173e-14
Identity = 54/114 (47.37%), Postives = 63/114 (55.26%), Query Frame = 1
Query:  496 ILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPI 837
            I KI NL    +LT L+  +N I K+ENLD LV+LE LDLSFN+I  IE LE L KL  L    N+I  IE +D L EL     G N +  IEN   L    KL  L L  N I
Sbjct:   66 IKKIENLDCLTTLTHLEFYDNQITKVENLDSLVNLESLDLSFNRITKIENLEKLTKLKTLFFVHNKITKIEGLDTLTELEYLELGDNRIAKIEN---LDNNLKLDRLFLGANQI 176          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Celegans
Match: sds-22 (Protein phosphatase 1 regulatory subunit SDS22 homolog [Source:UniProtKB/Swiss-Prot;Acc:P45969])

HSP 1 Score: 72.4034 bits (176), Expect = 1.722e-13
Identity = 69/220 (31.36%), Postives = 113/220 (51.36%), Query Frame = 1
Query:  253 TP*INISKMSINPVRKYRGDDVLIDIRMKR-LYNTLEPNIISNKLLTQV-VYEQGPKDEAGKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFP--NLMFLD 900
            +P I+++    + +    G   + ++RM+  L  ++ P I S   LT + +YE    ++  +I+  E +    ++SL L +  I +IN L     L  L LV+N IEKIENL+ L  L+ L+L  N+I+ IE + +LV L +L +  N+I  +E ++ L++L+V S   N +  IENV  L   K+L            SD+    I    P  NL+ LD
Sbjct:   38 SPEIDLTHTRADHIPDLTGFPKIEELRMRNNLLVSISPTISSLVTLTSLDLYE----NQLTEISHLESLV--NLVSLDLSYNRIRQINGLDKLTKLETLYLVSNKIEKIENLEALTQLKLLELGDNRIKKIENIGHLVNLDELFIGKNKIRQLEGVETLQKLSVLSLPGNRIVKIENVEQLNNLKEL----------YLSDQGLQDIHGVEPLTNLLLLD 241          

HSP 2 Score: 50.447 bits (119), Expect = 2.354e-6
Identity = 66/230 (28.70%), Postives = 106/230 (46.09%), Query Frame = 1
Query:  277 MSINPVRKYRGDDVLIDIRMKRLYNTLEPNIISNKL--------LTQV-VYEQGPKDEAGKIAKTEGIAFSTVLSLRLDFKN-ILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQAC 936
            +S N +R+  G D L   +++ LY      ++SNK+        LTQ+ + E G      +I K E I     L      KN I ++  +   + L+ L L  N I KIEN+++L +L+ L LS   ++ I G+E L  L  L +  N I     ++ L+ LN F    N + S   +  L K K LQ++ L  NP      YF+    +   +M +    VT+++   C
Sbjct:  110 LSYNRIRQINGLDKLT--KLETLY------LVSNKIEKIENLEALTQLKLLELG----DNRIKKIENIGHLVNLDELFIGKNKIRQLEGVETLQKLSVLSLPGNRIVKIENVEQLNNLKELYLSDQGLQDIHGVEPLTNLLLLDVANNEIKTFSGVERLESLNDFWANDNKVESFSEIEQLSKLKGLQTVYLERNPF-----YFNDTNQYRRKVM-MTLTQVTQIDATTC 321          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Celegans
Match: K10D2.8 (pep chromosome:WBcel235:III:5188726:5190175:1 gene:WBGene00189952.1 transcript:K10D2.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K10D2.8)

HSP 1 Score: 70.4774 bits (171), Expect = 6.507e-13
Identity = 48/126 (38.10%), Postives = 74/126 (58.73%), Query Frame = 1
Query:  430 KIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKL 807
            KI + E       LSLR +   + KI++     SLT+L L +N IEK+ENL+ LV+L +LD+S+N+I  IEGL  L+ L +L L  N+I  IE ++    +    FG N +  +EN+ +L   ++L
Sbjct:   41 KIWQFENTPGIRDLSLRWNL--LKKIDHFQCLTSLTRLNLNDNQIEKLENLETLVNLVFLDVSYNRITKIEGLSELINLEELHLVHNKIITIEGLETNTAMKYLEFGDNRIQKMENLSHLVNLERL 164          

HSP 2 Score: 64.3142 bits (155), Expect = 8.391e-11
Identity = 48/137 (35.04%), Postives = 74/137 (54.01%), Query Frame = 1
Query:  430 KIAKTEGIA-FSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPI 837
            +I K EG++    +  L L    I+ I  L    ++  L+  +N I+K+ENL  LV+LE L L  N+I  IEGL+ + +L +LSL  N + +IE +D L  L   S  +N +  I+    L     L+SL+L+ N I
Sbjct:  104 RITKIEGLSELINLEELHLVHNKIITIEGLETNTAMKYLEFGDNRIQKMENLSHLVNLERLFLGANQIRKIEGLDGMAQLKELSLPGNALQIIEGLDTLSGLKSISLAQNGIRKIDG---LSGLTNLKSLDLNDNII 237          

HSP 3 Score: 60.4622 bits (145), Expect = 1.212e-9
Identity = 51/159 (32.08%), Postives = 76/159 (47.80%), Query Frame = 1
Query:  430 KIAKTEGIAFSTVLS-LRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSD-EYFSFIFAFFPNLMFLD 900
            +I K E ++    L  L L    I KI  L     L +L L  N ++ IE LD L  L+ + L+ N I  I+GL  L  L  L L  N I  +EN++  K ++     KN L   ++V  L+K + L  L +  NP+  SD  Y + +    P++  LD
Sbjct:  148 RIQKMENLSHLVNLERLFLGANQIRKIEGLDGMAQLKELSLPGNALQIIEGLDTLSGLKSISLAQNGIRKIDGLSGLTNLKSLDLNDNIIEKLENVEQFKGISSLMIRKNKLNCWQDVRQLKKLENLTVLTMEMNPLYSSDYTYRNRVKEILPDVKLLD 306          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Celegans
Match: mog-2 (Probable U2 small nuclear ribonucleoprotein A' [Source:UniProtKB/Swiss-Prot;Acc:Q9BLB6])

HSP 1 Score: 49.2914 bits (116), Expect = 3.596e-6
Identity = 31/116 (26.72%), Postives = 52/116 (44.83%), Query Frame = 1
Query:  595 HLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIEN--MDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQAC 936
              + +DL+ N I  ++      +L  L L+ NRIN I       L  L   +   N +  + ++  L + KKL+ +   GNPI H D Y  ++    P +  +D+  V   E +A 
Sbjct:   43 QFDVIDLTDNDIRKLDNFPTFSRLNTLYLHNNRINYIAPDIATKLPNLKTLALTNNNICELGDIEPLAECKKLEYVTFIGNPITHKDNYRMYMIYKLPTVRVIDFNRVRLTEREAA 158          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Celegans
Match: mog-2 (Probable U2 small nuclear ribonucleoprotein A' [Source:UniProtKB/Swiss-Prot;Acc:Q9BLB6])

HSP 1 Score: 49.2914 bits (116), Expect = 3.596e-6
Identity = 31/116 (26.72%), Postives = 52/116 (44.83%), Query Frame = 1
Query:  595 HLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIEN--MDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQAC 936
              + +DL+ N I  ++      +L  L L+ NRIN I       L  L   +   N +  + ++  L + KKL+ +   GNPI H D Y  ++    P +  +D+  V   E +A 
Sbjct:   43 QFDVIDLTDNDIRKLDNFPTFSRLNTLYLHNNRINYIAPDIATKLPNLKTLALTNNNICELGDIEPLAECKKLEYVTFIGNPITHKDNYRMYMIYKLPTVRVIDFNRVRLTEREAA 158          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Fly
Match: Ppr-Y (gene:FBgn0046697 transcript:FBtr0346721)

HSP 1 Score: 173.326 bits (438), Expect = 1.971e-46
Identity = 139/516 (26.94%), Postives = 253/516 (49.03%), Query Frame = 1
Query:  343 LYNTLEPNIISNKLLTQVVYEQGPKDEAGKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEY--FSFIFAFFPNLMFLDYKLV-TKMEHQACYEKYLIRVEQYXXXXXXXXXXXXXXXXXXXSRKVHTLAFVELLDTDLLYNQMIHDDPEKEKIFSITGI--EDLANSYLEKFMFISTELFHKGLNELEKRQRDGTLFYTCINAAKSDNNQRAIDLLEEFNIFKVEIMQEINKSAV-ISENDMK---------------------KLKEMTYDLWSNLMSLEVQLFDQLEETIRDYLRNLTEMIDGFLEIVHAYFAQMRELETSLNERISESAVIVYDKIIKGDMEEDRVTNFKKTDI-----FNDKDTLANCIATSHDHRVLKIDNWEDGIRIKTKSWLHETCDSI 1794
            +Y  +EP II+  L+     +   + E  ++ + E +    +L++RL+F NIL+I++LW   +LTKL L  N IE IEN++ L +L+ L+LSFN IE IE L+ LV L  LSL+ N+I  IEN+D L  L + S G NL+ ++E +   R    L+ +NL GNPI     +    +I A  P L + +Y  + +++  +AC   Y   + + ++K+E+  +     +      K    +FVE LD   L++ +   D E  ++  + G   ++LA+ Y +    ++ E++  GL    +R  +   F+  +   + +      + +E F  F+  I +E     + + +N M                      + ++   DLW  LM+ E+ L + ++E+  ++ R + E++  F+E   A+F Q+RE+    +E ++E    +  + I        + +F    I      +D+D + N IA   D+  L++D  ED I  +TK ++    D +
Sbjct:   20 IYPDIEPGIINRSLIESSYLKHVHRGEGRRLHQLEPVVLEQILTMRLEFNNILRIDHLWILPNLTKLCLNCNKIETIENIEMLTNLKDLNLSFNFIEKIENLDTLVNLEVLSLFSNKIEAIENIDMLTMLVIISLGNNLIDTVEGIERFRFMNNLKIINLEGNPIAKRTNFCLLKYISAILPKLNYYEYTFIKSELRAEAC-NLYYREIREIEDKQEKEIQARKFLEREQSEAKRLASSFVEHLDGHQLFDSLWRGD-EDGRVLMLVGTQAQELADEYDKDIFELTQEIYKLGLERFTERDEEIRDFFNNLFDGQEELQILGQNEIEWFLQFREIIFEEARIRLLKLEQNSMHGEDEDTPENLKLSDALDKLNIQFEDAINDLWQALMAQELYLHESIQESTINFHRKIAELMSKFVEQSQAFFVQLREITLHFSENMTE----ILTRFISTKFA---LQDFDDVPIELRVCVDDRDAILNLIAGMKDYHTLRLDEREDTIATRTKEFVDNMIDQL 526          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Fly
Match: TbCMF46 (gene:FBgn0032163 transcript:FBtr0079898)

HSP 1 Score: 168.703 bits (426), Expect = 9.062e-45
Identity = 125/445 (28.09%), Postives = 226/445 (50.79%), Query Frame = 1
Query:  289 PVRKYRGDDVLIDIRMKRLY------NTLEPNIISNKLLTQVVYEQGPKDEAGKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEY--FSFIFAFFPNLMFLDYKLVTKMEHQACYEKYLIRVEQYXXXXXXXXXXXXXXXXXXXSRKVHTLAFVELLDTDLLYNQMIHDDPEKEKIFSITG--IEDLANSYLEKFMFISTELFHKGLNELEKRQRDGTLFYTCINAAKSDNNQRAIDLLEEFNIFKVEIMQEIN---KSAVISENDMKKLK-----------EMTYDLWSNLMSLEVQLFDQLEETIRDYLRNLTEMIDGFLEIVHAYFAQMREL 1551
            PV    G+D + +   + L       N  EP II  +++     E+G K EA ++ + E + +  + ++RL+FKNIL+I++LW   +LTKL L  N IE IE+L+ L  L+ L+LSFN I  IE LE LVKL  LSL+ NRI  IEN+  L+ L + S G NL+ ++E +  LR    L+ LNL GNPI    ++    ++ A  P L + +Y  +     +   +++   + + ++K+E   +    E   +        +FVE LD   LY+ +  DD E  +I  + G   ++L   Y +    ++ +++  GL    +R  +   F   ++  + +   +    +E+F  +K  I  E+    +     ++D+++L+           +   +LW +LM+ E+ L + +E++   + R +++++  F+E     F Q+R+L
Sbjct:    4 PVSSQPGEDAVEETEEEPLRGFLEEINCPEPGIIDRQMIETAYLEEGKKGEARRLHQLEPVVYDRITTMRLEFKNILRIDHLWMMPNLTKLCLNCNKIEVIEHLEMLTALKDLNLSFNYITRIENLEKLVKLEKLSLFSNRIRKIENIHTLQNLVILSIGNNLIDTVEGIERLRFVSSLKVLNLEGNPIAKQPDFPLSLYVIAILPQLNYYEYVFIKTETREEAQKRFYRELREIEDKQEREIQGLETEAREMAEADRLASSFVEHLDGMQLYDSLWRDD-EDGRILMLVGAPAQELCEEYSKDVYELTQQIYRLGLERFGERDEEIRDFNANLHEGQEELQAQGQRQIEDFLEYKERIFDEMRLKWRELDQRDDDLEQLQAQLDTLTANFEDSLNELWESLMAQELHLHEAVEDSTLKFNRKISDLMSNFVEQAQVIFLQLRDL 447          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Fly
Match: sds22 (gene:FBgn0028992 transcript:FBtr0083436)

HSP 1 Score: 81.6481 bits (200), Expect = 1.591e-16
Identity = 50/104 (48.08%), Postives = 65/104 (62.50%), Query Frame = 1
Query:  496 ILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKL 807
            I KI NL + K+L +L+L +N I KIENLD L HLE LD+SFN++  IE L+ LVKL  +    NRI  IEN+D L  L +   G N L  IEN+  L   ++L
Sbjct:   73 IKKIENLSSLKTLIELELYDNQITKIENLDDLPHLEVLDISFNRLTKIENLDKLVKLEKVYFVSNRITQIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQL 176          

HSP 2 Score: 63.929 bits (154), Expect = 1.154e-10
Identity = 49/121 (40.50%), Postives = 66/121 (54.55%), Query Frame = 1
Query:  475 LRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPI 837
            L + F  + KI NL     L K+  V+N I +IENLD L +L  L+L  NK++ IE +E LV L  L L  N+I  IEN+D L  L + S   N +  IEN   L K   L+ L +S N +
Sbjct:  110 LDISFNRLTKIENLDKLVKLEKVYFVSNRITQIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENLDTLVNLEILSLQANRIVKIEN---LEKLANLRELYVSENGV 227          

HSP 3 Score: 62.7734 bits (151), Expect = 3.005e-10
Identity = 48/112 (42.86%), Postives = 68/112 (60.71%), Query Frame = 1
Query:  496 ILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGN 831
            I +I NL    +LT L+L +N ++KIEN++ LV+L  L L  NKI  IE L+ LV L  LSL  NRI  IEN++ L  L      +N + +IEN   L +  KL++L+L+ N
Sbjct:  139 ITQIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENLDTLVNLEILSLQANRIVKIENLEKLANLRELYVSENGVETIEN---LSENTKLETLDLAKN 247          

HSP 4 Score: 55.4546 bits (132), Expect = 6.618e-8
Identity = 37/82 (45.12%), Postives = 50/82 (60.98%), Query Frame = 1
Query:  562 IEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKL 807
            IEK+EN + L  +E L L +N I+ IE L +L  L +L LY N+I  IEN+D+L  L V     N LT IEN+  L K +K+
Sbjct:   51 IEKLENFEPLTRIERLFLRWNLIKKIENLSSLKTLIELELYDNQITKIENLDDLPHLEVLDISFNRLTKIENLDKLVKLEKV 132          

HSP 5 Score: 55.0694 bits (131), Expect = 8.348e-8
Identity = 52/137 (37.96%), Postives = 69/137 (50.36%), Query Frame = 1
Query:  433 IAKTEGIA-FSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPIC 840
            I K E ++   T++ L L    I KI NL     L  L +  N + KIENLD+LV LE +    N+I  IE L+ L  LT L L  N++  IEN++ L  L     GKN +  IEN   L     L+ L+L  N I 
Sbjct:   73 IKKIENLSSLKTLIELELYDNQITKIENLDDLPHLEVLDISFNRLTKIENLDKLVKLEKVYFVSNRITQIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIEN---LDTLVNLEILSLQANRIV 206          

HSP 6 Score: 53.5286 bits (127), Expect = 2.478e-7
Identity = 48/138 (34.78%), Postives = 68/138 (49.28%), Query Frame = 1
Query:  496 ILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKL 909
            I KI NL    +L  L L  N I KIENL++L +L  L +S N +E IE L    KL  L L  NR+  I N++ L+ L       N +   +++  L+  K LQ++ L  NP+     Y S +    P L  +D  L
Sbjct:  183 IAKIENLDTLVNLEILSLQANRIVKIENLEKLANLRELYVSENGVETIENLSENTKLETLDLAKNRLKGIANLEKLELLEELWLNHNGVDDWKDIELLKVNKALQTIYLEYNPLAKDVRYRSKLRDILPQLQKIDATL 320          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Fly
Match: Cep97 (gene:FBgn0031575 transcript:FBtr0077504)

HSP 1 Score: 55.0694 bits (131), Expect = 1.901e-7
Identity = 42/127 (33.07%), Postives = 67/127 (52.76%), Query Frame = 1
Query:  463 TVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICH 843
            ++  L LD   + KI+N+ ++  +  L L  N + ++  + RL  L  L+LSFN I  IEGL+  + L  L+L  N I  IE+++    L   +   N + SI ++ YLR  K+L    L GN + H
Sbjct:   31 SIRQLILDENELQKIDNIDSYLKIETLSLARNQLLRMYGVCRLHCLRELNLSFNGILSIEGLKECIHLRVLNLEGNNIKTIEHLNTNVNLECLNLADNSIGSISDMSYLRNLKELY---LHGNRLTH 154          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Zebrafish
Match: drc3 (dynein regulatory complex subunit 3 [Source:ZFIN;Acc:ZDB-GENE-061103-349])

