dual specificity protein phosphatase 12

Overview
Namedual specificity protein phosphatase 12
Smed IDSMED30022703
Length (bp)1254
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of dual specificity protein phosphatase 12 (SMED30022703) t-SNE clustered cells

Violin plots show distribution of expression levels for dual specificity protein phosphatase 12 (SMED30022703) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of dual specificity protein phosphatase 12 (SMED30022703) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for dual specificity protein phosphatase 12 (SMED30022703) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022703

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30022703h1SMcG0019620 Contig1758GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30022703h1SMcG0019620 Contig1758GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30022703h1SMcG0019620 Contig1758GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
head regionSMED30022703h1SMcG0019620 OX_Smed_1.0.02479ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Human
Match: DUSP12 (dual specificity phosphatase 12 [Source:HGNC Symbol;Acc:HGNC:3067])

HSP 1 Score: 152.91 bits (385), Expect = 3.955e-42
Identity = 102/297 (34.34%), Postives = 151/297 (50.84%), Query Frame = 1
Query:   79 NLWLGSYEDASNVDLLKSLQIKYILTV-MDSPLLHK---MEDFNYKFIKAYDVPNQDLISYFDETSEFIENGRKFG-GVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIK-EKSFICPNDGFMKQLKIYFNMKCTGDYKSDEYKQFIRLFSPDDINKCTNTVSQAQF-----NLSKSSTDLIQFKCKKCRFLLFDNSSVVEHSKMK-----ASKTITENTICNE-------EIFIEALPWIDSS--SANGGKVNCPKCACKLGSYTWVGERCVCGNWVVPAFHIAKQKVDPVK 894
             L+ G     +  D L+   I  +LTV  + P       +ED    F+ A D P  DL+S+ D    FI   R  G  VL+HC AG+SRS  I+TA++MK  ++    A EK++  K     N+GF  QLK+Y  M    D  S  YKQ+ RL    +       + Q  F      +S+   D + +KC+KCR  LF +SS+++H +       A K +T +++            FIE + W++S+      G++ CPKC+ KLGS+ W GE+C CG W+ PAF I K +VD +K
Sbjct:   33 GLYFGGAAAVAEPDHLREAGITAVLTVDSEEPSFKAGPGVEDLWRLFVPALDKPETDLLSHLDRCVAFIGQARAEGRAVLVHCHAGVSRSVAIITAFLMKTDQLPFEKAYEKLQILKPEAKMNEGFEWQLKLYQAMGYEVDTSSAIYKQY-RLQKVTEKYPELQNLPQELFAVDPTTVSQGLKDEVLYKCRKCRRSLFRSSSILDHREGSGPIAFAHKRMTPSSMLTTGRQAQCTSYFIEPVQWMESALLGVMDGQLLCPKCSAKLGSFNWYGEQCSCGRWITPAFQIHKNRVDEMK 328          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Human
Match: DUSP19 (dual specificity phosphatase 19 [Source:HGNC Symbol;Acc:HGNC:18894])

HSP 1 Score: 92.4337 bits (228), Expect = 5.192e-21
Identity = 51/128 (39.84%), Postives = 73/128 (57.03%), Query Frame = 1
Query:   82 LWLGSYEDASNVDLLKSLQIKYILTVMDSPLLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENG-RKFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIK-EKSFICPNDGFMKQLKIY 459
            L LGS + A ++D LK  ++ +IL V        + DF YK I   D+P  +++SYF E  EFIE   RK G VL+HC AG+SR+  I+  ++M   +     A   +K  +  ICPN GFM+QL+ Y
Sbjct:   73 LLLGSQDAAHDLDTLKKNKVTHILNVAYGVENAFLSDFTYKSISILDLPETNILSYFPECFEFIEEAKRKDGVVLVHCNAGVSRAAAIVIGFLMNSEQTSFTSAFSLVKNARPSICPNSGFMEQLRTY 200          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Human
Match: DUSP6 (dual specificity phosphatase 6 [Source:HGNC Symbol;Acc:HGNC:3072])

HSP 1 Score: 91.2781 bits (225), Expect = 2.912e-20
Identity = 57/127 (44.88%), Postives = 78/127 (61.42%), Query Frame = 1
Query:   82 LWLGSYEDASNVDLLKSLQIKYILTVMDS-P-LLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGR-KFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIK-EKSFICPNDGFMKQL 450
            L+LG  +D++N+D+L+   IKYIL V  + P L     +F YK I   D  +Q+L  +F E   FI+  R K  GVL+HCLAGISRS T+  AY+M+   +  NDA + +K +KS I PN  FM QL
Sbjct:   89 LYLGCAKDSTNLDVLEEFGIKYILNVTPNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQL 215          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Human
Match: DUSP9 (dual specificity phosphatase 9 [Source:HGNC Symbol;Acc:HGNC:3076])

HSP 1 Score: 92.8189 bits (229), Expect = 4.851e-20
Identity = 57/128 (44.53%), Postives = 78/128 (60.94%), Query Frame = 1
Query:   79 NLWLGSYEDASNVDLLKSLQIKYILTVMDS-P-LLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGRKFG-GVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIK-EKSFICPNDGFMKQL 450
            NL+LGS  D++N++ L  L I+YIL V  + P    K  DF+YK I   D  +Q+L  +F E  EFI+       GVL+HCLAG+SRS T+  AY+M+   +  NDA + +K +KS I PN  FM QL
Sbjct:  210 NLYLGSARDSANLESLAKLGIRYILNVTPNLPNFFEKNGDFHYKQIPISDHWSQNLSRFFPEAIEFIDEALSQNCGVLVHCLAGVSRSVTVTVAYLMQKLHLSLNDAYDLVKRKKSNISPNFNFMGQL 337          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Human
Match: DUSP9 (dual specificity phosphatase 9 [Source:HGNC Symbol;Acc:HGNC:3076])

HSP 1 Score: 92.8189 bits (229), Expect = 4.851e-20
Identity = 57/128 (44.53%), Postives = 78/128 (60.94%), Query Frame = 1
Query:   79 NLWLGSYEDASNVDLLKSLQIKYILTVMDS-P-LLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGRKFG-GVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIK-EKSFICPNDGFMKQL 450
            NL+LGS  D++N++ L  L I+YIL V  + P    K  DF+YK I   D  +Q+L  +F E  EFI+       GVL+HCLAG+SRS T+  AY+M+   +  NDA + +K +KS I PN  FM QL
Sbjct:  210 NLYLGSARDSANLESLAKLGIRYILNVTPNLPNFFEKNGDFHYKQIPISDHWSQNLSRFFPEAIEFIDEALSQNCGVLVHCLAGVSRSVTVTVAYLMQKLHLSLNDAYDLVKRKKSNISPNFNFMGQL 337          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Celegans
Match: Y54F10BM.13 (pep chromosome:WBcel235:III:2329577:2331183:-1 gene:WBGene00021867.1 transcript:Y54F10BM.13.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y54F10BM.13)

HSP 1 Score: 89.3521 bits (220), Expect = 3.020e-20
Identity = 51/128 (39.84%), Postives = 76/128 (59.38%), Query Frame = 1
Query:   79 NLWLGSYEDASNVDLLKSLQIKYILTVMDSPLLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGRKFGG-VLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKEKSFICPNDGFMKQLKIY 459
            +L  GS + A+++ +L++ +I +I+ V      H  + F Y  I   D+P   +I YF+   EFI+  R+  G V IHC AGISRS T + AY+MK+ KI   +A++K +E   I PN GF +QLK Y
Sbjct:   89 DLLFGSQDVAADLPILENRKITHIVNVGTGIPNHFPKKFEYLQIDILDLPETRIIDYFERVFEFIDKVRQNEGIVFIHCNAGISRSATFVVAYLMKNLKISCREAMDKCRETRSIRPNTGFAQQLKEY 216          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Celegans
Match: C24F3.2 (pep chromosome:WBcel235:IV:10222472:10223745:1 gene:WBGene00007697.1 transcript:C24F3.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C24F3.2)

HSP 1 Score: 82.4185 bits (202), Expect = 1.722e-17
Identity = 69/259 (26.64%), Postives = 130/259 (50.19%), Query Frame = 1
Query:  139 IKYILTVMDSPLL--HKMEDFNYKFIKAYDVPNQDLI--SYFDETSEFIENG-RKFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKE-KSFICPNDGFMKQLKIYFNMKCTGDYKSDEYKQFIRLFSPDDINKCTNTVSQAQFNLSKSSTDLIQFKCKKCRFLLFDNSSVVEHSKMKASKTITENTICNEEIFIEALPWIDSSSANGGKVNCPKCACKLGSYTWVGERC-VCGNWVVPAFHIAKQKVDPVK 894
            IK +LT+   P+    K+   +YKF+   D+P++ ++  +  +    +I  G  K   V +HCLA +SRS +I  AY+M   +     A++ I+  +  I PN GF+ QLKI+   +    + +D+YK  +++  P     C ++ +  +  +    T  ++FKC++CR ++F++ ++V H   +A           ++  IE + W++ S A     +   C  KLG++   G +C  C  +V     I + K+D V+
Sbjct:   30 IKRVLTLTTEPISEKQKIGGVDYKFLHLLDMPDEPILDNAILETAVLYINEGVEKEENVGVHCLAAVSRSVSICAAYLMYKNQWPVEKALKMIESVRKTIGPNAGFLAQLKIW--ERSGMSFSADQYKN-LKIDIPGI--TCVDSKTIWRQPVIDDQTK-VRFKCRQCRKVIFNSDNIV-HPLAEAC----------QKYLIEPMAWLNVSGATCSVSH--TCGAKLGTFIASGSKCNGCNKFVRQWIFINRTKLDKVE 269          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Celegans
Match: vhp-1 (Tyrosine-protein phosphatase vhp-1 [Source:UniProtKB/Swiss-Prot;Acc:Q10038])

HSP 1 Score: 77.7962 bits (190), Expect = 3.190e-15
Identity = 52/134 (38.81%), Postives = 75/134 (55.97%), Query Frame = 1
Query:   79 NLWLGSYEDASNVDLLKSLQIKYILTV-MDSP-LLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGRKFGG-VLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKE-KSFICPNDGFMKQLKIYFNM 468
            N++LGS  D+ +  +L +L I  ++ + M  P  +   ED N+  I   D   + L  YF    EF+E  R+ G   LIHCLAGISRS T+  +YIM++ K+  +DA   +KE +  I PN  FM QL  Y N+
Sbjct:  111 NIYLGSQIDSLDETMLDALDISVVINLSMTCPKSVCIKEDKNFMRIPVNDSYQEKLSPYFPMAYEFLEKCRRAGKKCLIHCLAGISRSPTLAISYIMRYMKMGSDDAYRYVKERRPSISPNFNFMGQLLEYENV 244          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Celegans
Match: vhp-1 (Tyrosine-protein phosphatase vhp-1 [Source:UniProtKB/Swiss-Prot;Acc:Q10038])

HSP 1 Score: 77.7962 bits (190), Expect = 3.190e-15
Identity = 52/134 (38.81%), Postives = 75/134 (55.97%), Query Frame = 1
Query:   79 NLWLGSYEDASNVDLLKSLQIKYILTV-MDSP-LLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGRKFGG-VLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKE-KSFICPNDGFMKQLKIYFNM 468
            N++LGS  D+ +  +L +L I  ++ + M  P  +   ED N+  I   D   + L  YF    EF+E  R+ G   LIHCLAGISRS T+  +YIM++ K+  +DA   +KE +  I PN  FM QL  Y N+
Sbjct:  111 NIYLGSQIDSLDETMLDALDISVVINLSMTCPKSVCIKEDKNFMRIPVNDSYQEKLSPYFPMAYEFLEKCRRAGKKCLIHCLAGISRSPTLAISYIMRYMKMGSDDAYRYVKERRPSISPNFNFMGQLLEYENV 244          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Celegans
Match: vhp-1 (Tyrosine-protein phosphatase vhp-1 [Source:UniProtKB/Swiss-Prot;Acc:Q10038])

HSP 1 Score: 77.7962 bits (190), Expect = 3.431e-15
Identity = 52/134 (38.81%), Postives = 75/134 (55.97%), Query Frame = 1
Query:   79 NLWLGSYEDASNVDLLKSLQIKYILTV-MDSP-LLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGRKFGG-VLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKE-KSFICPNDGFMKQLKIYFNM 468
            N++LGS  D+ +  +L +L I  ++ + M  P  +   ED N+  I   D   + L  YF    EF+E  R+ G   LIHCLAGISRS T+  +YIM++ K+  +DA   +KE +  I PN  FM QL  Y N+
Sbjct:  186 NIYLGSQIDSLDETMLDALDISVVINLSMTCPKSVCIKEDKNFMRIPVNDSYQEKLSPYFPMAYEFLEKCRRAGKKCLIHCLAGISRSPTLAISYIMRYMKMGSDDAYRYVKERRPSISPNFNFMGQLLEYENV 319          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Fly
Match: MKP-4 (gene:FBgn0031044 transcript:FBtr0074741)

HSP 1 Score: 123.635 bits (309), Expect = 3.220e-31
Identity = 89/337 (26.41%), Postives = 167/337 (49.55%), Query Frame = 1
Query:   76 SNLWLGSYEDASNVDLLKSLQIKYILTVMDSPLLHKMEDFNY---KFIKAYDVPNQDLISYFDETSEFIENG-RKFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKEK-SFICPNDGFMKQLKIYFNMKCTGDYKSDEYKQFIRLFSPDDINKCT------NTVSQAQFNLSKSSTDLIQFKCKKCRFLLFDNSSVVEH--------------------SKMKA------------------SKTITENTI-----------CNEEIFIEALPWIDSSSANG-GKVNCPKCACKLGSYTWVGE-RCVCGNWVVPAFHIAKQKVDPVKSM 900
            + L+LG+   A++++ L+S +I +ILT+   PL   + + ++   K+I+  D+P +D++ + +   +FI +   + G VL+HC  G+SRS + + AY+MK   +D   A E +K K  F+ PN GF+ QLK++  M C  D     YK      + + + K        ++V +   ++++ + + I F+C++CR +L   S V+EH                    +K+ A                  S+ I ++++           C   +F+E + W+     N  G++ CPKC  KLG+++W+   +C CG  + PAF++   KV+  K++
Sbjct:   44 TGLFLGNLTAATHMETLRSFKITHILTLDSVPLPQHILEASFLTTKYIQIADMPREDILQHLEGCVDFISSALAQQGNVLVHCYFGVSRSSSTVIAYMMKRHNLDFLPAYELVKAKRRFVQPNAGFVSQLKLFRRMGCKIDPNCQRYKIHRLRLAGEQMRKAKILPQSFHSVVRPDPDITRENPEPIVFRCRRCRRVLASKSHVLEHKPRDRPPQEVVPKEKEEVAAAKLPAQSHDQAENHHGARMLEQLSERIRQSSLGSPGHESTPNYCRSILFVEPIAWMHRIMLNTQGRLYCPKCEQKLGNFSWINACKCPCGETMTPAFYLIPSKVELSKAV 380          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Fly
Match: MKP-4 (gene:FBgn0031044 transcript:FBtr0332481)