HSP 1 Score: 351.673 bits (901), Expect = 6.712e-114
Identity = 193/475 (40.63%), Postives = 291/475 (61.26%), Query Frame = 1
Query:  358 EPNIISNKLLTQVVYEQGPKDEAGKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQACYEKYLIRVEQYXXXXXXXXXXXXXXXXXXXSRKVHTLAFVELLDTDLLYNQMIHDDPEKEKIFSITGIEDLANSYLEKFMFISTELFHKGLNELEKRQRDGTLFYTCINAAKSDNNQRAIDLLEEFNIF---KVEIMQEINKSAVISENDMKKLKEMTYDLWSNLMSLEVQLFDQLEETIRDYLRNLTEMIDGFLEIVHAYFAQMRELETSLNERISESAVIVYDKIIKGDMEEDRVTNFKKTDIFNDKDTLANCIATSHDHRVLKIDNWEDGIRIKTKSWL 1773
            EP +I  ++L + V EQ  +        TEGI    VL LRLD++NILKI +LW+F SLTKLQL NN IE+IE L+ L +L WLDLSFNKIEVIEGL+ LVKL DLSL+ NRI+VIEN+D L+ L V S G N +  +ENV+YLR+F+ L++LNL+GNPIC  D Y +F+ A+ P L++LDY+L+ +   +    KY   +E+ ++ E + ++    +K   E  ++H  AFVE L+   L++ M  DDP+ EK+  + G++ L   +  +   +  ++F  GL++  +R  +   F++C   A ++N Q+A  +  +F  F   K   M +I + AV  E  +   ++        LMSLE+QL DQLE+  +++ RN++EM+ GF+E V   FAQ R+LE   +E+  E  +   +K++K ++EE+   +     +  DKDTL N    SHD  ++KIDN ED +R  T SW+
Sbjct:    7 EPGVIDEQMLQRAVEEQQTR-------YTEGIQLEEVLELRLDYRNILKIYHLWSFSSLTKLQLDNNAIERIEGLENLTNLTWLDLSFNKIEVIEGLQTLVKLQDLSLFNNRISVIENLDTLQRLQVLSLGNNSIAQLENVIYLRRFQSLRTLNLAGNPICEEDRYKTFVSAYLPELVYLDYRLLDEQTRETANAKYQYAIEEMRQNEMQEQQAMEAQKISNEELQLHKDAFVENLNGAQLFHSMFADDPDAEKLALLPGVDALLEEFRSRMEAVCMQMFEAGLSQYSRRSAEVESFFSCSREAVAENKQKAAQIAADFESFRRLKTAEMHQI-QDAVQLETHLSVCRQQLTHTSEQLMSLELQLVDQLEDVYKEFERNISEMLGGFVEFVQGMFAQCRDLENQHHEQQLEIGLETLEKVLKNELEEEIPDDLAM--LLVDKDTLINAANASHDTHLMKIDNREDVLRTHTDSWI 471          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Zebrafish
Match: lrguk (leucine-rich repeats and guanylate kinase domain containing [Source:ZFIN;Acc:ZDB-GENE-050419-232])

HSP 1 Score: 78.1814 bits (191), Expect = 1.711e-14
Identity = 57/165 (34.55%), Postives = 81/165 (49.09%), Query Frame = 1
Query:  454 AFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQACYEKY 948
            A+S++  L LD  +   I  L   K L+ L L +N I +I  LD L  L  L L+ N I  IE L+ L  L  L L CNRI  +  + NL+ L   +   NL+T I+   +L     L+ +NL  NP+   D+Y   +     +L+ LD + VT  E  A   KY
Sbjct:  114 AYSSLTKLILDHNSFSVIRGLEKCKRLSHLSLAHNNISRIRGLDHLP-LRELCLAGNMINKIENLQTLHNLQVLDLSCNRIQSLTGLQNLRFLGTVNLESNLITEIKEAAHLHDLILLREINLLKNPVQDHDDYRIAVIFLLQHLILLDKQTVTAEEKVAAVNKY 277          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Zebrafish
Match: ppp1r7 (protein phosphatase 1, regulatory (inhibitor) subunit 7 [Source:NCBI gene;Acc:560323])

HSP 1 Score: 74.3294 bits (181), Expect = 7.963e-14
Identity = 49/139 (35.25%), Postives = 76/139 (54.68%), Query Frame = 1
Query:  496 ILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLV 912
            I ++ NL    +LT L + +N I K+E L  LV+L  L LS N IEV+EGLEN  KL+ L +  NRI  IEN+ +L +L  F    N + +  ++  L+  K L+++ L  NP+    +Y   I    P++  +D   +
Sbjct:  205 ITQLQNLDGLHNLTVLSIQSNRITKLEGLQNLVNLRELYLSHNGIEVMEGLENNKKLSTLDIAANRIKKIENISHLTDLKEFWMNDNQIENWADLDELKNAKGLETVYLERNPLQKDPQYRRKIMLALPSVRQIDATFI 343          

HSP 2 Score: 73.559 bits (179), Expect = 1.210e-13
Identity = 49/117 (41.88%), Postives = 68/117 (58.12%), Query Frame = 1
Query:  427 GKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIEN 777
            GKI   E +  +  +SLR +   I +I NL +  SL +L L +N I K+ENL  L  LE LD+SFN +  IEGL++L K+  L L  N+I  I N+D+L  L +   G N +  IEN
Sbjct:   74 GKIEGLEVLLKAKTISLRQNL--IKRIENLESLVSLRELDLYDNQIRKLENLQALTELEQLDVSFNLLRKIEGLDSLTKVKKLFLLHNKIASIANLDHLTSLQMLELGSNRIRVIEN 188          

HSP 3 Score: 53.1434 bits (126), Expect = 4.629e-7
Identity = 50/137 (36.50%), Postives = 73/137 (53.28%), Query Frame = 1
Query:  430 KIAKTEGI-AFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPI 837
            +I K E + A + +  L + F  + KI  L +   + KL L++N I  I NLD L  L+ L+L  N+I VIE L++L  L  L L  N+I  ++N+D L  L V S   N +T +E    L+    L+ L LS N I
Sbjct:  116 QIRKLENLQALTELEQLDVSFNLLRKIEGLDSLTKVKKLFLLHNKIASIANLDHLTSLQMLELGSNRIRVIENLDSLSSLESLFLGTNKITQLQNLDGLHNLTVLSIQSNRITKLEG---LQNLVNLRELYLSHNGI 249          

HSP 4 Score: 51.6026 bits (122), Expect = 1.857e-6
Identity = 38/87 (43.68%), Postives = 50/87 (57.47%), Query Frame = 1
Query:  547 LVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKL 807
            LV+  I KIE L+ L+  + + L  N I+ IE LE+LV L +L LY N+I  +EN+  L EL       NLL  IE +  L K KKL
Sbjct:   68 LVHCRIGKIEGLEVLLKAKTISLRQNLIKRIENLESLVSLRELDLYDNQIRKLENLQALTELEQLDVSFNLLRKIEGLDSLTKVKKL 154          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Zebrafish
Match: ppp1r7 (protein phosphatase 1, regulatory (inhibitor) subunit 7 [Source:NCBI gene;Acc:560323])

HSP 1 Score: 70.8626 bits (172), Expect = 1.227e-13
Identity = 46/110 (41.82%), Postives = 64/110 (58.18%), Query Frame = 1
Query:  427 GKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKN 756
            GKI   E +  +  +SLR +   I +I NL +  SL +L L +N I K+ENL  L  LE LD+SFN +  IEGL++L K+  L L  N+I  I N+D+L  L +   G N
Sbjct:   77 GKIEGLEVLLKAKTISLRQNL--IKRIENLESLVSLRELDLYDNQIRKLENLQALTELEQLDVSFNLLRKIEGLDSLTKVKKLFLLHNKIASIANLDHLTSLQMLELGSN 184          

HSP 2 Score: 52.373 bits (124), Expect = 2.950e-7
Identity = 38/87 (43.68%), Postives = 50/87 (57.47%), Query Frame = 1
Query:  547 LVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKL 807
            LV+  I KIE L+ L+  + + L  N I+ IE LE+LV L +L LY N+I  +EN+  L EL       NLL  IE +  L K KKL
Sbjct:   71 LVHCRIGKIEGLEVLLKAKTISLRQNLIKRIENLESLVSLRELDLYDNQIRKLENLQALTELEQLDVSFNLLRKIEGLDSLTKVKKL 157          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Zebrafish
Match: lrrc6 (leucine rich repeat containing 6 [Source:NCBI gene;Acc:432388])

HSP 1 Score: 64.3142 bits (155), Expect = 1.800e-10
Identity = 54/164 (32.93%), Postives = 78/164 (47.56%), Query Frame = 1
Query:  475 LRLDFKNILKINNLWAF-KSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEH-QACYEKYLIRV 960
            L L  ++I +I ++  + + L  L L NN+I KIEN+ RL  LE+L+L+ N IEVIE LE    L  L L  N +  + +++ LK         NL               L+ L L GNP      Y  ++ A  P L  LD K +++ E  QA  E   +R 
Sbjct:   26 LSLHQQDIQRIEHIHKWCRDLKILYLQNNLIPKIENVGRLKKLEYLNLALNNIEVIENLEGCESLQKLDLTVNFVGRLSSVETLKH--------NL--------------HLKELYLVGNPCAEYHGYRQYVVATVPQLQSLDGKEISRAERIQALQELDAVRT 167          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Xenopus
Match: drc3 (dynein regulatory complex subunit 3 [Source:NCBI gene;Acc:100170587])

HSP 1 Score: 373.244 bits (957), Expect = 7.137e-122
Identity = 214/487 (43.94%), Postives = 309/487 (63.45%), Query Frame = 1
Query:  334 MKRLYNTLEPNIISNKLLTQVVYEQGPKDEAGKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQACYEKYLIRVEQYXXXXXXXXXXXXXXXXXXXSRKVHTLAFVELLDTDLLYNQMIHDDPEKEKIFSITGIEDLANSY-LEKFMFISTELFHKGLNELEKRQRDGTLFYTCINAAKSDNNQRAIDLLEEFNIFKVEIMQEINKSAVISENDMKKLKEMTY-----DLWSNLMSLEVQLFDQLEETIRDYLRNLTEMIDGFLEIVHAYF--AQMRELETSLNERISESAVIVYDKIIKGDMEEDRVTNFKKTDIFNDKDTLANCIATSHDHRVLKIDNWEDGIRIKTKSW 1770
            M  LY+T+EPN+I + +L   V EQGPK+EAG+IAK EGI F  V SLRLDFKNILKI+NLW F SLTKLQL NNIIEKI  LD LVHL WLDLSFN IEVIEGL+ L KL DLSLY NRI+V+ENMD L  L V S G N LTS+EN++YLRKFK+L++L+L+GNP+   D+Y  FI A  PNL +LD++L+ +   +    KY   ++     E + ++K+ +E+       +H  A+VE L+   L+  M  DD +  K+  + G+ +L +SY L + + I   +F  G+ + EKR+ +   F  C+  A  +N ++    ++E      EI+ E+++S   S  D   LK   Y      L  +LM+LE+QL DQ EE I++Y RN+++M+  FLE V   +    +R+LE   +E++ E ++ + +K++KG+M+++   + +   IF DKDT+ N ++ SHD  +LKIDN ED +  K  +W
Sbjct:    1 MSSLYDTMEPNVIDDDMLRNAVEEQGPKEEAGRIAKLEGIDFKHVSSLRLDFKNILKIDNLWQFHSLTKLQLDNNIIEKISGLDTLVHLVWLDLSFNNIEVIEGLKALTKLEDLSLYNNRISVVENMDTLSNLQVLSLGNNNLTSLENLIYLRKFKQLRTLSLAGNPLSEDDQYKLFIAAHLPNLAYLDFRLLNENIREMATMKYQYSIDDITHNENQEKRKQEEEEQKQRELDLHKAAYVENLNGPFLFESMYADDADGTKLSGLPGVAELMDSYPLLRCIEICQNIFEYGMKQHEKREAEAFEFNECMQEAIRENQEQGAKKIQELTEKNSEILNELSQS---SNQDFLDLKISQYIDDINKLLDSLMTLELQLVDQTEEIIKEYERNVSDMVSAFLETVQGLYPWGSVRDLENHHHEKLLEISINLLEKVLKGEMDDEITDDIRM--IFVDKDTVINAVSASHDIHLLKIDNREDELVTKMNTW 482          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Xenopus
Match: drc3 (dynein regulatory complex subunit 3 [Source:NCBI gene;Acc:100170587])

HSP 1 Score: 349.362 bits (895), Expect = 1.190e-112
Identity = 210/489 (42.94%), Postives = 302/489 (61.76%), Query Frame = 1
Query:  334 MKRLYNTLEPNIISNKLLTQVVYEQGPKDEAGKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQACYEKYLIRVEQYXXXXXXXXXXXXXXXXXXXSRKVHTLAFVELLDTDLLYNQMIHDDPEKEKIFSITGIEDLANSY-LEKFMFISTELFHKGLNELEKRQRDGTLFYTCINAAKSDNNQRAIDLLEEFNIFKVEIMQEINKSAVISENDMKKLKEMTY-----DLWSNLMSLEVQLFDQLEETIRDYLRNLTEMIDGFL---EIVHAY-FAQMRELETSLNERISESAVIVYDKIIKGDMEEDRVTNFKKTDIFNDKDTLANCIATSHDHRVLKIDNWEDGIRIKTKSW 1770
            M  LY+T+EPN+I + +L   V EQGPK+EAG+IAK EGI F  V SLRLDFKNILKI+NLW F SLTKLQL NNIIEKI  LD LVHL WLDLSFN IEVIEGL+ L KL DLSLY NRI+V+ENMD L  L V S G N LTS+EN++YLRKFK+L++L+L+GNP+   D+Y  FI A  PNL +LD++L+ +   +    KY   ++     E + ++K+ +E+       +H  A+VE L+   L+  M  DD +  K+  + G+ +L +SY L + + I   +F  G+ + EKR+ +   F  C+  A  +N ++    ++E      EI+ E+++S   S  D   LK   Y      L  +LM+LE+QL DQ E       R+ +  + G L    +   Y  AQ+R+LE   +E++ E ++ + +K++KG+M+++   + +   IF DKDT+ N ++ SHD  +LKIDN ED +  K  +W
Sbjct:    1 MSSLYDTMEPNVIDDDMLRNAVEEQGPKEEAGRIAKLEGIDFKHVSSLRLDFKNILKIDNLWQFHSLTKLQLDNNIIEKISGLDTLVHLVWLDLSFNNIEVIEGLKALTKLEDLSLYNNRISVVENMDTLSNLQVLSLGNNNLTSLENLIYLRKFKQLRTLSLAGNPLSEDDQYKLFIAAHLPNLAYLDFRLLNENIREMATMKYQYSIDDITHNENQEKRKQEEEEQKQRELDLHKAAYVENLNGPFLFESMYADDADGTKLSGLPGVAELMDSYPLLRCIEICQNIFEYGMKQHEKREAEAFEFNECMQEAIRENQEQGAKKIQELTEKNSEILNELSQS---SNQDFLDLKISQYIDDINKLLDSLMTLELQLVDQTE-----VHRHSSSPLTGLLSHESLTSMYTMAQVRDLENHHHEKLLEISINLLEKVLKGEMDDEITDDIRM--IFVDKDTVINAVSASHDIHLLKIDNREDELVTKMNTW 479          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Xenopus
Match: CNTRL (centriolin [Source:NCBI gene;Acc:100270771])

HSP 1 Score: 82.4185 bits (202), Expect = 1.480e-15
Identity = 60/178 (33.71%), Postives = 94/178 (52.81%), Query Frame = 1
Query:  430 KIAKTEGIAFSTVLSLRLDFKNILK---INNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIE--NMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQACYEKY 948
            K  K E +A+ T L+L L  +   K   I NL   + L  L L +N+IEKIE L++ + L  L+L++NKI  IE  E++  L  L+L  N I  I       LK L   +  +N ++S+++V  L+  K L +L+LS NP+ +   Y  +      +L  LD + VT  E Q  +E++
Sbjct:   59 KQTKQENLAYVTSLNLCLAKEGGKKFKFIENLEKCERLEVLNLSHNLIEKIEKLEKQIRLRELNLAYNKISKIEHFEHMQNLKKLNLAGNEIEHIPVWVGKKLKSLTALNLKENRISSLQDVSRLKPLKDLTTLSLSDNPVSNLPHYRLYTVFHLRSLNSLDAQPVTNQERQEAHERF 236          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Xenopus
Match: CNTRL (centriolin [Source:NCBI gene;Acc:100270771])

HSP 1 Score: 82.4185 bits (202), Expect = 1.509e-15
Identity = 60/178 (33.71%), Postives = 94/178 (52.81%), Query Frame = 1
Query:  430 KIAKTEGIAFSTVLSLRLDFKNILK---INNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIE--NMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQACYEKY 948
            K  K E +A+ T L+L L  +   K   I NL   + L  L L +N+IEKIE L++ + L  L+L++NKI  IE  E++  L  L+L  N I  I       LK L   +  +N ++S+++V  L+  K L +L+LS NP+ +   Y  +      +L  LD + VT  E Q  +E++
Sbjct:   48 KQTKQENLAYVTSLNLCLAKEGGKKFKFIENLEKCERLEVLNLSHNLIEKIEKLEKQIRLRELNLAYNKISKIEHFEHMQNLKKLNLAGNEIEHIPVWVGKKLKSLTALNLKENRISSLQDVSRLKPLKDLTTLSLSDNPVSNLPHYRLYTVFHLRSLNSLDAQPVTNQERQEAHERF 225          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Xenopus
Match: CNTRL (centriolin [Source:NCBI gene;Acc:100270771])

HSP 1 Score: 82.4185 bits (202), Expect = 1.686e-15
Identity = 60/178 (33.71%), Postives = 94/178 (52.81%), Query Frame = 1
Query:  430 KIAKTEGIAFSTVLSLRLDFKNILK---INNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIE--NMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQACYEKY 948
            K  K E +A+ T L+L L  +   K   I NL   + L  L L +N+IEKIE L++ + L  L+L++NKI  IE  E++  L  L+L  N I  I       LK L   +  +N ++S+++V  L+  K L +L+LS NP+ +   Y  +      +L  LD + VT  E Q  +E++
Sbjct:   21 KQTKQENLAYVTSLNLCLAKEGGKKFKFIENLEKCERLEVLNLSHNLIEKIEKLEKQIRLRELNLAYNKISKIEHFEHMQNLKKLNLAGNEIEHIPVWVGKKLKSLTALNLKENRISSLQDVSRLKPLKDLTTLSLSDNPVSNLPHYRLYTVFHLRSLNSLDAQPVTNQERQEAHERF 198          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Mouse
Match: Drc3 (dynein regulatory complex subunit 3 [Source:MGI Symbol;Acc:MGI:1921915])

HSP 1 Score: 350.517 bits (898), Expect = 2.433e-113
Identity = 201/494 (40.69%), Postives = 313/494 (63.36%), Query Frame = 1
Query:  334 MKRLYNTLEPNIISNKLLTQVVYEQGPKDEAGKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQACYEKYLIRVEQYXXXXXXXXXXXXXXXXXXXSRKVHTLAFVELLDTDLLYNQMIHDDPEKEKIFSITGIEDLANSYLEKFMFISTELFHKGLNELEKRQRDGTLFYTCINAAKSDNNQRAIDLLEEFNIFKVEIMQEINKSAVISENDM----KKLKEMT---YDLWSNLMSLEVQLFDQLEETIRDYLRNLTEMIDGFLEIVHAYFAQMRELETSLNERISESAVIVYDKIIKGDMEEDRVTNFKKTDIFNDKDTLANCIATSHDHRVLKIDNWEDGIRIKTKSWLHETCDSI 1794
            M R Y+++EP ++ + +L   V EQGP++EAG++AK EGI F  VLSL+LDF+NIL+I+NLW F++L KLQL NNIIE+IE L  L+HL WLDLSFN IE IEGL+ LV L DLSL  NRI+ ++++D L +L V S G N ++++ N++YLR+F  L++L+L+GNP+  ++EY  FI+A+  +L++LD++ V +   +    K+   +++ K +E +++ K  +E+   E  + H +AFVE L+   L++ M  +D E  K+  + G+ +L  +Y +KF+ I   +F  GLN+ EKR+ +   F  CI  A  +N  +      +  + K E    +N +A+  E D+    KKL E T    +L++ LM LE+QL +QLEETI  + RN+T+++  F+E V +  AQ R+LE   +E++ E A+   +KI+KG+M+ED   + +   +F DKDT+ N +  SHD  +LKIDN ED +     SW     D I
Sbjct:    1 MSRPYDSMEPKVMDDDMLKAAVGEQGPQEEAGQLAKQEGILFKDVLSLQLDFQNILRIDNLWQFENLKKLQLNNNIIERIEGLTNLIHLVWLDLSFNNIEAIEGLDTLVNLEDLSLSNNRISKVDSLDALVKLQVLSLGNNQISNMMNIIYLRRFPCLRTLSLAGNPVSEAEEYKMFIYAYLSDLVYLDFRRVDEQMREMAKMKHQYSIDELKHREAQLQMKLEEEQAKQEKLEEHKMAFVEHLNGPFLFDSMYSEDVEGNKLSYLPGVRELLEAYKDKFVIICLNIFEYGLNQQEKRKVELDTFNECIQEAILENQDQG-----KLKVAKFEEKHLLNLNAIREETDLSNIEKKLTECTESIGELFNTLMILEMQLVEQLEETINIFERNITDLVGLFIENVQSLIAQCRDLENHHHEKLLEIAINTLEKILKGEMDEDLPDDVRA--LFVDKDTIVNAVGASHDIHLLKIDNREDELVTGINSWCAHLVDKI 487          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Mouse
Match: Drc3 (dynein regulatory complex subunit 3 [Source:MGI Symbol;Acc:MGI:1921915])

HSP 1 Score: 350.517 bits (898), Expect = 2.651e-113
Identity = 201/494 (40.69%), Postives = 313/494 (63.36%), Query Frame = 1
Query:  334 MKRLYNTLEPNIISNKLLTQVVYEQGPKDEAGKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQACYEKYLIRVEQYXXXXXXXXXXXXXXXXXXXSRKVHTLAFVELLDTDLLYNQMIHDDPEKEKIFSITGIEDLANSYLEKFMFISTELFHKGLNELEKRQRDGTLFYTCINAAKSDNNQRAIDLLEEFNIFKVEIMQEINKSAVISENDM----KKLKEMT---YDLWSNLMSLEVQLFDQLEETIRDYLRNLTEMIDGFLEIVHAYFAQMRELETSLNERISESAVIVYDKIIKGDMEEDRVTNFKKTDIFNDKDTLANCIATSHDHRVLKIDNWEDGIRIKTKSWLHETCDSI 1794
            M R Y+++EP ++ + +L   V EQGP++EAG++AK EGI F  VLSL+LDF+NIL+I+NLW F++L KLQL NNIIE+IE L  L+HL WLDLSFN IE IEGL+ LV L DLSL  NRI+ ++++D L +L V S G N ++++ N++YLR+F  L++L+L+GNP+  ++EY  FI+A+  +L++LD++ V +   +    K+   +++ K +E +++ K  +E+   E  + H +AFVE L+   L++ M  +D E  K+  + G+ +L  +Y +KF+ I   +F  GLN+ EKR+ +   F  CI  A  +N  +      +  + K E    +N +A+  E D+    KKL E T    +L++ LM LE+QL +QLEETI  + RN+T+++  F+E V +  AQ R+LE   +E++ E A+   +KI+KG+M+ED   + +   +F DKDT+ N +  SHD  +LKIDN ED +     SW     D I
Sbjct:    1 MSRPYDSMEPKVMDDDMLKAAVGEQGPQEEAGQLAKQEGILFKDVLSLQLDFQNILRIDNLWQFENLKKLQLNNNIIERIEGLTNLIHLVWLDLSFNNIEAIEGLDTLVNLEDLSLSNNRISKVDSLDALVKLQVLSLGNNQISNMMNIIYLRRFPCLRTLSLAGNPVSEAEEYKMFIYAYLSDLVYLDFRRVDEQMREMAKMKHQYSIDELKHREAQLQMKLEEEQAKQEKLEEHKMAFVEHLNGPFLFDSMYSEDVEGNKLSYLPGVRELLETYKDKFVIICLNIFEYGLNQQEKRKVELDTFNECIQEAILENQDQG-----KLKVAKFEEKHLLNLNAIREETDLSNIEKKLTECTESIGELFNTLMILEMQLVEQLEETINIFERNITDLVGLFIENVQSLIAQCRDLENHHHEKLLEIAINTLEKILKGEMDEDLPDDVRA--LFVDKDTIVNAVGASHDIHLLKIDNREDELVTGINSWCAHLVDKI 487          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Mouse
Match: Drc3 (dynein regulatory complex subunit 3 [Source:MGI Symbol;Acc:MGI:1921915])

HSP 1 Score: 234.187 bits (596), Expect = 7.065e-72
Identity = 121/276 (43.84%), Postives = 191/276 (69.20%), Query Frame = 1
Query:  334 MKRLYNTLEPNIISNKLLTQVVYEQGPKDEAGKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQACYEKYLIRVEQYXXXXXXXXXXXXXXXXXXXSRKVHTLAFVELLDTDLLYNQMIHDDPEKEKIFSITGIEDLANSY 1161
            M R Y+++EP ++ + +L   V EQGP++EAG++AK EGI F  VLSL+LDF+NIL+I+NLW F++L KLQL NNIIE+IE L  L+HL WLDLSFN IE IEGL+ LV L DLSL  NRI+ ++++D L +L V S G N ++++ N++YLR+F  L++L+L+GNP+  ++EY  FI+A+  +L++LD++ V +   +    K+   +++ K +E +++ K  +E+   E  + H +AFVE L+   L++ M  +D E  K+  + G+ +L  +Y
Sbjct:    1 MSRPYDSMEPKVMDDDMLKAAVGEQGPQEEAGQLAKQEGILFKDVLSLQLDFQNILRIDNLWQFENLKKLQLNNNIIERIEGLTNLIHLVWLDLSFNNIEAIEGLDTLVNLEDLSLSNNRISKVDSLDALVKLQVLSLGNNQISNMMNIIYLRRFPCLRTLSLAGNPVSEAEEYKMFIYAYLSDLVYLDFRRVDEQMREMAKMKHQYSIDELKHREAQLQMKLEEEQAKQEKLEEHKMAFVEHLNGPFLFDSMYSEDVEGNKLSYLPGVRELLEAY 276          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Mouse
Match: Drc3 (dynein regulatory complex subunit 3 [Source:MGI Symbol;Acc:MGI:1921915])

HSP 1 Score: 217.238 bits (552), Expect = 2.232e-66
Identity = 103/208 (49.52%), Postives = 152/208 (73.08%), Query Frame = 1
Query:  334 MKRLYNTLEPNIISNKLLTQVVYEQGPKDEAGKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQACYEKYLIR 957
            M R Y+++EP ++ + +L   V EQGP++EAG++AK EGI F  VLSL+LDF+NIL+I+NLW F++L KLQL NNIIE+IE L  L+HL WLDLSFN IE IEGL+ LV L DLSL  NRI+ ++++D L +L V S G N ++++ N++YLR+F  L++L+L+GNP+  ++EY  FI+A+  +L++LD++ V +    A   +   R
Sbjct:    1 MSRPYDSMEPKVMDDDMLKAAVGEQGPQEEAGQLAKQEGILFKDVLSLQLDFQNILRIDNLWQFENLKKLQLNNNIIERIEGLTNLIHLVWLDLSFNNIEAIEGLDTLVNLEDLSLSNNRISKVDSLDALVKLQVLSLGNNQISNMMNIIYLRRFPCLRTLSLAGNPVSEAEEYKMFIYAYLSDLVYLDFRRVDEQMASAASTQQPTR 208          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Mouse
Match: Ppp1r7 (protein phosphatase 1, regulatory subunit 7 [Source:MGI Symbol;Acc:MGI:1913635])

HSP 1 Score: 82.8037 bits (203), Expect = 1.514e-16
Identity = 62/164 (37.80%), Postives = 88/164 (53.66%), Query Frame = 1
Query:  424 AGKIAKTEGI-AFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLV 912
            + +I   E I   + + SL L    I K+ NL A  +LT L + +N + KIE L  LV+L  L LS N IEVIEGLEN  KLT L +  NRI  IEN+ +L EL  F    NLL S  ++  L+  + L+++ L  NP+    +Y   +    P++  +D   V
Sbjct:  196 SNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSVQSNRLAKIEGLQSLVNLRELYLSNNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDATYV 359          

HSP 2 Score: 79.7221 bits (195), Expect = 1.494e-15
Identity = 60/139 (43.17%), Postives = 83/139 (59.71%), Query Frame = 1
Query:  430 KIAKTEGI-AFSTVLSLRLDFKNILK-INNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPIC 840
            +I K EG+     V SL L  +N++K I NL   +SL +L L +N I+KIENL+ L  LE LD+SFN +  IEG++ L +L  L L  N+IN IEN+ NL +L +   G N + +IEN+  L     L+SL L  N I 
Sbjct:   88 RIGKIEGLEVLKKVKSLCL-RQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEVLDISFNMLRNIEGIDKLTQLKKLFLVNNKINKIENISNLHQLQMLELGSNRIRAIENIDTL---TNLESLFLGKNKIT 222          
BLAST of Dynein regulatory complex subunit 3 vs. UniProt/SwissProt
Match: sp|Q9D5E4|DRC3_MOUSE (Dynein regulatory complex subunit 3 OS=Mus musculus OX=10090 GN=Drc3 PE=1 SV=1)

HSP 1 Score: 350.517 bits (898), Expect = 1.702e-112
Identity = 201/494 (40.69%), Postives = 313/494 (63.36%), Query Frame = 1
Query:  334 MKRLYNTLEPNIISNKLLTQVVYEQGPKDEAGKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQACYEKYLIRVEQYXXXXXXXXXXXXXXXXXXXSRKVHTLAFVELLDTDLLYNQMIHDDPEKEKIFSITGIEDLANSYLEKFMFISTELFHKGLNELEKRQRDGTLFYTCINAAKSDNNQRAIDLLEEFNIFKVEIMQEINKSAVISENDM----KKLKEMT---YDLWSNLMSLEVQLFDQLEETIRDYLRNLTEMIDGFLEIVHAYFAQMRELETSLNERISESAVIVYDKIIKGDMEEDRVTNFKKTDIFNDKDTLANCIATSHDHRVLKIDNWEDGIRIKTKSWLHETCDSI 1794
            M R Y+++EP ++ + +L   V EQGP++EAG++AK EGI F  VLSL+LDF+NIL+I+NLW F++L KLQL NNIIE+IE L  L+HL WLDLSFN IE IEGL+ LV L DLSL  NRI+ ++++D L +L V S G N ++++ N++YLR+F  L++L+L+GNP+  ++EY  FI+A+  +L++LD++ V +   +    K+   +++ K +E +++ K  +E+   E  + H +AFVE L+   L++ M  +D E  K+  + G+ +L  +Y +KF+ I   +F  GLN+ EKR+ +   F  CI  A  +N  +      +  + K E    +N +A+  E D+    KKL E T    +L++ LM LE+QL +QLEETI  + RN+T+++  F+E V +  AQ R+LE   +E++ E A+   +KI+KG+M+ED   + +   +F DKDT+ N +  SHD  +LKIDN ED +     SW     D I
Sbjct:    1 MSRPYDSMEPKVMDDDMLKAAVGEQGPQEEAGQLAKQEGILFKDVLSLQLDFQNILRIDNLWQFENLKKLQLNNNIIERIEGLTNLIHLVWLDLSFNNIEAIEGLDTLVNLEDLSLSNNRISKVDSLDALVKLQVLSLGNNQISNMMNIIYLRRFPCLRTLSLAGNPVSEAEEYKMFIYAYLSDLVYLDFRRVDEQMREMAKMKHQYSIDELKHREAQLQMKLEEEQAKQEKLEEHKMAFVEHLNGPFLFDSMYSEDVEGNKLSYLPGVRELLEAYKDKFVIICLNIFEYGLNQQEKRKVELDTFNECIQEAILENQDQG-----KLKVAKFEEKHLLNLNAIREETDLSNIEKKLTECTESIGELFNTLMILEMQLVEQLEETINIFERNITDLVGLFIENVQSLIAQCRDLENHHHEKLLEIAINTLEKILKGEMDEDLPDDVRA--LFVDKDTIVNAVGASHDIHLLKIDNREDELVTGINSWCAHLVDKI 487          
BLAST of Dynein regulatory complex subunit 3 vs. UniProt/SwissProt
Match: sp|Q5XI54|DRC3_RAT (Dynein regulatory complex subunit 3 OS=Rattus norvegicus OX=10116 GN=Drc3 PE=2 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 1.405e-109
Identity = 200/494 (40.49%), Postives = 310/494 (62.75%), Query Frame = 1
Query:  334 MKRLYNTLEPNIISNKLLTQVVYEQGPKDEAGKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQACYEKYLIRVEQYXXXXXXXXXXXXXXXXXXXSRKVHTLAFVELLDTDLLYNQMIHDDPEKEKIFSITGIEDLANSYLEKFMFISTELFHKGLNELEKRQRDGTLFYTCINAAKSDNNQRAIDLLEEFNIFKVEIMQEINKSAVISENDM----KKLKEMT---YDLWSNLMSLEVQLFDQLEETIRDYLRNLTEMIDGFLEIVHAYFAQMRELETSLNERISESAVIVYDKIIKGDMEEDRVTNFKKTDIFNDKDTLANCIATSHDHRVLKIDNWEDGIRIKTKSWLHETCDSI 1794
            M R Y+++EP ++ + +L   V EQGP++EAG++AK EGI F  VL+L+LDF+NIL+I+NLW F++L KLQL NNIIE+IE L+ L HL WLDLSFN IE IEGL+ LV L DLSL  NRI+ I+++D L  L V S G N + ++ N++YLR+F  L++L+LSGNP+  ++EY  FI+A+ P+L++LD++ V +   +    K+   +++ K +E  ++ +  +E+   +    H +AFVE L+   L++ M  DD E  K+  + G+ +L  +Y +KF+ I   +F  GL++ EKR+ +   F  CI  A  +N  +      +  I K E    +N +A+  E+D+    +KL E      +L++ LM LE+QL +QLEETI  + RN+T+++  F+E V +  AQ R+LE   +E++ E A+   +KI+KG+M+ED   + +   +F DKDT+ N +  SHD  +LKIDN ED +     SW     D I
Sbjct:    1 MSRPYDSMEPKVMDDDMLKVAVGEQGPQEEAGQLAKQEGILFKDVLALQLDFQNILRIDNLWQFENLRKLQLNNNIIERIEGLENLTHLVWLDLSFNNIEAIEGLDTLVNLEDLSLSHNRISKIDSLDPLVNLQVLSLGNNQINNMMNIIYLRRFPCLRTLSLSGNPVSEAEEYKVFIYAYLPDLVYLDFRRVDEQAREVAKMKHQYSIDELKHREALMQIRLEEEQAKQQKLAEHKMAFVEHLNGPFLFDSMYSDDVEGNKLSYLPGVGELLEAYKDKFVIICLNIFEYGLSQQEKRKIELDTFNECIQEAIQENQDQG-----KLKIAKFEEKHLLNLNAIREESDLFTMEQKLTECNESITELFNTLMILEMQLVEQLEETINVFERNITDLVGLFIENVQSLIAQCRDLENHHHEKLLEIAINTLEKILKGEMDEDLPDDVRA--LFVDKDTIVNAVGASHDIHLLKIDNREDELVTGVNSWCAHLVDKI 487          
BLAST of Dynein regulatory complex subunit 3 vs. UniProt/SwissProt
Match: sp|Q9H069|DRC3_HUMAN (Dynein regulatory complex subunit 3 OS=Homo sapiens OX=9606 GN=DRC3 PE=1 SV=2)