HSP 1 Score: 123.635 bits (309), Expect = 3.220e-31
Identity = 89/337 (26.41%), Postives = 167/337 (49.55%), Query Frame = 1
Query:   76 SNLWLGSYEDASNVDLLKSLQIKYILTVMDSPLLHKMEDFNY---KFIKAYDVPNQDLISYFDETSEFIENG-RKFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKEK-SFICPNDGFMKQLKIYFNMKCTGDYKSDEYKQFIRLFSPDDINKCT------NTVSQAQFNLSKSSTDLIQFKCKKCRFLLFDNSSVVEH--------------------SKMKA------------------SKTITENTI-----------CNEEIFIEALPWIDSSSANG-GKVNCPKCACKLGSYTWVGE-RCVCGNWVVPAFHIAKQKVDPVKSM 900
            + L+LG+   A++++ L+S +I +ILT+   PL   + + ++   K+I+  D+P +D++ + +   +FI +   + G VL+HC  G+SRS + + AY+MK   +D   A E +K K  F+ PN GF+ QLK++  M C  D     YK      + + + K        ++V +   ++++ + + I F+C++CR +L   S V+EH                    +K+ A                  S+ I ++++           C   +F+E + W+     N  G++ CPKC  KLG+++W+   +C CG  + PAF++   KV+  K++
Sbjct:   44 TGLFLGNLTAATHMETLRSFKITHILTLDSVPLPQHILEASFLTTKYIQIADMPREDILQHLEGCVDFISSALAQQGNVLVHCYFGVSRSSSTVIAYMMKRHNLDFLPAYELVKAKRRFVQPNAGFVSQLKLFRRMGCKIDPNCQRYKIHRLRLAGEQMRKAKILPQSFHSVVRPDPDITRENPEPIVFRCRRCRRVLASKSHVLEHKPRDRPPQEVVPKEKEEVAAAKLPAQSHDQAENHHGARMLEQLSERIRQSSLGSPGHESTPNYCRSILFVEPIAWMHRIMLNTQGRLYCPKCEQKLGNFSWINACKCPCGETMTPAFYLIPSKVELSKAV 380          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Fly
Match: CG10089 (gene:FBgn0036369 transcript:FBtr0075823)

HSP 1 Score: 86.2705 bits (212), Expect = 2.190e-18
Identity = 47/134 (35.07%), Postives = 79/134 (58.96%), Query Frame = 1
Query:   82 LWLGSYEDASNVDLLKSLQIKYILTVMDSPLLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGR-KFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKE-KSFICPNDGFMKQLKIYFNMKCT 477
            L++G+Y D+ +   L+  +I +I+ + DSP    + D +Y  + A D P+Q+L  YF   ++FI   R + G VLIHCLAG+SRS T+  AYIM    ++  +A++ ++  ++   PN GF  QL+ +   K +
Sbjct:   12 LYVGNYRDSKDHAQLERFKISHIIAIHDSPR-RLLPDKHYLCVMASDTPDQNLSQYFSVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQSQLQEFEQFKLS 144          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Fly
Match: CG10089 (gene:FBgn0036369 transcript:FBtr0075821)

HSP 1 Score: 85.8853 bits (211), Expect = 2.501e-18
Identity = 47/134 (35.07%), Postives = 79/134 (58.96%), Query Frame = 1
Query:   82 LWLGSYEDASNVDLLKSLQIKYILTVMDSPLLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGR-KFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKE-KSFICPNDGFMKQLKIYFNMKCT 477
            L++G+Y D+ +   L+  +I +I+ + DSP    + D +Y  + A D P+Q+L  YF   ++FI   R + G VLIHCLAG+SRS T+  AYIM    ++  +A++ ++  ++   PN GF  QL+ +   K +
Sbjct:   12 LYVGNYRDSKDHAQLERFKISHIIAIHDSPR-RLLPDKHYLCVMASDTPDQNLSQYFSVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQSQLQEFEQFKLS 144          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Fly
Match: CG10089 (gene:FBgn0036369 transcript:FBtr0075822)

HSP 1 Score: 85.8853 bits (211), Expect = 2.501e-18
Identity = 47/134 (35.07%), Postives = 79/134 (58.96%), Query Frame = 1
Query:   82 LWLGSYEDASNVDLLKSLQIKYILTVMDSPLLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGR-KFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKE-KSFICPNDGFMKQLKIYFNMKCT 477
            L++G+Y D+ +   L+  +I +I+ + DSP    + D +Y  + A D P+Q+L  YF   ++FI   R + G VLIHCLAG+SRS T+  AYIM    ++  +A++ ++  ++   PN GF  QL+ +   K +
Sbjct:   12 LYVGNYRDSKDHAQLERFKISHIIAIHDSPR-RLLPDKHYLCVMASDTPDQNLSQYFSVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQSQLQEFEQFKLS 144          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Zebrafish
Match: dusp12 (dual specificity phosphatase 12 [Source:ZFIN;Acc:ZDB-GENE-050626-91])

HSP 1 Score: 157.918 bits (398), Expect = 1.550e-44
Identity = 104/302 (34.44%), Postives = 156/302 (51.66%), Query Frame = 1
Query:   76 SNLWLGSYEDASNVDLLKSLQIKYILTVMDSPLLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENG------RKFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKE-KSFICPNDGFMKQLKIYFNMKCTGDYKSDEYKQFIRLFSPDDINKCTNTVSQAQFNLSKSSTDLIQ--FKCKKCRFLLFDNSSVVEH------SKMKASKTITENTICNEEI-----FIEALPWIDSS--SANGGKVNCPKCACKLGSYTWVGERCVCGNWVVPAFHIAKQKVDPVKSMSF*SL 915
            S L++GS  D  + + L +  I +ILTV DS     +  FN KFI+A D  + DL+S  D+ + FI          K   VL+HC  G SRS  ++TAY+MK   +   +A  K++  K  +  N+ F+ QL +Y  M C  D  S  YKQF RL    +       V +  F +  + T   +  ++C+KCR  LF +SS++ H      S     KT   ++   +E      FIE + W++ +      G++ CPKC+ KLGS+ W GE+C CG WV PAF + K +VD +K +S  +L
Sbjct:    6 SGLYIGSVSDLKDAESLSAAGITHILTV-DSEEA-SVTGFNTKFIRALDDESTDLLSRLDDCTSFISEALSTQADSKSAAVLVHCHVGQSRSAAVVTAYLMKTQHLTLQEAYSKLQNIKPDVKMNEEFLDQLALYELMDCKVDTTSPVYKQF-RLKKITEKYPELQNVPKDVFAVDPAQTQNAEAVYRCRKCRRTLFRHSSILSHCVGSGASAFSHKKTRIVSSSAEDETQCTSYFIEPVQWMEQALLGVMDGQLLCPKCSSKLGSFNWYGEQCSCGRWVTPAFQMHKNRVDEIKHISISAL 304          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Zebrafish
Match: dusp12 (dual specificity phosphatase 12 [Source:ZFIN;Acc:ZDB-GENE-050626-91])

HSP 1 Score: 157.918 bits (398), Expect = 1.550e-44
Identity = 104/302 (34.44%), Postives = 156/302 (51.66%), Query Frame = 1
Query:   76 SNLWLGSYEDASNVDLLKSLQIKYILTVMDSPLLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENG------RKFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKE-KSFICPNDGFMKQLKIYFNMKCTGDYKSDEYKQFIRLFSPDDINKCTNTVSQAQFNLSKSSTDLIQ--FKCKKCRFLLFDNSSVVEH------SKMKASKTITENTICNEEI-----FIEALPWIDSS--SANGGKVNCPKCACKLGSYTWVGERCVCGNWVVPAFHIAKQKVDPVKSMSF*SL 915
            S L++GS  D  + + L +  I +ILTV DS     +  FN KFI+A D  + DL+S  D+ + FI          K   VL+HC  G SRS  ++TAY+MK   +   +A  K++  K  +  N+ F+ QL +Y  M C  D  S  YKQF RL    +       V +  F +  + T   +  ++C+KCR  LF +SS++ H      S     KT   ++   +E      FIE + W++ +      G++ CPKC+ KLGS+ W GE+C CG WV PAF + K +VD +K +S  +L
Sbjct:    6 SGLYIGSVSDLKDAESLSAAGITHILTV-DSEEA-SVTGFNTKFIRALDDESTDLLSRLDDCTSFISEALSTQADSKSAAVLVHCHVGQSRSAAVVTAYLMKTQHLTLQEAYSKLQNIKPDVKMNEEFLDQLALYELMDCKVDTTSPVYKQF-RLKKITEKYPELQNVPKDVFAVDPAQTQNAEAVYRCRKCRRTLFRHSSILSHCVGSGASAFSHKKTRIVSSSAEDETQCTSYFIEPVQWMEQALLGVMDGQLLCPKCSSKLGSFNWYGEQCSCGRWVTPAFQMHKNRVDEIKHISISAL 304          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Zebrafish
Match: dusp12 (dual specificity phosphatase 12 [Source:ZFIN;Acc:ZDB-GENE-050626-91])

HSP 1 Score: 148.673 bits (374), Expect = 2.731e-41
Identity = 99/288 (34.38%), Postives = 147/288 (51.04%), Query Frame = 1
Query:   76 SNLWLGSYEDASNVDLLKSLQIKYILTVMDSPLLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENG------RKFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKE-KSFICPNDGFMKQLKIYFNMKCTGDYKSDEYKQFIRLFSPDDINKCTNTVSQAQFNLSKSSTDLIQ--FKCKKCRFLLFDNSSVVEH------SKMKASKTITENTICNEEI-----FIEALPWIDSS--SANGGKVNCPKCACKLGSYTWVGERCVCGNWVVPAFHIAK 873
            S L++GS  D  + + L +  I +ILTV DS     +  FN KFI+A D  + DL+S  D+ + FI          K   VL+HC  G SRS  ++TAY+MK   +   +A  K++  K  +  N+ F+ QL +Y  M C  D  S  YKQF RL    +       V +  F +  + T   +  ++C+KCR  LF +SS++ H      S     KT   ++   +E      FIE + W++ +      G++ CPKC+ KLGS+ W GE+C CG WV PAF + K
Sbjct:    6 SGLYIGSVSDLKDAESLSAAGITHILTV-DSEEA-SVTGFNTKFIRALDDESTDLLSRLDDCTSFISEALSTQADSKSAAVLVHCHVGQSRSAAVVTAYLMKTQHLTLQEAYSKLQNIKPDVKMNEEFLDQLALYELMDCKVDTTSPVYKQF-RLKKITEKYPELQNVPKDVFAVDPAQTQNAEAVYRCRKCRRTLFRHSSILSHCVGSGASAFSHKKTRIVSSSAEDETQCTSYFIEPVQWMEQALLGVMDGQLLCPKCSSKLGSFNWYGEQCSCGRWVTPAFQMHK 290          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Zebrafish
Match: dusp12 (dual specificity phosphatase 12 [Source:ZFIN;Acc:ZDB-GENE-050626-91])

HSP 1 Score: 89.7373 bits (221), Expect = 3.800e-20
Identity = 66/212 (31.13%), Postives = 102/212 (48.11%), Query Frame = 1
Query:  235 DLISYFDETSEFIENG------RKFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKE-KSFICPNDGFMKQLKIYFNMKCTGDYKSDEYKQFIRLFSPDDINKCTNTVSQAQFNLSKSSTDLIQ--FKCKKCRFLLFDNSSVVEH------SKMKASKTITENTICNEEI-----FIEALPWIDSS--SANGGKVNCPKCACKLG 804
            DL+S  D+ + FI          K   VL+HC  G SRS  ++TAY+MK   +   +A  K++  K  +  N+ F+ QL +Y  M C  D  S  YKQF RL    +       V +  F +  + T   +  ++C+KCR  LF +SS++ H      S     KT   ++   +E      FIE + W++ +      G++ CPKC+ KLG
Sbjct:   26 DLLSRLDDCTSFISEALSTQADSKSAAVLVHCHVGQSRSAAVVTAYLMKTQHLTLQEAYSKLQNIKPDVKMNEEFLDQLALYELMDCKVDTTSPVYKQF-RLKKITEKYPELQNVPKDVFAVDPAQTQNAEAVYRCRKCRRTLFRHSSILSHCVGSGASAFSHKKTRIVSSSAEDETQCTSYFIEPVQWMEQALLGVMDGQLLCPKCSSKLG 236          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Zebrafish
Match: dusp6 (dual specificity phosphatase 6 [Source:ZFIN;Acc:ZDB-GENE-030613-1])

HSP 1 Score: 91.2781 bits (225), Expect = 8.727e-20
Identity = 57/130 (43.85%), Postives = 79/130 (60.77%), Query Frame = 1
Query:   79 NLWLGSYEDASNVDLLKSLQIKYILTVMDSPLLHKM----EDFNYKFIKAYDVPNQDLISYFDETSEFIENGRKFG-GVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIK-EKSFICPNDGFMKQL 450
            +L+LG  +D++N+D+L+   IKYIL V  +P L  M     +F YK I   D  +Q+L  +F E   FI+  R    GVL+HCLAGISRS T+  AY+M+   +  NDA + +K +KS I PN  FM QL
Sbjct:  212 HLYLGCAKDSTNLDILEEFGIKYILNV--TPNLPNMFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGLKCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQL 339          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Xenopus
Match: fcn3 (ficolin 3 [Source:Xenbase;Acc:XB-GENE-6054553])

HSP 1 Score: 154.451 bits (389), Expect = 4.235e-43
Identity = 96/292 (32.88%), Postives = 153/292 (52.40%), Query Frame = 1
Query:   79 NLWLGSYEDASNVDLLKSLQIKYILTVMDSPLLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIEN--GRKFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKE-KSFICPNDGFMKQLKIYFNMKCTGDYKSDEYKQFIRLFSPDDINKCTNTVSQAQFN---LSKSSTDLIQFKCKKCRFLLFDNSSVVEHS----------KMKASKTITENTICNEEIFIEALPWIDSS--SANGGKVNCPKCACKLGSYTWVGERCVCGNWVVPAFHIAKQKVDPVKSM 900
             L+LGS  DA+++  L+   I ++LTV DS +   ++ F  KF+   D  +QDL+S     ++F++   G+    VL+HC AG+SRS  ++ AY+M    +   DA  +++  KS I  N+ F+ QL +Y  M C  D     YKQ+ RL    +       + Q  F     S + T  + ++C+KCR  LF  +S++ H+          K   S    ++T C    F+E + W++ +      G++ CPKC+ KLGS+ W G +C CG WV PAF I K +VD  K++
Sbjct:    7 GLYLGSASDAADLQRLQEAGITHVLTV-DSEVPTGLDGFITKFVHILDDASQDLLSCLPACTDFLKEALGKCGRSVLVHCHAGVSRSAAVIAAYLMHTSNLSLEDACSRLQALKSDIRMNEEFLGQLSLYETMGCDVDMTCASYKQY-RLQKVTEKYPELLKLPQEVFASDPCSMAQTAEVLYRCRKCRRSLFRETSILNHALGTGAAAFAHKRPPSLQKVDSTKCTS-YFVEPVQWMEEALLGVMDGQLLCPKCSSKLGSFNWYGVQCSCGRWVTPAFQIHKNRVDEAKTL 295          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Xenopus
Match: npc1l1 (NPC1 like 1 [Source:Xenbase;Acc:XB-GENE-964011])