HSP 1 Score: 339.732 bits (870), Expect = 2.665e-108
Identity = 195/494 (39.47%), Postives = 306/494 (61.94%), Query Frame = 1
Query:  334 MKRLYNTLEPNIISNKLLTQVVYEQGPKDEAGKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQACYEKYLIRVEQYXXXXXXXXXXXXXXXXXXXSRKVHTLAFVELLDTDLLYNQMIHDDPEKEKIFSITGIEDLANSYLEKFMFISTELFHKGLNELEKRQRDGTLFYTCINAAKSDNNQRAIDLLEEFNIFKVEIMQEINKSAVISENDMKKLKEMTY-------DLWSNLMSLEVQLFDQLEETIRDYLRNLTEMIDGFLEIVHAYFAQMRELETSLNERISESAVIVYDKIIKGDMEEDRVTNFKKTDIFNDKDTLANCIATSHDHRVLKIDNWEDGIRIKTKSWLHETCDSI 1794
            M +  N++EP ++ + +L   V +QGP++EAG++AK EGI F  VLSL+LDF+NIL+I+NLW F++L KLQL NNIIEKIE L+ L HL WLDLSFN IE IEGL+ LV L DLSL+ NRI+ I+++D L +L V S G N + ++ N++YLR+FK L++L+LS NPI  +++Y  FI A+ P+LM+LDY+ +     +    K+   +++ K +E  ++ +  DE+   E  + H  AFVE L+   L++ M  +D E   +  + G+ +L  +Y +KF+ I   +F  GL + EKR+ +   F  C+  A  +N ++      +  I K E     + SA+  E ++  +++M         +L+  LM+LE+QL +QLEETI  + RN+ +M+  F+E V +  AQ R+LE   +E++ E ++   +KI++GD++ED   + +   +F DKDT+ N +  SHD  +LKIDN ED +  +  SW     D I
Sbjct:    1 MNQPCNSMEPRVMDDDMLKLAVGDQGPQEEAGQLAKQEGILFKDVLSLQLDFRNILRIDNLWQFENLRKLQLDNNIIEKIEGLENLAHLVWLDLSFNNIETIEGLDTLVNLEDLSLFNNRISKIDSLDALVKLQVLSLGNNRIDNMMNIIYLRRFKCLRTLSLSRNPISEAEDYKMFICAYLPDLMYLDYRRIDDHTKKLAEAKHQYSIDELKHQENLMQAQLEDEQAQREELEKHKTAFVEHLNGSFLFDSMYAEDSEGNNLSYLPGVGELLETYKDKFVIICVNIFEYGLKQQEKRKTELDTFSECVREAIQENQEQG-----KRKIAKFEEKHLSSLSAIREELELPNIEKMILECSADISELFDALMTLEMQLVEQLEETINMFERNIVDMVGLFIENVQSLMAQCRDLENHHHEKLLEISISTLEKIVEGDLDEDLPNDLRA--LFVDKDTIVNAVGASHDIHLLKIDNREDELVTRINSWCTRLIDRI 487          
BLAST of Dynein regulatory complex subunit 3 vs. UniProt/SwissProt
Match: sp|Q4R6X9|DRC3_MACFA (Dynein regulatory complex subunit 3 OS=Macaca fascicularis OX=9541 GN=DRC3 PE=2 SV=1)

HSP 1 Score: 333.954 bits (855), Expect = 4.518e-106
Identity = 197/497 (39.64%), Postives = 311/497 (62.58%), Query Frame = 1
Query:  334 MKRLYNTLEPNIISNKLLTQVVYEQGPKDEAGKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQACYEKYLIRVEQYXXXXXXXXXXXXXXXXXXXSRKVHTLAFVELLDTDLLYNQMIHDDPEKEKIFSITGIEDLANSYLEKFMFISTELFHKGLNELEKRQRDGTLFYTCINAAKSDN---NQRAIDLLEEFNIFKVEIMQEINKSAVISENDMKKLKEM-------TYDLWSNLMSLEVQLFDQLEETIRDYLRNLTEMIDGFLEIVHAYFAQMRELETSLNERISESAVIVYDKIIKGDMEEDRVTNFKKTDIFNDKDTLANCIATSHDHRVLKIDNWEDGIRIKTKSWLHETCDSI 1794
            M RL +++EP ++ + +L   V EQGP++EAG++AK EGI F  VLSL+LDF+NIL+I+NLW F++L KLQL NNIIEKI  L+ L HL WLDLSFN IE IEGL+ LV L DLSL+ NRI+ I+++D L +L V S G N + ++ N++YLR+F+ L++L+LSGNPI  +++Y  FI A+ P+L++LD++ +     +    K+   +++ K +E  ++ +  DE+   E  + H  AFVE L+   L++ M  +D E  K+  + G+ +L  +Y +KF+ I   +F  GL + EKR+ +   F  C++ A  +N    +R I   EE ++  +        SA+  E+++  +++M         +L++ LM LE+QL +QLEETI  + RN+ +M+  F+E V +  AQ R+LE   +E++ E ++   +KI+KGD++ED   + +   +F DKDT+ N +  SHD  +LKIDN ED +  +  SW     D I
Sbjct:    1 MNRLCDSMEPKVMDDDMLKLAVGEQGPQEEAGQLAKQEGILFKDVLSLQLDFRNILRIDNLWQFENLRKLQLDNNIIEKIGGLENLTHLVWLDLSFNNIETIEGLDTLVNLEDLSLFNNRISKIDSLDALVKLQVLSLGNNQIDNMMNIVYLRRFQCLRTLSLSGNPISEAEDYKMFICAYLPDLVYLDFRRIDDHTKELAEAKHQYSIDELKHRENLMQVRLQDERARQEELEKHKTAFVEHLNGSFLFDSMYAEDSEGNKLSYLPGVSELLEAYKDKFVIICMNIFEYGLKQQEKRKIELDTFSECVHEAIQENQEQGKRKIAQFEEKHLSSL--------SAIREESELPNIEKMILECSADVSELFNELMMLEMQLVEQLEETINMFERNIVDMVGLFIENVQSLMAQCRDLENHHHEKLLEISISTLEKIVKGDLDEDLPDDLRA--LFVDKDTIVNAVGASHDIHLLKIDNREDELVTRINSWCTRLVDKI 487          
BLAST of Dynein regulatory complex subunit 3 vs. UniProt/SwissProt
Match: sp|A8IVX2|DRC3_CHLRE (Dynein regulatory complex subunit 3 OS=Chlamydomonas reinhardtii OX=3055 GN=DRC3 PE=1 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 6.457e-63
Identity = 150/470 (31.91%), Postives = 260/470 (55.32%), Query Frame = 1
Query:  334 MKRLYNTLEPNIISNKLLTQVVYEQGPKDEAGKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQACYEKYLIRVEQYXXXXXXXXXXXXXXXXXXXSRKVHTLAFVELLDTDLLYNQMIHDDPEKEKIFSITGIEDLANSYLEKFMFISTELFHKGLNELEKRQRDGTLFYTCINAAKSDNNQRAIDLLEEFNIFKVEIMQEINKSAVISENDMKKLKEMTYDLWSNLMSLEVQLFDQLEETIRDYLRNLTEMIDGFLEIVHAYFAQMRELETSLNERISESAVIVYDKIIKGDMEEDRVTNFKKTDIFNDKDTLANCIATSHDHRVLKIDNWED 1743
            ++RL   +EPN+I+  L  + +  QG + +     K   + F  V  L   FKN+  ++NL    +LTKLQL NN I KIENL  L +L WLDLSFNKI  I GLE L KL DLSL+ N+I  IEN+D L  LNV S G N L+ ++NV+YLR+FK+L+ +NL+GNPIC S +Y S++ +   +L++LDY+ V   + QA  E++   + + +E+EE+  ++E          K+   A +E ++T  L + M+ +D E  ++  +  + D  N   +KF   + E     L +  K++ +   +   + +   + +  A  L+ E+   K    + +    +++E+ +  LK     L   LM++E++  + L+  ++++ R  +E+ +      + YF Q+R+L+ S   +++  A+ V++K  + + + + +    +T +  DKD+L N +  SHD  + KID+ ED
Sbjct:    4 LERLIAEVEPNVITESLTRECIQIQGGEPDTAA-NKKRTMPFRDVECLAFSFKNLACVDNLRGLDTLTKLQLDNNQITKIENLAHLTNLTWLDLSFNKITAISGLETLTKLVDLSLFNNQIAKIENLDTLVNLNVLSLGNNQLSQLDNVMYLRQFKQLRLVNLAGNPICKSHDYRSYVLSHIKDLIYLDYRRVNPADVQAAREQHQDEMIELQEREEQQSQEEKLNAERESHEKLMKQANLEGVET--LIDDMVKEDLEWPRLSQVPSLLDPWNEIRDKFNTYTDEFKVAILEQHNKKKAEYEEWLGVVRSYLDEKDAEARKLIVEYEKAKKRTARVVVDQPLMAESQIDNLKVKLMALKDQLMAIEMEAVEVLDGLVQEFDRAYSELAEINKGQYNGYFTQVRDLQNSFFNQLTSVAMTVFEKYNQENSDIESLPEEART-LLQDKDSLMNALQASHDAHMGKIDSLED 469          
BLAST of Dynein regulatory complex subunit 3 vs. TrEMBL
Match: A0A210QM46 (Leucine-rich repeat-containing protein 48 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT05716 PE=4 SV=1)

HSP 1 Score: 410.609 bits (1054), Expect = 3.174e-133
Identity = 235/526 (44.68%), Postives = 343/526 (65.21%), Query Frame = 1
Query:  334 MKRLYNTLEPNIISNKLLTQVVYEQGPKDEAGKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQACYEKYLIRVEQYXXXXXXXXXXXXXXXXXXXSRKVHTLAFVELLDTDLLYNQMIHDDPEKEKIFSITGIEDLANSYLEKFMFISTELFHKGLNELEKRQRDGTLFYTCINAAKSDNNQRAIDLLEEFNIFKVEIMQEINKSAVISENDMKKLKEMTYD-------LWSNLMSLEVQLFDQLEETIRDYLRNLTEMIDGFLEIVHAYFAQMRELETSLNERISESAVIVYDKIIKGDMEEDRVTNFKKTDIFNDKDTLANCIATSHDHRVLKIDNWEDGIRIKTKSWLHETCDSIKQTXXXXXXXXXXXXXXXXXDQVRSEIENYEI 1890
            M RLY+T+EP ++   +L + V EQGPKDEAGKIAK+EGI F  VL+LRLDF N+LKI+NLW F +LTKLQL NNIIEKIE LD LV+L WLDLSFN IEVIEGL  L KL DL+LY NRI  +ENMD L  L+VFS G N+LT + N+LYLR+FK++++LNL+GNP C    Y  ++ AF   + FLDY+LV K   +   EK++I+ ++    E++ E K+ +E    +  ++H  A+VEL+D   L+  M  +D E +K+  + GIEDL  ++ +KF+ I  ++F  GL E EKR  +   F+ C+  A+ +N    +  +  F + K  IMQE+ + +     D K L+ +  D       LW  LM LE+Q+ DQLE+ I+D+ R++ +++  F E + A+ AQ R+LET  +E++ E A+I  +K++K +++++   + +   +F DKDT+ N +++SHD  +LKIDN ED +  +   WL  T D I + EE  RNR R++EINN ID +R EI+N E+
Sbjct:    1 MSRLYDTVEPAVVDEDMLKRAVEEQGPKDEAGKIAKSEGIDFGDVLALRLDFLNVLKIDNLWEFTALTKLQLDNNIIEKIEGLDCLVNLVWLDLSFNNIEVIEGLNALTKLEDLTLYNNRIATLENMDTLLNLHVFSIGNNMLTELSNLLYLRRFKEMKTLNLAGNPFCKQSGYKQYVIAFLSGIDFLDYRLVDKQSREDAMEKHMIQRDEMLHNEKQAELKQEEEIKNKKQLELHKAAYVELMDGPHLFEMMYIEDSEGQKLSEMPGIEDLLQTFKDKFVAICHQMFEYGLKEHEKRDSEVKQFWECVEDAEQENKNLGMKAINNFMVVKKRIMQELGQIS-----DQKVLESVVADYNNQVSELWDKLMGLELQIVDQLEDVIKDFERSMQDLVASFQENIQAFLAQCRDLETFHHEKMMEIAIITLEKVLKNELDDEINEDLRM--LFVDKDTIMNAVSSSHDVHLLKIDNKEDDMVTRINHWLKTTIDKIHEDEEVARNRMRVTEINNLIDHLRDEIDNLEV 519          
BLAST of Dynein regulatory complex subunit 3 vs. TrEMBL
Match: W4XT49 (Uncharacterized protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 410.223 bits (1053), Expect = 4.207e-133
Identity = 237/527 (44.97%), Postives = 339/527 (64.33%), Query Frame = 1
Query:  334 MKRLYNTLEPNIISNKLLTQVVYEQGPKDEAGKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQACYEKYLIRVEQYXXXXXXXXXXXXXXXXXXXSRKVHTLAFVELLDTDLLYNQMIHDDPEKEKIFSITGIEDLANSYLEKFMFISTELFHKGLNELEKRQRDGTLFYTCINAAKSDNNQRAIDLLEEFNIFKVEIMQEINKSAVIS-----ENDMKKLKEMTYDLWSNLMSLEVQLFDQLEETIRDYLRNLTEMIDGFLEIVHAYFAQMRELETSLNERISESAVIVYDKIIKGDMEEDRVTNFKKTDIFNDKDTLANCIATSHDHRVLKIDNWEDGIRIKTKSWLHETCDSIKQTXXXXXXXXXXXXXXXXXDQVRSEIENYEIPGV 1899
            M RLY+T+EP+++   +L + V EQGPK+EAG+IAK EGI F+ V  LRLDFKNILK++NLW F +L KLQL NNIIEKIE LD L HL WLDLSFN IEV+EGLE L KL DL+LY NRI  +ENMD+L +L+VFS G N L+S+EN++YLR+FK L++LNL+GNP C    Y  F+ A  P L +LD++L+      A  E+Y   +E+    E   E K L+ +      +   LA+VE LD   L++ M  +DPE  K+ ++ G+++L   Y EK + I  ++F  GL E EKR ++   FY+C+  AK +N + A+ ++ EFN +K +I+ E+    V+S     E+ + + KE    LW  LM  E+QL DQLE+TI+D+ RNL +M+  F+E V    +Q+R+LE   +ER+ E A I  +K +K +++++   + +   +  DKDT+ N ++ SHD  +LKIDN ED I  +   WL    + I   EE  RNR+R+ EINNFID ++ +IEN E+P  
Sbjct:    1 MSRLYDTVEPSVVDEIMLQKAVEEQGPKEEAGRIAKAEGIDFTDVTQLRLDFKNILKVDNLWQFNNLVKLQLDNNIIEKIEGLDTLAHLVWLDLSFNNIEVVEGLEKLEKLEDLTLYNNRIATLENMDSLTQLHVFSVGNNNLSSLENLIYLRRFKGLRTLNLAGNPFCDDANYKQFVVAHIPTLAYLDFRLIDGNTKTAAMEQYKYAIEELMADETAAENKRLEIELKESKFEKQKLAYVENLDGPHLFDNMFAEDPEASKLGALPGVDELLAVYKEKMVAICQQVFAFGLQEHEKRCKEVDEFYSCVQEAKDENKEMAVVIINEFNKYKKKIVAEL---TVMSDPNGIESQITEYKEEVDKLWDRLMGFELQLVDQLEDTIKDFERNLADMVSSFVEFVQGLISQVRDLENIHHERLLEIAHITLEKYVKNELDDELPEDLRM--LLVDKDTITNAVSASHDVHLLKIDNREDDIIQRANGWLGALMERIHNEEEVARNRDRVKEINNFIDHLKDDIENMELPNA 522          
BLAST of Dynein regulatory complex subunit 3 vs. TrEMBL
Match: A0A3S1A630 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_008543 PE=4 SV=1)