HSP 1 Score: 94.3597 bits (233), Expect = 2.141e-20
Identity = 53/127 (41.73%), Postives = 78/127 (61.42%), Query Frame = 1
Query:   82 LWLGSYEDASNVDLLKSLQIKYILTVMDS-PLLHKMED-FNYKFIKAYDVPNQDLISYFDETSEFIENGRKFG-GVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIK-EKSFICPNDGFMKQL 450
            L+LG+  DA +++ +++  I YI+ V    PL H  +  FNYK + A D   Q+L  YF+E  EFI+   + G  +LIHC AG+SRS TI+ AY+MKH ++   DA + +K ++  I PN  FM QL
Sbjct:  311 LYLGNEHDAQDLETMQTRNISYIVNVTTHLPLYHYEKGVFNYKRLPATDSNKQNLRQYFEEAFEFIDEAHQCGKALLIHCQAGVSRSATIVIAYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQL 437          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Xenopus
Match: usp48 (ubiquitin specific peptidase 48 [Source:Xenbase;Acc:XB-GENE-5938602])

HSP 1 Score: 91.6633 bits (226), Expect = 8.938e-20
Identity = 56/127 (44.09%), Postives = 77/127 (60.63%), Query Frame = 1
Query:   82 LWLGSYEDASNVDLLKSLQIKYILTVMDS--PLLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGR-KFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIK-EKSFICPNDGFMKQL 450
            L+LG  +D++N+D+L+   IKYIL V  +   L     +F YK I   D  +Q+L  +F E   FI+  R K  GVL+HCLAGISRS T+  AY+M+   +  NDA + +K +KS I PN  FM QL
Sbjct:  211 LYLGCAKDSTNLDVLEEFGIKYILNVTPNLPNLFENAGEFRYKQIPISDHWSQNLSQFFPEAISFIDEARGKSCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQL 337          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Xenopus
Match: lrit2 (leucine-rich repeat, Ig-like and transmembrane domains 2 [Source:Xenbase;Acc:XB-GENE-923281])

HSP 1 Score: 91.6633 bits (226), Expect = 9.161e-20
Identity = 56/128 (43.75%), Postives = 78/128 (60.94%), Query Frame = 1
Query:   79 NLWLGSYEDASNVDLLKSLQIKYILTVMDS-P-LLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGRKFG-GVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIK-EKSFICPNDGFMKQL 450
            +L+LGS  D+ N+D L  L I+YIL V  + P +  K  +F+YK I   D  +Q+L  +F E  EFI+       GVL+HCLAGISRS T+  AY+M+   +  NDA + +K +K+ I PN  FM QL
Sbjct:  201 HLYLGSARDSGNIDTLAKLGIRYILNVTPNLPNIFEKDGEFHYKQIPISDHWSQNLSQFFPEAIEFIDEAASHNCGVLVHCLAGISRSVTVTVAYLMQKLNLSLNDAYDFVKRKKTNISPNFNFMGQL 328          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Xenopus
Match: eci1 (enoyl-CoA delta isomerase 1 [Source:Xenbase;Acc:XB-GENE-999272])

HSP 1 Score: 89.7373 bits (221), Expect = 4.281e-19
Identity = 57/129 (44.19%), Postives = 78/129 (60.47%), Query Frame = 1
Query:   82 LWLGSYEDASNVDLLKSLQIKYILTVMDSPLLHKM----EDFNYKFIKAYDVPNQDLISYFDETSEFIENGR-KFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIK-EKSFICPNDGFMKQL 450
            L+LG  +D++N+D+L    IKYIL V  +P L  M     +F YK I   D  +Q+L  +F E   FI+  R K  G+L+HCLAGISRS T+  AY+M+   +  NDA + +K +KS I PN  FM QL
Sbjct:  200 LYLGCAKDSANLDILAKYNIKYILNV--TPNLPNMFEHNGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARSKNCGILVHCLAGISRSVTVTVAYLMQKLNLSLNDAYDFVKRKKSNISPNFNFMGQL 326          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Mouse
Match: Dusp12 (dual specificity phosphatase 12 [Source:MGI Symbol;Acc:MGI:1890614])

HSP 1 Score: 149.058 bits (375), Expect = 6.720e-41
Identity = 99/300 (33.00%), Postives = 146/300 (48.67%), Query Frame = 1
Query:   79 NLWLGSYEDASNVDLLKSLQIKYILTVMDSPLLHK---MEDFNYKFIKAYDVPNQDLISYFDETSEFIENGRKFG-GVLIHCLAGISRSGTILTAYIMKHFKID---PNDAIEKIKEKSFICPNDGFMKQLKIYFNMKCTGDYKSDEYKQFIRLFSPDDINKCTNTVSQAQF-----NLSKSSTDLIQFKCKKCRFLLFDNSSVVEHS-----------KMKASKTITENTICN-EEIFIEALPWIDSS--SANGGKVNCPKCACKLGSYTWVGERCVCGNWVVPAFHIAKQKVDPVKSM 900
             L+LG     +    L+   I  +LTV   P        E     F+ A D P  DL+S+ D    FI   R  G  VL+HC AG+SRS  ++ A+IMK  ++      D +  +K ++ +  N+GF  QLK+Y  M    D  S  YKQ+      +   K  N + Q  F      +S+   D I +KC+KCR  LF +SS++ HS           +   S  +T  +       FIE + W++S+      G++ CPKC+ KLGS+ W GE+C CG W+ PAF I K +VD +K +
Sbjct:   33 GLYLGGAAAVAEPGHLREAGITAVLTVDSEPAFPAGAGFEGLRSLFVPALDKPETDLLSHLDRCVAFIGQARSEGRAVLVHCHAGVSRSVAVVMAFIMKTDQLTFEKAYDILRTVKPEAKV--NEGFEWQLKLYEAMGYEVDTSSAFYKQYRLQKVTEKCPKLWN-LPQELFAVDPTTISQGLKDDILYKCRKCRRSLFRHSSILGHSEGSGPIAFAHKRTAPSSVLTTGSQAQCTSYFIEPVQWMESTLLGVMDGQLLCPKCSAKLGSFNWYGEQCSCGRWITPAFQIHKNRVDEMKML 329          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Mouse
Match: Dusp19 (dual specificity phosphatase 19 [Source:MGI Symbol;Acc:MGI:1915332])