HSP 1 Score: 409.838 bits (1052), Expect = 7.265e-133
Identity = 221/493 (44.83%), Postives = 321/493 (65.11%), Query Frame = 1
Query:  334 MKRLYNTLEPNIISNKLLTQVVYEQGPKDEAGKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDE--YFSFIFAFFPNLMFLDYKLVTKMEHQACYEKYLIRVEQYXXXXXXXXXXXXXXXXXXXSRKVHTLAFVELLDTDLLYNQMIHDDPEKEKIFSITGIEDLANSYLEKFMFISTELFHKGLNELEKRQRDGTLFYTCINAAKSDNNQRAIDLLEEFNIFK----VEIMQEINKSAVISENDMKKLKEMTYDLWSNLMSLEVQLFDQLEETIRDYLRNLTEMIDGFLEIVHAYFAQMRELETSLNERISESAVIVYDKIIKGDMEEDRVTNFKKTDIFNDKDTLANCIATSHDHRVLKIDNWEDGIRIKTKSWLHETCDSI 1794
            M RLY+T+EP+++  ++L + V EQGPKDEAGKIAK EGI FS VLSLRLDFKNILKI+NLW F +LTKLQL NNIIEKIE LD LV+L WLDLSFN IEVIEGL NL KL DL+LY NRI+ IEN++ LK+L+VFS G N +   +++LYLR+F  L++LN++ NP+   D+  +  ++ AF PN+ FLDY+L+ +    A YEK+  +VE+  +K+ +      + +  +   ++H  A+VE L+T  L+  M  DDPE  K+  I G++++   + EK M +  +LF  GL E +KR+ +  +F+ C+N AK +N +  ++ + +F   K    +E++Q  +   V  +N +++  +    LW  LM LE+QL DQLEE I+D+ RN+ +++  FLE V AY  Q R+LE   NER+ ESA    +K  K +++ED     K   +  DKDT+ N + +SHD  +LKIDN ED I  +  +WL    ++I
Sbjct:    1 MSRLYDTVEPSVVDEEMLQKAVEEQGPKDEAGKIAKREGINFSDVLSLRLDFKNILKIDNLWEFTALTKLQLDNNIIEKIEGLDSLVNLVWLDLSFNNIEVIEGLSNLKKLNDLTLYNNRISKIENIEALKQLHVFSIGNNEIKEYKDILYLRQFPMLKTLNIANNPVSREDKDGFKQYVAAFLPNVEFLDYRLLDQQTKAAAYEKFQTQVEEQIDKDNKARAAAEEHERKMAETQLHKEAYVEYLNTARLFEDMYADDPEGNKLNQIPGVDEMLLVFKEKLMTVCQQLFEFGLQEYDKRKAEVDMFWECVNEAKQENKEMGMEAINKFMKDKKRLFIEMVQMTDTKMV--DNKLQEYNDQVSALWDKLMGLELQLVDQLEEIIKDFERNMQDLVSVFLESVQAYLTQARDLENIHNERMIESATSALEKAAKNELDEDVPEELKM--LLVDKDTVMNAVTSSHDVHLLKIDNKEDDIVTRINNWLKNMIETI 489          
BLAST of Dynein regulatory complex subunit 3 vs. TrEMBL
Match: A0A4W5KJY8 (Dynein regulatory complex subunit 3 OS=Hucho hucho OX=62062 PE=4 SV=1)

HSP 1 Score: 404.445 bits (1038), Expect = 7.007e-131
Identity = 212/490 (43.27%), Postives = 312/490 (63.67%), Query Frame = 1
Query:  334 MKRLYNTLEPNIISNKLLTQVVYEQGPKDEAGKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQACYEKYLIRVEQYXXXXXXXXXXXXXXXXXXXSRKVHTLAFVELLDTDLLYNQMIHDDPEKEKIFSITGIEDLANSYLEKFMFISTELFHKGLNELEKRQRDGTLFYTCINAAKSDNNQRAIDLLEEFNIFKVEIMQEINKS--AVISENDMKKLKEMTYDLWSNLMSLEVQLFDQLEETIRDYLRNLTEMIDGFLEIVHAYFAQMRELETSLNERISESAVIVYDKIIKGDMEEDRVTNFKKTDIFNDKDTLANCIATSHDHRVLKIDNWEDGIRIKTKSWLHETCDSIK 1797
            M RLY+T EP+++  +LL + V EQGP+D+AG+IAK EGI +  V  LRLD+KNILKI++LW F SLTKLQL NNIIEKIE L RL +L+WLDLSFN IE IEGL++LVKL DLSLY NRI+VIENMD L  L+V S G N L  +ENV+YLRKFK L++LNL+GNPIC  D Y  F+ A+ P L++LD++L+ +   +  + KY   +E+ +  E +  +     +   +  K+H  AFVELL+   L++ M  DD E  K+  + G+  L  +Y    + +  ++F  GL +  +R+ +   F+ C   A  DN QRA  +  +F   + ++M E+ ++    + E  M    E    L  +LM+ E+QL DQLE+ I+D+ RN+++M+ GF+E+V   FAQ R+LE   +E++ E AV   +++ K ++EED   + +   +F DKDT+ N ++ SHD  +LKIDN ED +  +  SW+     S++
Sbjct:    1 MSRLYDTAEPSLVDEELLQKAVEEQGPQDQAGQIAKEEGIQYDEVCQLRLDYKNILKIDHLWQFTSLTKLQLDNNIIEKIEGLGRLTNLKWLDLSFNNIEGIEGLDSLVKLEDLSLYNNRISVIENMDTLLNLHVLSIGNNFLAQLENVIYLRKFKNLRTLNLAGNPICKEDRYKIFVAAYLPELVYLDFRLLDEQTREQAFGKYQYAIEEMRHNEAQERRAMDARQEQEDELKLHRDAFVELLNGPYLFDSMYADDAEAAKLAYLPGVSVLLETYKNHLVALCVQVFEIGLAQRGRREDEVKSFFDCSREAVDDNQQRAAQIAADFEKARRQVMSEMQQATDTRLLEAQMNHCSEEINQLCDSLMTQELQLVDQLEDIIKDFERNISDMVAGFIEVVQGIFAQCRDLENHHHEKLLEIAVATLERVAKNELEEDMPDDVRM--LFVDKDTVINAVSGSHDTHLLKIDNREDELMTRCNSWMSALMKSVQ 488          
BLAST of Dynein regulatory complex subunit 3 vs. TrEMBL
Match: A0A3M6TEM2 (Uncharacterized protein OS=Pocillopora damicornis OX=46731 GN=pdam_00018500 PE=4 SV=1)

HSP 1 Score: 404.06 bits (1037), Expect = 1.101e-130
Identity = 230/523 (43.98%), Postives = 339/523 (64.82%), Query Frame = 1
Query:  334 MKRLYNTLEPNIISNKLLTQVVYEQGPKDEAGKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQACYEKYLIRVEQYXXXXXXXXXXXXXXXXXXXSRKVHTLAFVELLDTDLLYNQMIHDDPEKEKIFSITGIEDLANSYLEKFMFISTELFHKGLNELEKRQRDGTLFYTCINAAKSDNNQRAIDLLEEFNIFKVEIMQEINKSAVIS--ENDMKKLKEMTYDLWSNLMSLEVQLFDQLEETIRDYLRNLTEMIDGFLEIVHAYFAQMRELETSLNERISESAVIVYDKIIKGDMEEDRVTNFKKTDIFNDKDTLANCIATSHDHRVLKIDNWEDGIRIKTKSWLHETCDSIKQTXXXXXXXXXXXXXXXXXDQVRSEIENYEIPG 1896
            M RLY+T+EP++I  ++L   + EQGPK EAG+IAK EG  F  VLSLRLDFKNILKI+NLW+  +LTKLQ+ NNIIE++E LD LV+LEWLDLSFN IEVIEGL+ L KL DL+LY NRI+ IENMD L +L+VFS G N L  ++NV+YLR+FK L++LNLSGNP      Y  ++ A    L++LD++L+ +   +A  EKY   +E+  + E   ++K+ + +   + R++H +AFVE L+   L+  M  DDPE  K+ ++ G+E++ N Y EKF  I  E+F  GL E EKR+ +   F++C+  A  +NN   +  +  +  +K ++  +       S  E  MK++ E    LW  LM LE++L DQLE+TI+D+ RN+ +++  F+E V     Q+R+LE + +E+ S+ AV+  +K++K ++EED   + +   +F DKDTL N ++ SHD  +LKIDN ED +  +  + +    + I   +E  RNR R+SEINN +D  R E E+YE+ G
Sbjct:    1 MSRLYDTIEPSVIDEQMLKNAIEEQGPKGEAGRIAKQEGTDFGDVLSLRLDFKNILKIDNLWSLVNLTKLQMDNNIIERMEGLDMLVNLEWLDLSFNNIEVIEGLDKLTKLKDLTLYNNRISKIENMDFLTQLHVFSIGNNSLKQLDNVVYLRRFKSLRTLNLSGNPFSEEVNYKEYVIAHLSELVYLDFRLIDESAREAATEKYKYSIEEMVQNETIAKRKQDEVEENQKERQLHKMAFVEDLNGPWLFESMYADDPEAGKLGALPGMEEILNGYNEKFTAICQEIFEFGLKEHEKREAEIASFFSCLEEATQENNNTGVKHIHSYIEYKKKVFLDYTSLTDQSHMETLMKEIVEEIRKLWDTLMGLEMELVDQLEDTIKDFERNMADLVTAFVEHVQGLMTQLRDLENAHHEKTSDIAVVTLEKLMKNELEEDLPDDLRM--LFVDKDTLMNAVSASHDTHLLKIDNKEDDMLTRATTRMQTLNEKI-HNDEVLRNRKRVSEINNLVDHFRDEAESYEVTG 520          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Cavefish
Match: drc3 (dynein regulatory complex subunit 3 [Source:ZFIN;Acc:ZDB-GENE-061103-349])

HSP 1 Score: 320.087 bits (819), Expect = 6.936e-102
Identity = 189/497 (38.03%), Postives = 292/497 (58.75%), Query Frame = 1
Query:  367 IISNKLLTQVVYEQGPKDEAGKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQACYEKYLIRVEQYXXXXXXXXXXXXXXXXXXXSRKVHTLAFVELLDTDLLYNQMIHDDPEKEKIFSITGIEDLANSYLEKFMFISTEL-------FHKGLNELEKRQRDGTLFYTCINAAKSDNNQRAIDLLEEFNIFKVEIMQEINK--SAVISENDMKKLKEMTYDLWSNLMSLEVQLFDQLEETIRDYLRNLTEMIDGFLE-----------IVHAYFAQMRELETSLNERISESAVIVYDKIIKGDMEEDRVTNFKKTDIFNDKDTLANCIATSHDHRVLKIDNWEDGIRIKTKSWLHETCDSIK 1797
            +I+ ++L + V EQGP+  AG+IAK  GI +  V+ LRL++K IL+I++LW F SLTKLQL NN IEKI+ L++L +L WL LSFNKI++IEGLE LVKL  LSL  N+I  IE MD L+ L + S G+N+++ I+NV+YLR+FK L+SLNL+ NPIC    Y  F+ A+ P+L++LD++LV +  ++   EK  +  ++  E+E                 ++H  AFVE L+   L++ M  DD E+ ++ S+ G+  L  +Y    +   TEL       F  GL +  +R+ +G  F+TC   A SDN QRA  ++ +F   + ++M E+ K     + E       E    L   LM+LE+QL DQLE+  +++ RN+++M+  F+E            V ++FAQ RELE   +E++ E A+   +K+ + ++EED   +     +  DKDT+   ++ SHD   LKIDN ED +  +  SW+     S++
Sbjct:    1 VINEEMLRKAVEEQGPQGRAGRIAKEGGIQYDEVIQLRLEYK-ILQIDHLWEFTSLTKLQLNNNSIEKIQGLEKLTNLLWL-LSFNKIKMIEGLEALVKLQTLSLSNNQIPAIEKMDTLEHLEILSLGENVISQIDNVIYLRRFKNLRSLNLARNPICQETNYKIFVVAYLPDLVYLDFRLVDEQTNE-LKEKRAMEAQKITEQEL----------------QLHKDAFVEYLNGPQLFDSMFADDAEESRLASLPGVPKLLETYPCLLIHYQTELVALCMQIFETGLIQHAERKNEGDSFFTCCREAVSDNQQRAAQIVTDFEESRRQVMAEMQKITDPELLEAQRDNYSEKISQLSDTLMTLELQLVDQLEDVFKEFERNISDMVGAFIENVQGIYPLTALPVQSHFAQCRELEKHYHEKLQEIALATLEKMARNELEEDMPEDMHL--LLVDKDTVVKAVSASHDTHQLKIDNREDELMTRINSWMSAMMKSVQ 476          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Cavefish
Match: drc3 (dynein regulatory complex subunit 3 [Source:ZFIN;Acc:ZDB-GENE-061103-349])

HSP 1 Score: 287.345 bits (734), Expect = 9.649e-90
Identity = 169/488 (34.63%), Postives = 272/488 (55.74%), Query Frame = 1
Query:  334 MKRLYNTLEPNIISNKLLTQVVYEQGPKDEAGKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQACYEKYLIRVEQYXXXXXXXXXXXXXXXXXXXSRKVHTLAFVELLDTDLLYNQMIHDDPEKEKIFSITGIEDLANSYLEKFMFISTELFHKGLNELEKRQRDGTLFYTCINAAKSDNNQRAIDLLEEFNIFKVEIMQEINKSAVISENDMKKLKEMTYDLWSNLMSLEVQLFDQLEETIRDYLRNLTEMIDGFLEIVHAYFAQMRELETSLNERISESAVIVYDKIIKGDMEEDRVTNFKKTDIFNDKDTLANCIATSHDHRVLKIDNWEDGIRIKTKSWLHETCDSIK 1797
            M   Y+ +   +I+ ++L + V EQGP+  AG+IAK  GI +  V+ LRL++K IL+I++LW F SLTKLQL NN IEKI+ L++L +L WLDLSFNKI++IEGLE LVKL  LSL  N+I  IE MD L+ L + S G+N+++ I+NV+YLR+FK L+SLNL+ NPIC    Y  F+ A+ P+L++LD++LV     +   E+ L  +    + E + ++    +K   +  ++H  AFVE L+   L++ M  DD E+ ++ S+ G+  L    LE +  +  ++F  GL +  +R+ +G  F+TC   A SDN QRA  ++ +F   + ++    +    I                                   ++ RN+++M+  F+E V   +       T  +E++ E A+   +K+ + ++EED   +     +  DKDT+   ++ SHD   LKIDN ED +  +  SW+     S++
Sbjct:    1 MSMWYDRMGHCVINEEMLRKAVEEQGPQGRAGRIAKEGGIQYDEVIQLRLEYKKILQIDHLWEFTSLTKLQLNNNSIEKIQGLEKLTNLLWLDLSFNKIKMIEGLEALVKLQTLSLSNNQIPAIEKMDTLEHLEILSLGENVISQIDNVIYLRRFKNLRSLNLARNPICQETNYKIFVVAYLPDLVYLDFRLVD----EQTRERALTEINVMTDNELKEKRAMEAQKITEQELQLHKDAFVEYLNGPQLFDSMFADDAEESRLASLPGVPKL----LETYPSLCMQIFETGLIQHAERKNEGDSFFTCCREAVSDNQQRAAQIVTDFEESRRQVGFACSLCVTI-----------------------------------EFERNISDMVGAFIENVQGIYPL-----THYHEKLQEIALATLEKMARNELEEDMPEDMHL--LLVDKDTVVKAVSASHDTHQLKIDNREDELMTRINSWMSAMMKSVR 438          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Cavefish
Match: ENSAMXT00000057771.1 (pep primary_assembly:Astyanax_mexicanus-2.0:24:38132889:38135255:-1 gene:ENSAMXG00000029033.1 transcript:ENSAMXT00000057771.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.9005 bits (237), Expect = 4.283e-22
Identity = 53/103 (51.46%), Postives = 69/103 (66.99%), Query Frame = 1
Query:  562 IEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVL-YLRKFKKLQSLNLSGNPICHSDEYFSFI 867
            I KIE L+ L +LE LDLS+NKI+VIEGL+ LVKL  L+L  N I+VIENMD L+ L   S     +  ++N + YLR+FK L+SL L+GNPI     Y  +I
Sbjct:   18 ISKIEGLEILTNLECLDLSYNKIKVIEGLDTLVKLKQLNLSMNNISVIENMDTLEHLQHLSLAHTRICQLDNTVEYLRRFKNLRSLRLAGNPISRKTNYTLYI 120          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Cavefish
Match: ppp1r7 (protein phosphatase 1 regulatory subunit 7 [Source:NCBI gene;Acc:111191999])

HSP 1 Score: 80.8777 bits (198), Expect = 3.956e-16
Identity = 55/153 (35.95%), Postives = 83/153 (54.25%), Query Frame = 1
Query:  454 AFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLV 912
            A +++ SL L    I K+ NL    +LT L + +N I K+E L  +V+L  L LS N IEVIEGLEN  KLT L +  NRI  IEN+ +L +L  F    N + +  ++  L+  K L+++ L  NP+    +Y   I    P++  +D   +
Sbjct:  192 ALTSLDSLFLGTNKITKLQNLDGLHNLTVLSIQSNRITKLEGLQNMVNLRELYLSHNGIEVIEGLENNKKLTTLDIAANRIKKIENISHLTDLQEFWMNDNQIENWSDLDELKNAKGLETVYLERNPLQKDPQYRRKIMLALPSVRQIDATFI 344          

HSP 2 Score: 78.5666 bits (192), Expect = 2.535e-15
Identity = 58/138 (42.03%), Postives = 76/138 (55.07%), Query Frame = 1
Query:  427 GKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPIC 840
            GKI   E +  +  LSLR +   I KI NL +  SL +L L +N I K+ENL  L  LE LD+SFN +  IEGLE L K+  L L  N+I+ I N+++L  L++   G N +  IEN   L     L SL L  N I 
Sbjct:   75 GKIEGLEVLQKAKTLSLRQNL--IKKIENLESLSSLRELDLYDNQIRKLENLQALTELEQLDVSFNLLRKIEGLERLTKVKKLFLLHNKISSIANLEHLTSLHMLELGSNRIRIIEN---LDALTSLDSLFLGTNKIT 207          