HSP 1 Score: 92.4337 bits (228), Expect = 3.878e-21
Identity = 50/128 (39.06%), Postives = 76/128 (59.38%), Query Frame = 1
Query:   82 LWLGSYEDASNVDLLKSLQIKYILTVMDSPLLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGR-KFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKE-KSFICPNDGFMKQLKIY 459
            L LGS + A +++LL+  ++ +IL V        + +F YK I   DVP  +++SYF E  EFIE  + K G VL+HC AG+SR+  I+  ++M   +     A+  +KE +  ICPN GFM+QL+ Y
Sbjct:   72 LLLGSQDAAHDLELLRKHKVTHILNVAYGVENAFLSEFTYKTISILDVPETNILSYFPECFEFIEQAKLKDGVVLVHCNAGVSRAAAIVIGFLMSSEEATFTTALSLVKEARPSICPNPGFMEQLRTY 199          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Mouse
Match: Dusp6 (dual specificity phosphatase 6 [Source:MGI Symbol;Acc:MGI:1914853])

HSP 1 Score: 91.2781 bits (225), Expect = 8.491e-20
Identity = 56/127 (44.09%), Postives = 77/127 (60.63%), Query Frame = 1
Query:   82 LWLGSYEDASNVDLLKSLQIKYILTVMDS--PLLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGR-KFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIK-EKSFICPNDGFMKQL 450
            L+LG  +D++N+D+L+   IKYIL V  +   L     +F YK I   D  +Q+L  +F E   FI+  R K  GVL+HCLAGISRS T+  AY+M+   +  NDA + +K +KS I PN  FM QL
Sbjct:  214 LYLGCAKDSTNLDVLEEFGIKYILNVTPNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQL 340          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Mouse
Match: Dusp9 (dual specificity phosphatase 9 [Source:MGI Symbol;Acc:MGI:2387107])

HSP 1 Score: 92.0485 bits (227), Expect = 9.539e-20
Identity = 57/128 (44.53%), Postives = 78/128 (60.94%), Query Frame = 1
Query:   79 NLWLGSYEDASNVDLLKSLQIKYILTVMDS-P-LLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGRKFG-GVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIK-EKSFICPNDGFMKQL 450
            NL+LGS  D++N++ L  L I+YIL V  + P L  K  DF+YK I   D  +Q+L  +F E   FI+       GVL+HCLAG+SRS T+  AY+M+   +  NDA + +K +KS I PN  FM QL
Sbjct:  278 NLYLGSARDSANLESLAKLGIRYILNVTPNLPNLFEKNGDFHYKQIPISDHWSQNLSQFFPEAIAFIDEALSQNCGVLVHCLAGVSRSVTVTVAYLMQKLHLSLNDAYDLVKRKKSNISPNFNFMGQL 405          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Mouse
Match: Dusp7 (dual specificity phosphatase 7 [Source:MGI Symbol;Acc:MGI:2387100])