HSP 3 Score: 59.3066 bits (142), Expect = 5.056e-9
Identity = 48/137 (35.04%), Postives = 70/137 (51.09%), Query Frame = 1
Query:  430 KIAKTEGI-AFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPI 837
            +I K E + A + +  L + F  + KI  L     + KL L++N I  I NL+ L  L  L+L  N+I +IE L+ L  L  L L  N+I  ++N+D L  L V S   N +T +E    L+    L+ L LS N I
Sbjct:  117 QIRKLENLQALTELEQLDVSFNLLRKIEGLERLTKVKKLFLLHNKISSIANLEHLTSLHMLELGSNRIRIIENLDALTSLDSLFLGTNKITKLQNLDGLHNLTVLSIQSNRITKLEG---LQNMVNLRELYLSHNGI 250          

HSP 4 Score: 49.2914 bits (116), Expect = 7.534e-6
Identity = 38/87 (43.68%), Postives = 48/87 (55.17%), Query Frame = 1
Query:  547 LVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKL 807
            LV+  I KIE L+ L   + L L  N I+ IE LE+L  L +L LY N+I  +EN+  L EL       NLL  IE +  L K KKL
Sbjct:   69 LVHCRIGKIEGLEVLQKAKTLSLRQNLIKKIENLESLSSLRELDLYDNQIRKLENLQALTELEQLDVSFNLLRKIEGLERLTKVKKL 155          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Cavefish
Match: lrrc6 (leucine rich repeat containing 6 [Source:NCBI gene;Acc:103025716])

HSP 1 Score: 63.929 bits (154), Expect = 2.719e-10
Identity = 50/156 (32.05%), Postives = 77/156 (49.36%), Query Frame = 1
Query:  463 TVLSLRLDFKNILKINNL--WAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKME 924
            T+  + L  ++I +I ++  W  + L  L L NN+I KIEN+ RL +LE+L+L+ N IEVIE LE    L  L L  N + ++ ++++LK  NV                      L+ L L GNP      Y  ++ A  P L +LD   + + E
Sbjct:   38 TLEEVSLHQQDIERIEHIDKWC-RDLKILYLQNNLIPKIENVGRLKNLEYLNLALNNIEVIENLEGCESLQKLDLTVNFVGLLSSVESLKH-NVH---------------------LRELYLVGNPCSEFQGYRQYVVACLPQLKWLDGTAIRRAE 170          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007158.1 (pep scaffold:Pmarinus_7.0:GL477065:91521:97732:-1 gene:ENSPMAG00000006473.1 transcript:ENSPMAT00000007158.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 133.65 bits (335), Expect = 1.311e-35
Identity = 74/208 (35.58%), Postives = 126/208 (60.58%), Query Frame = 1
Query: 1156 SYLEKFMFISTELFHKGLNELEKRQRDGTLFYTCINAAKSDNNQRAIDLLEEFNIFKVEIMQEINKSAVISENDMKKLK--EMTYDLWSNLMSLEVQLFDQLEETIRDYLRNLTEMIDGFLEIVHAYFAQMRELETSLNERISESAVIVYDKIIKGDMEEDRVTNFKKTDIFNDKDTLANCIATSHDHRVLKIDNWEDGIRIKTKSWL 1773
            +Y +KF+ I  ++F  GL + +KR+ +   F   +N AKSDN Q A  ++ +F     ++++E+ +    +  D K L+  +   ++W  LM LE+QL DQLE+ ++D+ RNLT+M+  F+E V    +Q RELE + +E++ E  +  +DKI+K +++E+   + +   IF DKD+L N  + SHD  +LKIDN ED I  +  +W+
Sbjct:    4 TYRQKFVDICRKIFEYGLQQYKKREEEVDDFTRSVNEAKSDNRQAASAIISDFEKENAQLLEEVQQITDAALLDAKILEHSQKINNMWDALMKLEIQLLDQLEDVVKDFERNLTDMVAAFIENVQGLLSQCRELENNYHEKLLEVLMSTFDKIVKNELKEELSEDLRL--IFTDKDSLVNAASASHDIHLLKIDNKEDDIISRANTWM 209          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Sea Lamprey
Match: ppp1r7 (protein phosphatase 1, regulatory (inhibitor) subunit 7 [Source:NCBI gene;Acc:560323])

HSP 1 Score: 82.4185 bits (202), Expect = 2.367e-17
Identity = 62/153 (40.52%), Postives = 86/153 (56.21%), Query Frame = 1
Query:  403 EQGPKDEA--------GKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPI 837
            E  P DE         GKI + E +    VL LR +   I +I NL +  +L +L L +N+++KIENLD LV+LE LD+SFN +  IEGL+ L K+  L L  N+I  IEN+++L EL +     N +  IEN+  L   K L SL +  N I
Sbjct:   53 ELNPDDEEVDLNHCRIGKIERLEILMKVKVLCLRQNM--IAQIENLESLTTLRELDLYDNVLKKIENLDTLVNLEMLDISFNVLRKIEGLDTLRKVRKLFLVSNKITKIENLNSLTELRMLEVASNRIRVIENIETL---KNLDSLFIGKNKI 200          

HSP 2 Score: 81.2629 bits (199), Expect = 5.461e-17
Identity = 55/139 (39.57%), Postives = 78/139 (56.12%), Query Frame = 1
Query:  496 ILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLV 912
            I K+ NL +  +LT L + +N I KIE L  LV+L+ L LS N IEVIEGLEN  KLT L +  NR+  IEN+ +L EL  F    N +++  +V  L+  + LQ++ L  NP+    +Y   I    P +  +D   V
Sbjct:  200 ITKLQNLDSLTNLTVLSIQSNRITKIEGLSSLVNLQELYLSHNGIEVIEGLENNKKLTTLDIAANRVRRIENVGHLTELQEFWMNDNQISNWNDVDELKNARGLQTVYLERNPLQRDPQYRRKIMLALPWVRQIDATYV 338          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Sea Lamprey
Match: LRRC49 (leucine rich repeat containing 49 [Source:HGNC Symbol;Acc:HGNC:25965])

HSP 1 Score: 62.7734 bits (151), Expect = 1.364e-10
Identity = 46/125 (36.80%), Postives = 69/125 (55.20%), Query Frame = 1
Query:  475 LRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSD 849
            L LD + +     L   + L  L L +N+I + ++L  L  L +LDL  N++E I GL NL  L  L L  NRI  I ++++L +L+V     N +  IEN+ +L    +L+ LNL+GN I H D
Sbjct:   35 LNLDSRGMTMCPILDGEEDLRLLSLQHNLIRRAQHLSHLRRLVFLDLYANELEEISGLYNLRSLRVLMLGKNRIRKITSLESLTKLDVLDLHGNQIVRIENLSHL---SELRVLNLAGNQITHVD 156          

HSP 2 Score: 62.3882 bits (150), Expect = 2.252e-10
Identity = 47/156 (30.13%), Postives = 77/156 (49.36%), Query Frame = 1
Query:  472 SLRLDFKNILKINNLWAFKSLTKLQLVN---NIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQ 930
            SLR+      +I  + + +SLTKL +++   N I +IENL  L  L  L+L+ N+I  ++ L  L  L +L+L  N I+ ++ +D L  L       N + + + ++ LR+   L  + L GNP+     Y          L  LD K VT+ E +
Sbjct:   97 SLRVLMLGKNRIRKITSLESLTKLDVLDLHGNQIVRIENLSHLSELRVLNLAGNQITHVDSLRGLHSLAELNLRRNNISSMKEVDCLPSLQRLFLSYNNIANFDGIVCLREAPSLCEVALDGNPLAQEACYRQTALRHMGQLRQLDMKRVTEEERR 252          

HSP 3 Score: 54.6842 bits (130), Expect = 4.866e-8
Identity = 49/149 (32.89%), Postives = 69/149 (46.31%), Query Frame = 1
Query:  496 ILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNL--MFLDYKLVTKMEHQAC 936
            I +  +L   + L  L L  N +E+I  L  L  L  L L  N+I  I  LE+L KL  L L+ N+I  IEN+ +L EL V +   N +T +++   LR    L  LNL  N I    E         P+L  +FL Y  +   +   C
Sbjct:   64 IRRAQHLSHLRRLVFLDLYANELEEISGLYNLRSLRVLMLGKNRIRKITSLESLTKLDVLDLHGNQIVRIENLSHLSELRVLNLAGNQITHVDS---LRGLHSLAELNLRRNNISSMKE-----VDCLPSLQRLFLSYNNIANFDGIVC 204          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Sea Lamprey
Match: cep97 (centrosomal protein 97 [Source:ZFIN;Acc:ZDB-GENE-031030-11])

HSP 1 Score: 60.4622 bits (145), Expect = 8.774e-10
Identity = 46/195 (23.59%), Postives = 87/195 (44.62%), Query Frame = 1
Query:  433 IAKTEGI-AFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNL------------------------KELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPI------CHSDEYFSFIFAFFPNLMFLDYKLVTKME 924
            +AK +G+ +   ++ L     +++++  +    SL +L L  N I  IE L  L HL+WL+L+ N I+ IE L     LT + L  N I+ + +M  L                         +L + S  +N +T +  + +L   + L+ L++  NP         + ++  ++ ++   L  LD  +VT+ E
Sbjct:   47 LAKLDGVESCRHLMQLSAAENSLVRMGGVARLSSLKQLNLPRNSIPAIEGLKDLCHLQWLNLAGNSIKTIEHLNGCTSLTYVDLSDNNISHLGDMSKLSNLRTLLLHGNMVTSLRTAPTHLPPQLGILSLAENEITDLTEMSHLSCLRSLEQLSVMKNPCMLSAPSAPACDHRPYVLSWCLTLRVLDGHVVTQKE 241          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Sea Lamprey
Match: lrrc6 (leucine rich repeat containing 6 [Source:NCBI gene;Acc:432388])

HSP 1 Score: 57.7658 bits (138), Expect = 4.200e-9
Identity = 43/138 (31.16%), Postives = 64/138 (46.38%), Query Frame = 1
Query:  511 NLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKME 924
            ++W  + L  L L NN+I +IENL RL  LE+++L+ N +E IE L+    L  L L  N +                     L+S+E    LR    L+ L L GNP    + Y  ++ A  P L  LD + + + E
Sbjct:   37 DVWC-RHLKTLYLHNNVIPRIENLSRLKELEYINLALNNVERIENLQGCESLQKLDLTVNFVGE-------------------LSSVET---LRHNPLLEELFLVGNPCADFEGYRPYVVATLPQLKRLDGQEIERSE 151          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Yeast
Match: SDS22 (Regulatory subunit of the type 1 protein phosphatase (PP1) Glc7p; whether it functions as a positive or negative regulator of Glc7p is controversial; involved in the regulation of Glc7p nuclear localization and function [Source:SGD;Acc:S000001676])

HSP 1 Score: 61.6178 bits (148), Expect = 9.384e-11
Identity = 50/121 (41.32%), Postives = 71/121 (58.68%), Query Frame = 1
Query:  511 NLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSF--NKIEVIEG-LENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSF 864
            NL+ FK+L +L L  N+IE I  ++ L H + +DL F  NKI+ I   +  L KLT L L  N+I  I+N++NL +L    F +N ++ IEN   L   K L++L L GN + HS E  SF
Sbjct:   61 NLYRFKNLKQLCLRQNLIESISEVEVLPHDKIVDLDFYDNKIKHISSNVNKLTKLTSLDLSFNKIKHIKNLENLTDLENLYFVQNSISKIEN---LSTLKSLKNLELGGNKV-HSIEPDSF 177          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Nematostella
Match: EDO38071 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDZ3])

HSP 1 Score: 359.377 bits (921), Expect = 6.231e-118
Identity = 220/523 (42.07%), Postives = 321/523 (61.38%), Query Frame = 1
Query:  334 MKRLYNTLEPNIISNKLLTQVVYEQGPKDEAGKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQACYEKYLIRVEQYXXXXXXXXXXXXXXXXXXXSRKVHTLAFVELLDTDLLYNQMIHDDPEKEKIFSITGIEDLANSYL--EKFMFISTELFHKGLNELEKRQRDGTLFYTCINAAKSDNNQRAIDLLEEFNIFKVEIMQEINKSAVISENDMKKLKEMTYDLWSNLMSLEVQLFDQLEETIRDYLRNLTEMIDGFLEIVHAYFAQMRELETSLNERISESAVIVYDKIIKGDMEEDRVTNFKKTDIFNDKDTLANCIATSHDHRVLKIDNWEDGIRIKTKSWLHETCDSIKQTXXXXXXXXXXXXXXXXXDQVRSEIENYEIPG 1896
            M RLY+T+EP++I   +L Q V EQGPK EAG+IAK EGI F  VL+LRLDFKNILKI+NLW+F +LT LQL NNIIEKIE LD LV+L+WLDLSFN IEVIEGL+ L KL DL+LY NRI  IENMD+L  L+VFS G N L  ++NV+YLR+FK L++LNLS NP C   +Y  ++ A  P+L++LD++L+ +   +A  E+Y   +E+    E   +KK+ +E+   + R +H  A+V+ L+   LY  M  +DPE  K+  + G+ED+   Y    KF  +  E+F  GL E +KR+ +   F+ C+N AK+DN    +  ++++  FK                  KK                        +TI+D+ R++ +M+  F+E        +R+LE   NER+S+ AV+  +K++K ++EED   + +   +F DKDT+ N ++ SHD  +LKIDN ED I  +  + +    ++I  ++E +RNR+R++EINN ID  R E E+YE+ G
Sbjct:    1 MSRLYDTIEPSVIDEHMLKQAVEEQGPKGEAGRIAKQEGIDFENVLALRLDFKNILKIDNLWSFVNLTTLQLDNNIIEKIEGLDMLVNLQWLDLSFNNIEVIEGLDKLTKLKDLTLYNNRITKIENMDSLTNLHVFSIGNNSLKQLDNVIYLRRFKNLRTLNLSFNPFCEDSKYKEYVIAHLPDLVYLDFRLIDETAREAATERYKYSIEEMVHDETVAQKKQDEEEARNKERLLHKAAYVDELNGRALYESMFSEDPEVNKMSILPGMEDILKKYPFQNKFTAVCLEIFEFGLKESKKRKEEVDSFFQCLNEAKTDNKSEGVKHIQKYIDFK------------------KK------------------------DTIKDFERSMADMVTSFVE-------NLRDLENIHNERVSDIAVVTLEKLMKNELEEDLPDDLRM--LFVDKDTIMNAVSASHDTHLLKIDNKEDDIVTRANTTMQTLIENI-HSDEIKRNRDRVAEINNLIDHFRDEAESYEMSG 471          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Nematostella
Match: EDO44937 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU20])

HSP 1 Score: 78.5666 bits (192), Expect = 6.642e-16
Identity = 55/128 (42.97%), Postives = 73/128 (57.03%), Query Frame = 1
Query:  427 GKIAKTEGIA-FSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKL 807
            G+I K +       V SL L    I K+ NL    SL +L   +N I KIENLDRLV+L  LDLSFN I+VIE L +L KL  L L  N+I  IE +++L EL +   G N +  +E + +L K + L
Sbjct:   37 GRIDKIQNFERLRCVKSLCLRRNEIKKLENLETLTSLEELDFYDNQISKIENLDRLVNLRILDLSFNVIKVIENLNSLTKLEKLYLVQNKIGRIEGLEHLTELTMVELGANKIRVLEGLEHLTKLESL 164          

HSP 2 Score: 70.0922 bits (170), Expect = 4.487e-13
Identity = 59/164 (35.98%), Postives = 81/164 (49.39%), Query Frame = 1
Query:  424 AGKIAKTEGIAFSTVL-SLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLV 912
            A KI   EG+   T L SL +    I ++ NL    SL  L + +N I +++ L+ L  LE L +S N IE I+GLE+L KL  L L  NRI  I N+ +L  L  F F  N L   E++  L K  KL ++ L  NP+     Y   +    P L  +D  L 
Sbjct:  146 ANKIRVLEGLEHLTKLESLFVGKNKITELQNLSGLCSLKVLSIQSNRIVELKGLEHLDSLEELYISHNGIEEIKGLESLTKLNTLDLASNRIKRISNVGHLLNLEEFWFNDNQLEHWEDLDELAKCPKLHTVYLERNPLSRDTAYRRKVKLALPALKQIDATLC 309          

HSP 3 Score: 60.8474 bits (146), Expect = 4.665e-10
Identity = 42/111 (37.84%), Postives = 61/111 (54.95%), Query Frame = 1
Query:  475 LRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKL 807
            L L F  I  I NL +   L KL LV N I +IE L+ L  L  ++L  NKI V+EGLE+L KL  L +  N+I  ++N+  L  L V S   N +  ++ + +L   ++L
Sbjct:   98 LDLSFNVIKVIENLNSLTKLEKLYLVQNKIGRIEGLEHLTELTMVELGANKIRVLEGLEHLTKLESLFVGKNKITELQNLSGLCSLKVLSIQSNRIVELKGLEHLDSLEEL 208          

HSP 4 Score: 51.6026 bits (122), Expect = 4.770e-7
Identity = 34/87 (39.08%), Postives = 52/87 (59.77%), Query Frame = 1
Query:  547 LVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKL 807
            L +  I+KI+N +RL  ++ L L  N+I+ +E LE L  L +L  Y N+I+ IEN+D L  L +     N++  IEN+  L K +KL
Sbjct:   34 LTHGRIDKIQNFERLRCVKSLCLRRNEIKKLENLETLTSLEELDFYDNQISKIENLDRLVNLRILDLSFNVIKVIENLNSLTKLEKL 120          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Nematostella
Match: EDO30347 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T121])