HSP 1 Score: 87.8113 bits (216), Expect = 2.051e-18
Identity = 57/128 (44.53%), Postives = 78/128 (60.94%), Query Frame = 1
Query:   82 LWLGSYEDASNVDLLKSLQIKYILTVMDSPLLHKME---DFNYKFIKAYDVPNQDLISYFDETSEFIENGR-KFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIK-EKSFICPNDGFMKQL 450
            L+LG  +D++N+D+L    IKYIL V  + L +  E   +F YK I   D  +Q+L  +F E   FI+  R K  GVL+HCLAGISRS T+  AY+M+   +  NDA + +K +KS I PN  FM QL
Sbjct:  255 LYLGCAKDSTNLDVLGKYGIKYILNVTPN-LPNAFEHGGEFTYKQIPISDHWSQNLSQFFPEAISFIDEARSKKCGVLVHCLAGISRSVTVTVAYLMQKMNLSLNDAYDFVKRKKSNISPNFNFMGQL 381          
BLAST of dual specificity protein phosphatase 12 vs. UniProt/SwissProt
Match: sp|Q9JIM4|DUS12_RAT (Dual specificity protein phosphatase 12 OS=Rattus norvegicus OX=10116 GN=Dusp12 PE=1 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 3.498e-43
Identity = 103/298 (34.56%), Postives = 146/298 (48.99%), Query Frame = 1
Query:   79 NLWLGSYEDASNVDLLKSLQIKYILTVMDSPLLHK---MEDFNYKFIKAYDVPNQDLISYFDETSEFIENGRKFG-GVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKE-KSFICPNDGFMKQLKIYFNMKCTGDYKSDEYKQFIRLFS-----PDDINKCTNTVSQAQFNLSKSSTDLIQFKCKKCRFLLFDNSSVVEHSKMK------------ASKTITENTICNEEIFIEALPWIDSS--SANGGKVNCPKCACKLGSYTWVGERCVCGNWVVPAFHIAKQKVDPVKSM 900
             L+LG     +  D L+   I  +LTV   P        E     F+ A D P  DL+S+ D    FI   R  G  VL+HC AG+SRS  ++TA+IMK  ++    A E ++  K     N+GF  QLK+Y  M       S  YKQ+ RL       P+  N      +     +S+   D I +KC+KCR  LF  SS+++HS+              +S   T N       FIE + W++S+      G++ CPKC+ KLGS+ W GE+C CG W+ PAF I K +VD VK++
Sbjct:   33 GLYLGGAAAVAGPDYLREAGITAVLTVDSEPAFPAGAGFEGLQSLFVPALDKPETDLLSHLDRCVAFIGQARSEGRAVLVHCHAGVSRSVAVVTAFIMKTEQLTFEKAYENLQTIKPEAKMNEGFEWQLKLYEAMGHEVHTSSAVYKQY-RLQKVTEKYPELRNLPRELFAVDPTTVSQGLKDDILYKCRKCRRSLFRRSSILDHSEGSGPVAFAHKRTGLSSVLTTGNQAQCTSYFIEPVQWMESALLGVMDGQLLCPKCSAKLGSFNWYGEQCSCGRWITPAFQIHKNRVDEVKTL 329          
BLAST of dual specificity protein phosphatase 12 vs. UniProt/SwissProt
Match: sp|Q9UNI6|DUS12_HUMAN (Dual specificity protein phosphatase 12 OS=Homo sapiens OX=9606 GN=DUSP12 PE=1 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 1.899e-41
Identity = 102/297 (34.34%), Postives = 151/297 (50.84%), Query Frame = 1
Query:   79 NLWLGSYEDASNVDLLKSLQIKYILTV-MDSPLLHK---MEDFNYKFIKAYDVPNQDLISYFDETSEFIENGRKFG-GVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIK-EKSFICPNDGFMKQLKIYFNMKCTGDYKSDEYKQFIRLFSPDDINKCTNTVSQAQF-----NLSKSSTDLIQFKCKKCRFLLFDNSSVVEHSKMK-----ASKTITENTICNE-------EIFIEALPWIDSS--SANGGKVNCPKCACKLGSYTWVGERCVCGNWVVPAFHIAKQKVDPVK 894
             L+ G     +  D L+   I  +LTV  + P       +ED    F+ A D P  DL+S+ D    FI   R  G  VL+HC AG+SRS  I+TA++MK  ++    A EK++  K     N+GF  QLK+Y  M    D  S  YKQ+ RL    +       + Q  F      +S+   D + +KC+KCR  LF +SS+++H +       A K +T +++            FIE + W++S+      G++ CPKC+ KLGS+ W GE+C CG W+ PAF I K +VD +K
Sbjct:   33 GLYFGGAAAVAEPDHLREAGITAVLTVDSEEPSFKAGPGVEDLWRLFVPALDKPETDLLSHLDRCVAFIGQARAEGRAVLVHCHAGVSRSVAIITAFLMKTDQLPFEKAYEKLQILKPEAKMNEGFEWQLKLYQAMGYEVDTSSAIYKQY-RLQKVTEKYPELQNLPQELFAVDPTTVSQGLKDEVLYKCRKCRRSLFRSSSILDHREGSGPIAFAHKRMTPSSMLTTGRQAQCTSYFIEPVQWMESALLGVMDGQLLCPKCSAKLGSFNWYGEQCSCGRWITPAFQIHKNRVDEMK 328          
BLAST of dual specificity protein phosphatase 12 vs. UniProt/SwissProt
Match: sp|Q9D0T2|DUS12_MOUSE (Dual specificity protein phosphatase 12 OS=Mus musculus OX=10090 GN=Dusp12 PE=2 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 4.701e-40
Identity = 99/300 (33.00%), Postives = 146/300 (48.67%), Query Frame = 1
Query:   79 NLWLGSYEDASNVDLLKSLQIKYILTVMDSPLLHK---MEDFNYKFIKAYDVPNQDLISYFDETSEFIENGRKFG-GVLIHCLAGISRSGTILTAYIMKHFKID---PNDAIEKIKEKSFICPNDGFMKQLKIYFNMKCTGDYKSDEYKQFIRLFSPDDINKCTNTVSQAQF-----NLSKSSTDLIQFKCKKCRFLLFDNSSVVEHS-----------KMKASKTITENTICN-EEIFIEALPWIDSS--SANGGKVNCPKCACKLGSYTWVGERCVCGNWVVPAFHIAKQKVDPVKSM 900
             L+LG     +    L+   I  +LTV   P        E     F+ A D P  DL+S+ D    FI   R  G  VL+HC AG+SRS  ++ A+IMK  ++      D +  +K ++ +  N+GF  QLK+Y  M    D  S  YKQ+      +   K  N + Q  F      +S+   D I +KC+KCR  LF +SS++ HS           +   S  +T  +       FIE + W++S+      G++ CPKC+ KLGS+ W GE+C CG W+ PAF I K +VD +K +
Sbjct:   33 GLYLGGAAAVAEPGHLREAGITAVLTVDSEPAFPAGAGFEGLRSLFVPALDKPETDLLSHLDRCVAFIGQARSEGRAVLVHCHAGVSRSVAVVMAFIMKTDQLTFEKAYDILRTVKPEAKV--NEGFEWQLKLYEAMGYEVDTSSAFYKQYRLQKVTEKCPKLWN-LPQELFAVDPTTISQGLKDDILYKCRKCRRSLFRHSSILGHSEGSGPIAFAHKRTAPSSVLTTGSQAQCTSYFIEPVQWMESTLLGVMDGQLLCPKCSAKLGSFNWYGEQCSCGRWITPAFQIHKNRVDEMKML 329          
BLAST of dual specificity protein phosphatase 12 vs. UniProt/SwissProt
Match: sp|O13632|PVH1_SCHPO (Tyrosine-protein phosphatase yvh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=yvh1 PE=3 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 4.378e-37
Identity = 88/281 (31.32%), Postives = 147/281 (52.31%), Query Frame = 1
Query:   79 NLWLGSYEDASNVDLLKSLQIKYILTVMD-SPLLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENG-RKFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKEK-SFICPNDGFMKQLKIYFNMKCTGDYKSDEYKQFIRLFSPDDINKCTNTVSQAQFNLS-KSSTDLIQFKCKKCRFLLFDNSSVVEHSKMKASKTITENTICNEEIFIEALPWIDSSSANG---GKVNCPKCACKLGSYTWVGERCVCGNWVVPAFHIAKQKVDPVKSM 900
            NL++ S++ AS +       I Y L+ M  +P L   E   + +++  D  +Q+++ YF+++++FI     K   VL+HC AGISRS T++ AY+MK    +  +A+  I E+ S I PN  F++QL++YF      D     Y+Q++     D     T   S+  +  + ++    ++ +CKKCRF+L  +  +V H     +     +T C    F+E + W+      G   G+ +CPKC  K+GSY W G +C C  WV PA  I + +VD V+ +
Sbjct:   53 NLYISSWKTASELVSTSDKGIDYTLSAMSINPNLSVPEQ-QHLWLQIEDSSSQNILQYFEKSNKFIAFALSKNAKVLVHCFAGISRSVTLVAAYLMKENNWNTEEALSHINERRSGISPNANFLRQLRVYFECNYQLDRSLRPYRQWLFRRYGDFAVLNTRVPSEVAYAETVRARAGQLELRCKKCRFVLASSDYLVSHEPKDENNY--SHTRCTH-YFLEPIRWMQPELELGNLEGRFDCPKCNSKIGSYKWQGLQCSCLQWVCPALSILQSRVDAVRKL 329          
BLAST of dual specificity protein phosphatase 12 vs. UniProt/SwissProt
Match: sp|Q9VWF4|DUSK4_DROME (Dual specificity protein phosphatase MPK-4 OS=Drosophila melanogaster OX=7227 GN=MKP-4 PE=1 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 3.228e-30