HSP 1 Score: 67.3958 bits (163), Expect = 4.383e-13
Identity = 62/177 (35.03%), Postives = 80/177 (45.20%), Query Frame = 1
Query:  463 TVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHL---------------------EWLD------LSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLV 912
            ++ SL L    I K+ NL    SL +L   +N I KIENLDRLV+L                     E LD      +S N IE I+GLE+L KL  L L  NRI  I N+ +L  L  F F  N L   E++  L K  KL ++ L  NP+     Y   +    P L  +D  L 
Sbjct:    4 SLQSLCLRRNEIKKLENLETLTSLEELDFYDNQISKIENLDRLVNLSCHHVFLFVFQSNRIVELKGLEHLDSLEELYISHNGIEEIKGLESLAKLNTLDLASNRIKRISNVGHLLNLEEFWFNDNQLEHWEDLDELAKCPKLHTVYLERNPLSRDTAYRRKVKLALPALKQIDATLC 180          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Nematostella
Match: EDO35299 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLU3])

HSP 1 Score: 67.0106 bits (162), Expect = 4.570e-12
Identity = 54/160 (33.75%), Postives = 80/160 (50.00%), Query Frame = 1
Query:  457 FSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFG-------KNLLTSIEN----VLYLRKFKKLQ-SLNLSGNPICHSDEYFSFIFAFFPNLMFLD 900
             S +++L L   +I KI  L   ++L  L L +N I  IE L  L +L  L+LS N+I ++EGLENL KLT L L     N IEN+  LK+L+   +         N + S+E+    V+     K+L   +   GN +C+   Y   + +  P L  LD
Sbjct:   33 HSNLVTLNLHSNHISKIEGLQHLQNLRHLDLSSNQISHIEGLTSLGYLRVLNLSCNRIYLVEGLENLRKLTKLDL---SYNFIENVSGLKDLHGNGYSLTTLYLHGNRIASLEHFISSVIGCISLKELTLQMYGEGNHVCNVSGYRDGVLSAMPGLAVLD 189          

HSP 2 Score: 65.0846 bits (157), Expect = 2.105e-11
Identity = 49/130 (37.69%), Postives = 67/130 (51.54%), Query Frame = 1
Query:  496 ILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFK----KLQSLNLSGNPICHSDEYFSFIFA 873
            I  I +L    +L  L L +N I KIE L  L +L  LDLS N+I  IEGL +L  L  L+L CNRI ++E ++NL++L       N    IENV  L+        L +L L GN I   + + S +  
Sbjct:   24 ITSIKSLKLHSNLVTLNLHSNHISKIEGLQHLQNLRHLDLSSNQISHIEGLTSLGYLRVLNLSCNRIYLVEGLENLRKLTKLDLSYNF---IENVSGLKDLHGNGYSLTTLYLHGNRIASLEHFISSVIG 150          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Nematostella
Match: EDO45771 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSA0])

HSP 1 Score: 67.3958 bits (163), Expect = 1.056e-11
Identity = 52/162 (32.10%), Postives = 76/162 (46.91%), Query Frame = 1
Query:  454 AFSTVLSLR---LDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQ 930
              S++ SLR   L    I KINNL A   L  L L  N I KIENL  L  L  L+L+ N+I  +  +  +  L +L+L  N+I  +E +D L  L       N ++  E++  L +   +  L+L GNP      Y   +      L  LD K +T+ E +
Sbjct:   88 GLSSLKSLRVLMLGKNRIRKINNLEALTKLDVLDLHGNRISKIENLSHLTELRVLNLAGNEILKVCNISGMRSLAELNLRRNKICTVEEVDRLSNLQRLFLSFNCISRFEDINCLTRSTSITELSLDGNPFASDVTYKQTVLKSVTCLRQLDMKRITEEERR 249          

HSP 2 Score: 60.8474 bits (146), Expect = 1.208e-9
Identity = 51/152 (33.55%), Postives = 73/152 (48.03%), Query Frame = 1
Query:  496 ILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNL--MFLDYKLVTKMEHQACYEK 945
            I  I +L   + L  L + +N IE+I  L  L  L  L L  N+I  I  LE L KL  L L+ NRI+ IEN+ +L EL V +   N +  + N+  +R    L  LNL  N IC  +E          NL  +FL +  +++ E   C  +
Sbjct:   61 IRNIQHLANLRRLIFLDIYDNQIEEISGLSSLKSLRVLMLGKNRIRKINNLEALTKLDVLDLHGNRISKIENLSHLTELRVLNLAGNEILKVCNISGMR---SLAELNLRRNKICTVEE-----VDRLSNLQRLFLSFNCISRFEDINCLTR 204          

HSP 3 Score: 53.9138 bits (128), Expect = 1.438e-7
Identity = 44/121 (36.36%), Postives = 66/121 (54.55%), Query Frame = 1
Query:  475 LRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPI 837
            L LD + +     L    +L  L   +N+I  I++L  L  L +LD+  N+IE I GL +L  L  L L  NRI  I N++ L +L+V     N ++ IEN+ +L    +L+ LNL+GN I
Sbjct:   32 LNLDRRRLTVCPILEGEDNLRLLNFQHNLIRNIQHLANLRRLIFLDIYDNQIEEISGLSSLKSLRVLMLGKNRIRKINNLEALTKLDVLDLHGNRISKIENLSHL---TELRVLNLAGNEI 149          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Medaka
Match: drc3 (dynein regulatory complex subunit 3 [Source:NCBI gene;Acc:101162841])

HSP 1 Score: 226.098 bits (575), Expect = 3.967e-66
Identity = 152/473 (32.14%), Postives = 258/473 (54.55%), Query Frame = 1
Query:  361 PNIISNKLLTQVVYEQGPKDEAGKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQACYEKYLIRVEQYXXXXXXXXXXXXXXXXXXXSRKVHTLAFVELLDTDLLYNQMIHDDPEKEKIFSITGIEDLANSYLEKFMFISTELFHKGLNELEKRQRDGTLFYTCINAAKSDNNQRAIDLLEEFNIF---KVEIMQEINKSAVISENDMKKLKEMTYDLWSNLMSLEVQLFDQLEETIRDYLRNLTEMIDGFLEIVHAYFAQMRELETSLNERISESAVIVYDKIIKGDMEEDRVTNFKKTDIFNDKDTLANCIATSHDHRVLKIDNWEDGIRIKTKSW 1770
            PN ++ +++   + +   K +   ++K + I       ++L+++NI +I++L  + SL +L L NN+I+KI+ LD L++L WL+LSFN+IE I+GL +L KL  L+L  N+I VIENMD L  L  F  G NLL  +ENVLYL++FKKL  + + GN   + D+Y  FI AFFPNL  LD KL+ +   +    KY   +E+  ++E + +  E   +       +H  AFVE LD   L+  M  +D       S+ GIEDL  S+  + + +  +LF +GL E E+R+R+   F +  +  ++    +AI +LE+FN     +++ ++++     +SE   +   E+   L   LM+LE +L  +LEE IR+    +++ +  F+EI    F + R LE   + ++ E      + + KG   E+   + K   +F DK  + + + T+H   +L +++ E  +     SW
Sbjct:    5 PNRMNREMIQNAIEKNSIKSDL--MSKEDNICLPEADVIKLEYQNIQRIDSLQEYTSLVRLDLNNNLIKKIQGLDSLINLTWLNLSFNRIEKIQGLTSLQKLKVLNLSNNQITVIENMDTLDNLTHFFIGCNLLNQLENVLYLKRFKKLVHIYMKGNLFSNEDDYQFFIVAFFPNLTVLDNKLILQELKEKASSKYQDDIEKRNQEESQKQLAEEVLQKQEAELNLHKEAFVEYLDGPHLFKSMFDEDTFSSDRRSVPGIEDLLQSFENQMVGLCKQLFDRGLAEREQRERELKSFSSSQDEVETHYKNQAIQVLEDFNRQHKERIKKLEQLTLRNSVSEELSRGYDEIN-KLSERLMTLEFKLISKLEENIRNVETCISDKVTDFIEIAQETFTECRNLEDDFHHKVQEIIDATLENVAKGSQVENLPHDVKM--LFTDKIKVMHALNTNHKLHLLTLNDREQKLLTSVSSW 472          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Medaka
Match: drc3 (dynein regulatory complex subunit 3 [Source:NCBI gene;Acc:101162841])

HSP 1 Score: 167.933 bits (424), Expect = 2.369e-45
Identity = 113/277 (40.79%), Postives = 164/277 (59.21%), Query Frame = 1
Query:  487 FKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQACYEKYLIRVEQYXXXXXXXXXXXXXXXXXXXSRKVHTLAFVELLDTDLLYNQMIHDDPEKEKIFSITGIEDLANSYLEKFMFISTELFHKGLNELEKRQRDGTLFYTCINAAKSDNNQRAIDLLEEFN 1317
            F +I +I++L  + SL +L L NN+I+KI+ LD L++L WL+LSFN+IE I+GL +L KL  L+L  N+I VIENMD L  L  F  G NLL  +ENVLYL++FKKL  + + GN   + D+Y  FI AFFPNL  LD KL+ +   +    KY   +E+  ++E + +  E   +   E       AFVE LD   L+  M  +D       S+ GIEDL  SY   F F +T++ H  LN+ E+R+R+   F +  +  ++    +AI +LE+FN
Sbjct:   33 FADIQRIDSLQEYTSLVRLDLNNNLIKKIQGLDSLINLTWLNLSFNRIEKIQGLTSLQKLKVLNLSNNQITVIENMDTLDNLTHFFIGCNLLNQLENVLYLKRFKKLVHIYMKGNLFSNEDDYQFFIVAFFPNLTVLDNKLILQ---ELASSKYQDDIEKRNQEESQKQLAEEVLQKQEE-------AFVEYLDGPHLFKSMFDEDTFSSDRRSVPGIEDLLQSY-PLFRFSNTQIDHSLLNKREQRERELKSFSSSQDEVETHYKNQAIQVLEDFN 298          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Medaka
Match: ppp1r7 (protein phosphatase 1 regulatory subunit 7 [Source:NCBI gene;Acc:101158055])

HSP 1 Score: 82.4185 bits (202), Expect = 1.172e-16
Identity = 56/153 (36.60%), Postives = 84/153 (54.90%), Query Frame = 1
Query:  454 AFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLV 912
              +++ SL L    I K+ NL A  +L+ L + +N I KIE L  LV+L+ L LS N IEVIEGLEN  KLT L +  NR+  IEN+ +L EL  F    N + +  ++  L+  K L+++ L  NP+    +Y   I    P++  +D   +
Sbjct:  192 GLTSLTSLFLGTNKINKLQNLDALHNLSVLSIQSNRITKIEGLQNLVNLKELYLSHNGIEVIEGLENNKKLTTLDIAANRVKKIENISHLTELQEFWMNDNQIENWSDLDELKNAKSLETVYLERNPLQKDPQYRRKIMLALPSVRQIDATFI 344          

HSP 2 Score: 73.9442 bits (180), Expect = 8.189e-14
Identity = 69/195 (35.38%), Postives = 90/195 (46.15%), Query Frame = 1
Query:  307 GDDVLIDIRMKRLYNTLEPNIISNKLLTQVVYEQGPKD------------------EAGKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPI 837
            GDD   + R K +   ++PN  S    T    E+ P D                    GKI   E +  +  LSLR +   I KI NL +  SL +L L +N I K+ENLD L  LE LD+SFN +  IE LE L +L  L L  N+I  I N+++   L +   G N +  IEN   L     L SL L  N I
Sbjct:   24 GDD---ESRRKSINGDVDPNQPS----TTTSKEESPVDMDTITLDPEEEDVDLVHCRIGKIEGLEVLQKAKTLSLRQNL--IKKIENLESLSSLRELDLYDNQIRKLENLDNLTELEQLDVSFNILRKIENLERLTQLKKLFLVHNKITGIANLEHFSFLEMLELGSNRIRVIEN---LDGLTSLTSLFLGTNKI 206          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Medaka
Match: ppp1r7 (protein phosphatase 1 regulatory subunit 7 [Source:NCBI gene;Acc:101158055])

HSP 1 Score: 79.7221 bits (195), Expect = 1.591e-15
Identity = 56/153 (36.60%), Postives = 84/153 (54.90%), Query Frame = 1
Query:  454 AFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLV 912
              +++ SL L    I K+ NL A  +L+ L + +N I KIE L  LV+L+ L LS N IEVIEGLEN  KLT L +  NR+  IEN+ +L EL  F    N + +  ++  L+  K L+++ L  NP+    +Y   I    P++  +D   +
Sbjct:  231 GLTSLTSLFLGTNKINKLQNLDALHNLSVLSIQSNRITKIEGLQNLVNLKELYLSHNGIEVIEGLENNKKLTTLDIAANRVKKIENISHLTELQEFWMNDNQIENWSDLDELKNAKSLETVYLERNPLQKDPQYRRKIMLALPSVRQIDATFI 383          

HSP 2 Score: 72.0182 bits (175), Expect = 5.144e-13
Identity = 57/137 (41.61%), Postives = 73/137 (53.28%), Query Frame = 1
Query:  427 GKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPI 837
            GKI   E +  +  LSLR +   I KI NL +  SL +L L +N I K+ENLD L  LE LD+SFN +  IE LE L +L  L L  N+I  I N+++   L +   G N +  IEN   L     L SL L  N I
Sbjct:  114 GKIEGLEVLQKAKTLSLRQNL--IKKIENLESLSSLRELDLYDNQIRKLENLDNLTELEQLDVSFNILRKIENLERLTQLKKLFLVHNKITGIANLEHFSFLEMLELGSNRIRVIEN---LDGLTSLTSLFLGTNKI 245          

HSP 3 Score: 67.0106 bits (162), Expect = 1.868e-11
Identity = 51/121 (42.15%), Postives = 66/121 (54.55%), Query Frame = 1
Query:  475 LRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPI 837
            L + F  + KI NL     L KL LV+N I  I NL+    LE L+L  N+I VIE L+ L  LT L L  N+IN ++N+D L  L+V S   N +T IE    L+    L+ L LS N I
Sbjct:  172 LDVSFNILRKIENLERLTQLKKLFLVHNKITGIANLEHFSFLEMLELGSNRIRVIENLDGLTSLTSLFLGTNKINKLQNLDALHNLSVLSIQSNRITKIEG---LQNLVNLKELYLSHNGI 289          

HSP 4 Score: 56.9954 bits (136), Expect = 3.484e-8
Identity = 50/123 (40.65%), Postives = 67/123 (54.47%), Query Frame = 1
Query:  439 KTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKL 807
            K EG+ F  VL+ R   K ++       F SL  + LV+  I KIE L+ L   + L L  N I+ IE LE+L  L +L LY N+I  +EN+DNL EL       N+L  IEN+  L + KKL
Sbjct:   79 KREGV-FICVLTWRT--KAVVSC----CFFSLQDVDLVHCRIGKIEGLEVLQKAKTLSLRQNLIKKIENLESLSSLRELDLYDNQIRKLENLDNLTELEQLDVSFNILRKIENLERLTQLKKL 194          
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Medaka
Match: lrrc6 (leucine rich repeat containing 6 [Source:NCBI gene;Acc:101163520])

HSP 1 Score: 63.1586 bits (152), Expect = 4.962e-10
Identity = 48/149 (32.21%), Postives = 71/149 (47.65%), Query Frame = 1
Query:  478 RLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKME 924
            +LD + I  I+  W  K L  L L NN+I +IENL  L  L++L+L+ N IEVIE LE    L  L L  N +  + ++D+L+  N+                      L+ L L GNP    + Y  ++ A  P L  LD   +++ E
Sbjct:   73 QLDIEKIEHIDR-WCSK-LVILYLQNNLIPRIENLGHLKRLQYLNLALNNIEVIENLEGCESLQKLDLMVNFVGHLSSVDSLRH-NIH---------------------LRDLCLMGNPCSRFEGYRQYVVAALPQLQCLDGTEISRSE 197          
BLAST of Dynein regulatory complex subunit 3 vs. Planmine SMEST
Match: SMESG000061668.1 (SMESG000061668.1)

HSP 1 Score: 543.888 bits (1400), Expect = 0.000e+0
Identity = 295/295 (100.00%), Postives = 295/295 (100.00%), Query Frame = 1
Query:  277 MSINPVRKYRGDDVLIDIRMKRLYNTLEPNIISNKLLTQVVYEQGPKDEAGKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQACYEKYLIRVEQYXXXXXXXXXXXXXXXXXXXSRKVHTLAFVELLDTDLLYNQMIHDDPEKEKIFSITGIEDLANSY 1161
            MSINPVRKYRGDDVLIDIRMKRLYNTLEPNIISNKLLTQVVYEQGPKDEAGKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQACYEKYLIRVEQYKEKEEEIEKKELDEKNLLESRKVHTLAFVELLDTDLLYNQMIHDDPEKEKIFSITGIEDLANSY
Sbjct:    1 MSINPVRKYRGDDVLIDIRMKRLYNTLEPNIISNKLLTQVVYEQGPKDEAGKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQACYEKYLIRVEQYKEKEEEIEKKELDEKNLLESRKVHTLAFVELLDTDLLYNQMIHDDPEKEKIFSITGIEDLANSY 295          
BLAST of Dynein regulatory complex subunit 3 vs. Planmine SMEST
Match: SMESG000061669.1 (SMESG000061669.1)

HSP 1 Score: 283.878 bits (725), Expect = 2.518e-91
Identity = 139/141 (98.58%), Postives = 141/141 (100.00%), Query Frame = 1
Query: 1156 SYLEKFMFISTELFHKGLNELEKRQRDGTLFYTCINAAKSDNNQRAIDLLEEFNIFKVEIMQEINKSAVISENDMKKLKEMTYDLWSNLMSLEVQLFDQLEETIRDYLRNLTEMIDGFLEIVHAYFAQMRELETSLNERIS 1578
            +YLEKFMFISTELFHKGLNELEKRQRDGTLFYTCINAAKSDNNQRAIDLLEEFNIFKVEIMQEINKSAVISENDMKKLKEMTYDLWSNLMSLEVQLFDQLEETIRDYLRNLTEMIDGFLEIVHAYFAQMRELETSLNERI+
Sbjct:   16 TYLEKFMFISTELFHKGLNELEKRQRDGTLFYTCINAAKSDNNQRAIDLLEEFNIFKVEIMQEINKSAVISENDMKKLKEMTYDLWSNLMSLEVQLFDQLEETIRDYLRNLTEMIDGFLEIVHAYFAQMRELETSLNERIN 156          
BLAST of Dynein regulatory complex subunit 3 vs. Planmine SMEST
Match: SMESG000061669.1 (SMESG000061669.1)

HSP 1 Score: 273.092 bits (697), Expect = 1.524e-87
Identity = 134/135 (99.26%), Postives = 135/135 (100.00%), Query Frame = 1
Query: 1174 MFISTELFHKGLNELEKRQRDGTLFYTCINAAKSDNNQRAIDLLEEFNIFKVEIMQEINKSAVISENDMKKLKEMTYDLWSNLMSLEVQLFDQLEETIRDYLRNLTEMIDGFLEIVHAYFAQMRELETSLNERIS 1578
            MFISTELFHKGLNELEKRQRDGTLFYTCINAAKSDNNQRAIDLLEEFNIFKVEIMQEINKSAVISENDMKKLKEMTYDLWSNLMSLEVQLFDQLEETIRDYLRNLTEMIDGFLEIVHAYFAQMRELETSLNERI+
Sbjct:    1 MFISTELFHKGLNELEKRQRDGTLFYTCINAAKSDNNQRAIDLLEEFNIFKVEIMQEINKSAVISENDMKKLKEMTYDLWSNLMSLEVQLFDQLEETIRDYLRNLTEMIDGFLEIVHAYFAQMRELETSLNERIN 135          
BLAST of Dynein regulatory complex subunit 3 vs. Planmine SMEST
Match: SMESG000047633.1 (SMESG000047633.1)

HSP 1 Score: 259.61 bits (662), Expect = 1.246e-81
Identity = 133/276 (48.19%), Postives = 194/276 (70.29%), Query Frame = 1
Query:  334 MKRLYNTLEPNIISNKLLTQVVYEQGPKDEAGKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQACYEKYLIRVEQYXXXXXXXXXXXXXXXXXXXSRKVHTLAFVELLDTDLLYNQMIHDDPEKEKIFSITGIEDLANSY 1161
            M RLY+T+EP++I+ ++L   VYEQGPK  AG+IAK EG++F  V SLRL +KNIL+++NLW FK+LTKLQL NNIIEKI  L+ L+ L+WLDLSFN IE+IEG+++LV + DL+L+ NRI  +EN+++LK+L V S G NL+  + N+ YLR FK L+++NLSGNP C  DE+   + A+ P L++LDYKL+ + E + C EK  IR+E  +  E+E E +  +EK  +   +++ LAFV+ LD D L+  +  DD E +++  +    + A  Y
Sbjct:    1 MSRLYDTIEPSVITEEMLRTTVYEQGPKGTAGQIAKAEGLSFEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVLSIGNNLIDDLNNLKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLDYKLINEEERKICCEKEQIRIESLQSDEKEKEIQMEEEKLKMNQEELYNLAFVDGLDKDQLFESLFSDDMEGQRLKELPKNAEHAEEY 276          
BLAST of Dynein regulatory complex subunit 3 vs. Planmine SMEST
Match: SMESG000061670.1 (SMESG000061670.1)

HSP 1 Score: 137.502 bits (345), Expect = 1.743e-38
Identity = 88/98 (89.80%), Postives = 91/98 (92.86%), Query Frame = 1
Query: 1615 GDMEEDRVTNFKKTDIFNDKDTLANCIATSHDHRVLKIDNWEDGIRIKTKSWLHETCDSIKQTXXXXXXXXXXXXXXXXXDQVRSEIENYEIPGVNIN 1908
            G++E   V+N  K  IFNDKDTLANCIATSHDHRVLKIDNWEDGIRIKTKSWLHETCDSIKQTEEYERNRNRISEINNFIDQVRSEIENYEIPGVNIN
Sbjct:    2 GNLEYKIVSNSCK--IFNDKDTLANCIATSHDHRVLKIDNWEDGIRIKTKSWLHETCDSIKQTEEYERNRNRISEINNFIDQVRSEIENYEIPGVNIN 97          
The following BLAST results are available for this feature:
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DRC35.549e-10939.47dynein regulatory complex subunit 3 [Source:HGNC S... [more]
DRC35.549e-10939.47dynein regulatory complex subunit 3 [Source:HGNC S... [more]
DRC37.013e-9739.38dynein regulatory complex subunit 3 [Source:HGNC S... [more]
DRC37.013e-9739.38dynein regulatory complex subunit 3 [Source:HGNC S... [more]
DRC35.422e-4557.25dynein regulatory complex subunit 3 [Source:HGNC S... [more]
back to top
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C06A8.65.371e-1638.36pep chromosome:WBcel235:II:7772499:7773914:1 gene:... [more]
sds-221.722e-1331.36Protein phosphatase 1 regulatory subunit SDS22 hom... [more]
K10D2.86.507e-1338.10pep chromosome:WBcel235:III:5188726:5190175:1 gene... [more]
mog-23.596e-626.72Probable U2 small nuclear ribonucleoprotein A' [S... [more]
mog-23.596e-626.72Probable U2 small nuclear ribonucleoprotein A' [S... [more]
back to top
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Ppr-Y1.971e-4626.94gene:FBgn0046697 transcript:FBtr0346721[more]
TbCMF469.062e-4528.09gene:FBgn0032163 transcript:FBtr0079898[more]
sds221.591e-1648.08gene:FBgn0028992 transcript:FBtr0083436[more]
Cep971.901e-733.07gene:FBgn0031575 transcript:FBtr0077504[more]
back to top
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
drc36.712e-11440.63dynein regulatory complex subunit 3 [Source:ZFIN;A... [more]
lrguk1.711e-1434.55leucine-rich repeats and guanylate kinase domain c... [more]
ppp1r77.963e-1435.25protein phosphatase 1, regulatory (inhibitor) subu... [more]
ppp1r71.227e-1341.82protein phosphatase 1, regulatory (inhibitor) subu... [more]
lrrc61.800e-1032.93leucine rich repeat containing 6 [Source:NCBI gene... [more]
back to top
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
drc37.137e-12243.94dynein regulatory complex subunit 3 [Source:NCBI g... [more]
drc31.190e-11242.94dynein regulatory complex subunit 3 [Source:NCBI g... [more]
CNTRL1.480e-1533.71centriolin [Source:NCBI gene;Acc:100270771][more]
CNTRL1.509e-1533.71centriolin [Source:NCBI gene;Acc:100270771][more]
CNTRL1.686e-1533.71centriolin [Source:NCBI gene;Acc:100270771][more]
back to top
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Drc32.433e-11340.69dynein regulatory complex subunit 3 [Source:MGI Sy... [more]
Drc32.651e-11340.69dynein regulatory complex subunit 3 [Source:MGI Sy... [more]
Drc37.065e-7243.84dynein regulatory complex subunit 3 [Source:MGI Sy... [more]
Drc32.232e-6649.52dynein regulatory complex subunit 3 [Source:MGI Sy... [more]
Ppp1r71.514e-1637.80protein phosphatase 1, regulatory subunit 7 [Sourc... [more]
back to top
BLAST of Dynein regulatory complex subunit 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9D5E4|DRC3_MOUSE1.702e-11240.69Dynein regulatory complex subunit 3 OS=Mus musculu... [more]
sp|Q5XI54|DRC3_RAT1.405e-10940.49Dynein regulatory complex subunit 3 OS=Rattus norv... [more]
sp|Q9H069|DRC3_HUMAN2.665e-10839.47Dynein regulatory complex subunit 3 OS=Homo sapien... [more]
sp|Q4R6X9|DRC3_MACFA4.518e-10639.64Dynein regulatory complex subunit 3 OS=Macaca fasc... [more]
sp|A8IVX2|DRC3_CHLRE6.457e-6331.91Dynein regulatory complex subunit 3 OS=Chlamydomon... [more]
back to top
BLAST of Dynein regulatory complex subunit 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210QM463.174e-13344.68Leucine-rich repeat-containing protein 48 OS=Mizuh... [more]
W4XT494.207e-13344.97Uncharacterized protein OS=Strongylocentrotus purp... [more]
A0A3S1A6307.265e-13344.83Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A4W5KJY87.007e-13143.27Dynein regulatory complex subunit 3 OS=Hucho hucho... [more]
A0A3M6TEM21.101e-13043.98Uncharacterized protein OS=Pocillopora damicornis ... [more]
back to top
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
drc36.936e-10238.03dynein regulatory complex subunit 3 [Source:ZFIN;A... [more]
drc39.649e-9034.63dynein regulatory complex subunit 3 [Source:ZFIN;A... [more]
ENSAMXT00000057771.14.283e-2251.46pep primary_assembly:Astyanax_mexicanus-2.0:24:381... [more]
ppp1r73.956e-1635.95protein phosphatase 1 regulatory subunit 7 [Source... [more]
lrrc62.719e-1032.05leucine rich repeat containing 6 [Source:NCBI gene... [more]
back to top
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007158.11.311e-3535.58pep scaffold:Pmarinus_7.0:GL477065:91521:97732:-1 ... [more]
ppp1r72.367e-1740.52protein phosphatase 1, regulatory (inhibitor) subu... [more]
LRRC491.364e-1036.80leucine rich repeat containing 49 [Source:HGNC Sym... [more]
cep978.774e-1023.59centrosomal protein 97 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
lrrc64.200e-931.16leucine rich repeat containing 6 [Source:NCBI gene... [more]
back to top
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SDS229.384e-1141.32Regulatory subunit of the type 1 protein phosphata... [more]
back to top
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO380716.231e-11842.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449376.642e-1642.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303474.383e-1335.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352994.570e-1233.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO457711.056e-1132.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynein regulatory complex subunit 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
drc33.967e-6632.14dynein regulatory complex subunit 3 [Source:NCBI g... [more]
drc32.369e-4540.79dynein regulatory complex subunit 3 [Source:NCBI g... [more]
ppp1r71.172e-1636.60protein phosphatase 1 regulatory subunit 7 [Source... [more]
ppp1r71.591e-1536.60protein phosphatase 1 regulatory subunit 7 [Source... [more]
lrrc64.962e-1032.21leucine rich repeat containing 6 [Source:NCBI gene... [more]
back to top
BLAST of Dynein regulatory complex subunit 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000061668.10.000e+0100.00SMESG000061668.1[more]
SMESG000061669.12.518e-9198.58SMESG000061669.1[more]
SMESG000061669.11.524e-8799.26SMESG000061669.1[more]
SMESG000047633.11.246e-8148.19SMESG000047633.1[more]
SMESG000061670.11.743e-3889.80SMESG000061670.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022728 ID=SMED30022728|Name=Dynein regulatory complex subunit 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1914bp
TTCCGATCTGTTAGATTTCGCATAGTCGGATTACCGATATCTTTTATTGT
TGTGAAAATATGGAAATACTGTCAGATCTAAATAACGGTTGGACTCTCGA
GGCATTTCGATAAGCATTCTGTATTTATTTTAATGGATGCGGCCCTTGGA
ATTGTTAAGGATGGATAGCTTTGGACTACACAATTAATAATATTATCAAA
TTATAATCAAATCAATATCTAAAATATTAAAGTTAAAAGTCAAATTAATT
TTACCCCTTGAATAAATATCTCAAAAATGTCAATAAATCCGGTAAGAAAA
TATCGCGGCGATGACGTCCTAATTGATATTCGTATGAAACGTTTGTATAA
CACACTTGAGCCGAATATTATTAGCAATAAACTATTAACCCAAGTTGTTT
ATGAGCAAGGACCAAAGGATGAAGCAGGAAAGATTGCAAAAACGGAAGGT
ATAGCTTTCTCTACTGTTCTTTCTTTGCGATTAGATTTTAAAAATATTTT
AAAAATTAATAATTTATGGGCTTTTAAATCCTTAACAAAGTTACAGCTGG
TCAACAACATCATCGAAAAGATTGAAAATCTTGATCGATTAGTTCATTTA
GAATGGCTAGATCTATCTTTTAACAAAATAGAAGTGATAGAAGGGTTAGA
GAATTTGGTCAAATTAACCGATTTGAGCTTATATTGCAATCGGATAAATG
TCATTGAAAATATGGACAATTTGAAAGAGTTAAATGTTTTTTCTTTTGGT
AAAAATTTACTTACAAGTATCGAAAATGTTCTCTACTTAAGAAAATTCAA
AAAACTTCAATCCTTAAATTTATCCGGTAATCCTATTTGCCATTCTGATG
AATATTTTAGTTTTATTTTTGCATTTTTTCCTAATTTGATGTTTCTCGAT
TATAAACTGGTTACAAAAATGGAACACCAAGCATGCTATGAAAAATATTT
AATTAGAGTTGAACAATACAAAGAAAAAGAGGAGGAAATAGAGAAAAAAG
AACTTGACGAAAAGAATTTGTTAGAATCTAGAAAGGTTCATACGTTGGCT
TTTGTTGAATTGCTCGATACTGATTTATTATATAATCAAATGATTCACGA
TGATCCAGAAAAGGAGAAAATATTTTCAATAACTGGAATAGAGGATTTGG
CGAATTCATATCTGGAAAAGTTTATGTTCATCAGCACTGAACTTTTTCAC
AAAGGTCTAAACGAATTAGAAAAACGACAAAGAGATGGAACTTTGTTCTA
CACTTGTATCAATGCAGCGAAAAGTGATAATAACCAAAGAGCAATTGATT
TATTGGAAGAATTTAATATTTTTAAAGTTGAAATAATGCAAGAAATCAAT
AAGTCGGCTGTTATTAGTGAAAACGATATGAAAAAATTAAAGGAAATGAC
TTATGATTTATGGAGTAATTTAATGTCTTTGGAGGTTCAGTTATTTGATC
AACTGGAAGAAACGATTCGTGATTATTTGAGAAATCTAACAGAAATGATT
GATGGATTTTTGGAAATTGTTCATGCTTACTTTGCTCAAATGAGAGAACT
TGAAACATCCCTTAACGAGCGAATTAGTGAGTCAGCTGTAATTGTATACG
ACAAAATAATAAAAGGAGATATGGAGGAAGATCGAGTTACTAATTTTAAA
AAAACAGATATCTTCAACGACAAAGACACCCTTGCCAACTGTATTGCTAC
GTCCCATGATCACCGGGTATTGAAAATTGACAATTGGGAAGATGGCATTA
GAATTAAAACGAAGAGCTGGTTGCATGAAACATGCGATAGCATTAAGCAG
ACGGAAGAATATGAAAGAAATCGAAATCGAATTTCTGAAATAAATAATTT
TATTGATCAAGTTAGAAGTGAAATTGAAAATTATGAAATTCCCGGAGTAA
ATATCAATTAGGCG
back to top

protein sequence of SMED30022728-orf-1

>SMED30022728-orf-1 ID=SMED30022728-orf-1|Name=SMED30022728-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=545bp
MSINPVRKYRGDDVLIDIRMKRLYNTLEPNIISNKLLTQVVYEQGPKDEA
GKIAKTEGIAFSTVLSLRLDFKNILKINNLWAFKSLTKLQLVNNIIEKIE
NLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIENMDNLK
ELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAF
FPNLMFLDYKLVTKMEHQACYEKYLIRVEQYKEKEEEIEKKELDEKNLLE
SRKVHTLAFVELLDTDLLYNQMIHDDPEKEKIFSITGIEDLANSYLEKFM
FISTELFHKGLNELEKRQRDGTLFYTCINAAKSDNNQRAIDLLEEFNIFK
VEIMQEINKSAVISENDMKKLKEMTYDLWSNLMSLEVQLFDQLEETIRDY
LRNLTEMIDGFLEIVHAYFAQMRELETSLNERISESAVIVYDKIIKGDME
EDRVTNFKKTDIFNDKDTLANCIATSHDHRVLKIDNWEDGIRIKTKSWLH
ETCDSIKQTEEYERNRNRISEINNFIDQVRSEIENYEIPGVNIN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR032675LRR_dom_sf
IPR001611Leu-rich_rpt
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005930axoneme
GO:0042995cell projection
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 354..374
NoneNo IPR availableCOILSCoilCoilcoord: 221..251
NoneNo IPR availableSMARTSM00365LRR_sd22_2coord: 149..170
e-value: 19.0
score: 13.3
coord: 105..126
e-value: 0.002
score: 27.4
coord: 83..104
e-value: 0.59
score: 19.2
coord: 127..148
e-value: 0.19
score: 20.8
coord: 174..196
e-value: 470.0
score: 1.9
NoneNo IPR availablePFAMPF14580LRR_9coord: 89..224
e-value: 1.0E-11
score: 44.6
NoneNo IPR availablePANTHERPTHR45973:SF12DYNEIN REGULATORY COMPLEX SUBUNIT 3coord: 20..539
NoneNo IPR availablePANTHERPTHR45973FAMILY NOT NAMEDcoord: 20..539
NoneNo IPR availableSUPERFAMILYSSF52075Outer arm dynein light chain 1coord: 62..220
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 52..222
e-value: 2.6E-33
score: 116.5
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 107..128
score: 9.645
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 176..197
score: 6.518
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 129..150
score: 7.874
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 151..172
score: 5.848
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 85..106
score: 8.459