Identity = 89/337 (26.41%), Postives = 167/337 (49.55%), Query Frame = 1
Query:   76 SNLWLGSYEDASNVDLLKSLQIKYILTVMDSPLLHKMEDFNY---KFIKAYDVPNQDLISYFDETSEFIENG-RKFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKEK-SFICPNDGFMKQLKIYFNMKCTGDYKSDEYKQFIRLFSPDDINKCT------NTVSQAQFNLSKSSTDLIQFKCKKCRFLLFDNSSVVEH--------------------SKMKA------------------SKTITENTI-----------CNEEIFIEALPWIDSSSANG-GKVNCPKCACKLGSYTWVGE-RCVCGNWVVPAFHIAKQKVDPVKSM 900
            + L+LG+   A++++ L+S +I +ILT+   PL   + + ++   K+I+  D+P +D++ + +   +FI +   + G VL+HC  G+SRS + + AY+MK   +D   A E +K K  F+ PN GF+ QLK++  M C  D     YK      + + + K        ++V +   ++++ + + I F+C++CR +L   S V+EH                    +K+ A                  S+ I ++++           C   +F+E + W+     N  G++ CPKC  KLG+++W+   +C CG  + PAF++   KV+  K++
Sbjct:   44 TGLFLGNLTAATHMETLRSFKITHILTLDSVPLPQHILEASFLTTKYIQIADMPREDILQHLEGCVDFISSALAQQGNVLVHCYFGVSRSSSTVIAYMMKRHNLDFLPAYELVKAKRRFVQPNAGFVSQLKLFRRMGCKIDPNCQRYKIHRLRLAGEQMRKAKILPQSFHSVVRPDPDITRENPEPIVFRCRRCRRVLASKSHVLEHKPRDRPPQEVVPKEKEEVAAAKLPAQSHDQAENHHGARMLEQLSERIRQSSLGSPGHESTPNYCRSILFVEPIAWMHRIMLNTQGRLYCPKCEQKLGNFSWINACKCPCGETMTPAFYLIPSKVELSKAV 380          
BLAST of dual specificity protein phosphatase 12 vs. TrEMBL
Match: A0A1S3JIV5 (dual specificity protein phosphatase 12 OS=Lingula unguis OX=7574 GN=LOC106173653 PE=4 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 2.875e-61
Identity = 118/301 (39.20%), Postives = 169/301 (56.15%), Query Frame = 1
Query:   79 NLWLGSYEDASNVDLLKSLQIKYILTVMDSPLLHKME-DFNYKFIKAYDVPNQDLISYFDETSEFIENGRKFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKEKSFICPNDGFMKQLKIYFNMKCTGDYKSDEYKQFIRLFSPDDINKCTNTVSQAQFNLSKSSTDLIQ-------------FKCKKCRFLLFDNSSVVEHSKMKA-----------------SKTITENTICNEEIFIEALPWI-DSSSANGGKVNCPKCACKLGSYTWVGERCVCGNWVVPAFHIAKQKVD 885
            NL++GS +DAS+ + L+  ++ +ILT+   PL    +  F  KFI A D P  DL+SYF+E  +FIE+G K GGVL+HC AG+SRS TI  AY+M+   I   +A+ KI+EK  + PN GFM+QL ++  M    D K  +YK +         NK +  V QA  +L   + D ++             ++CKKCR +LF  +S + HS+                    S +  + T+C++  FIE + W+ D  S+  GK++CPKC  KLGS+ W GERC CG W+ PAFHI  QKVD
Sbjct:   10 NLYIGSRDDASDTETLQQKEVTHILTIDVKPLPTTQQMTFQCKFIHALDDPETDLLSYFEECIQFIEDGVKMGGVLVHCAAGVSRSATITAAYLMRKHNIGVEEALGKIEEKRHVGPNPGFMQQLHLFEEMGSRLDQKHPKYKIYF-------WNKLSARV-QAARSLEDINADTLEPDPSVGGTGGETVYRCKKCRRILFKQTSFLSHSEGTGEAAFDWRRDSIKHDGSHSSSDEKETMCSQSYFIEPVQWMSDCISSLEGKLSCPKCNAKLGSFNWAGERCPCGAWITPAFHIQIQKVD 302          
BLAST of dual specificity protein phosphatase 12 vs. TrEMBL
Match: A0A210QP86 (Dual specificity protein phosphatase 12 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT04541 PE=3 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 7.036e-56
Identity = 114/301 (37.87%), Postives = 175/301 (58.14%), Query Frame = 1
Query:   79 NLWLGSYEDASNVDLLKSLQIKYILTVMDSPLLHKM-EDFNYKFIKAYDVPNQDLISYFDETSEFIENGRKFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKE-KSFICPNDGFMKQLKIYFNMKCTGDYKSDEYKQF------IRLFSPDDINKCTNTVSQAQFNLSKSSTDL---IQFKCKKCRFLLFDNSSVVEH------------SKMKASKTIT-----ENTICNEEIFIEALPWI-DSSSANGGKVNCPKCACKLGSYTWVGERCVCGNWVVPAFHIAKQKVDPVK 894
            NL+LGS+  A ++  LK+  I +ILTV +SPL   + E F YKFI  +D+   DL++YF+E  +FI+ G ++G VL+HCLAG SRS T++ AYIMK  ++   +A+  ++  +S + PN+GF +QL +Y  M+   D  ++ ++++      +++ S D       T S  +   + S +D    I +KC+KCR  LF  S ++ H            SK+ ++K  T       T+C + +FIE + W+ +S S   GKV+CPKC  K+GS+ W GE+C CG WV PAFHI   KVD  K
Sbjct:   17 NLYLGSWSAAKDIIRLKARGITHILTVNNSPLPKSVSEQFKYKFIHGFDLEFTDLLNYFEECIKFIDEGIRYGSVLVHCLAGCSRSATMVIAYIMKKKQMGYGEALGIVRRSRSIVHPNEGFKEQLLLYQEMENKIDTTNERFRRYRLKKLALKIHSYD----LGETFSPEELTANPSDSDNKADIVYKCRKCRQALFKKSGLISHNVGEGEAAFDWRSKIPSNKKETVEGRESTTVCTQSLFIEPVRWMAESISEPVGKVSCPKCNSKIGSFVWHGEKCPCGAWVAPAFHIRANKVDESK 313          
BLAST of dual specificity protein phosphatase 12 vs. TrEMBL
Match: A0A5K3ETZ7 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 9.473e-55
Identity = 112/285 (39.30%), Postives = 160/285 (56.14%), Query Frame = 1
Query:   79 NLWLGSYEDASNVDLLKSLQIKYILTVMDSPLLHK-MEDFNYKFIKAYDVPNQDLISYFDETSEFIENGRKFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKEKSFICPNDGFMKQLKIYFNMKCTGDYKSDEYKQFIRLFSPDDINKCTNTVSQAQFNLSKSSTDLIQFKCKKCRFLLFDNSSVVEHSKMKASKTITENTICNE-EIFIEALPWIDSSSAN-GGKVNCPKCACKLGSYTWVGERCVCGNWVVPAFHIAKQKVDPVKSMSF*SLSEE 924
             LWLGS   A+ V  L ++ I+ +LTV  SPL     E      IKA DVP+++LI +F E   FI+      GVL+HCLAG+SRS TI+ AYIM  +K+    A + + ++  ICPN GF++QLK++ +M    D  S+ YK+F  L +   I  C  T       +S     L  F C+KCR +LF +  V+ H   K          CN+ E+F  AL W +S +++  GK+ CPKCA K+GSY W GE CVCG W+ PAFH +++ +D +   +  S  +E
Sbjct:    7 GLWLGSRPRANEVPKLIAVGIRSVLTVDMSPLEEPAFEKLKRLHIKASDVPSENLIIHFKEAIAFIDENVS-EGVLVHCLAGVSRSATIVIAYIMWKYKLSYTAARDIVAKRRNICPNAGFVRQLKLFESMNFVVDTSSELYKEFESLRNSYPI--CLPTGKILLHYISSRDPSLSNFACRKCRSVLFHSEDVIHHLCPKKDGDSQSVKPCNQGELFTNALEWFNSQTSDVQGKLYCPKCAVKIGSYNWCGEPCVCGRWLTPAFHFSRKHLDELPGGAIPSAKDE 288          
BLAST of dual specificity protein phosphatase 12 vs. TrEMBL
Match: K1QLY7 (Dual specificity protein phosphatase 12 OS=Crassostrea gigas OX=29159 GN=CGI_10026177 PE=4 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 4.547e-54
Identity = 110/295 (37.29%), Postives = 165/295 (55.93%), Query Frame = 1
Query:   79 NLWLGSYEDASNVDLLKSLQIKYILTVMDSPLLHKM-EDFNYKFIKAYDVPNQDLISYFDETSEFIENGRKFGG-VLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKEKS-FICPNDGFMKQLKIYFNMKCTGDYKSDEYKQFIRLFSPDDINKCTNTVS-QAQFNLSKSSTDL----IQFKCKKCRFLLFDNSSVVEH------------SKMKASKTITEN--TICNEEIFIEALPWIDSSSAN-GGKVNCPKCACKLGSYTWVGERCVCGNWVVPAFHIAKQKVDPVK 894
            N+++G+       D LK   + +ILT+ + PL   + E++ YKFI   D+   DL+S+F+E   FIE+  + GG VL+HCL G SRS TI  AY+M   KI   +A+E +K K   +CPN+GF+ QL ++  M C  D   ++Y+Q+      D++   T+    + Q +   ++ +L    + FKC+KCR  LF  S +++H             K+   KT   N   +C+   FIE + W+  S  +  GK++CPKC CK+GS+ W GERC CG+WV PAFHI   KVD  K
Sbjct:   15 NIYIGAERAVHRTDQLKQNNVTHILTINNVPLHRSITENYKYKFIYGLDLEFTDLLSHFEECFHFIEDATESGGSVLVHCLMGCSRSATIAIAYLMYKNKITYEEALEIVKNKRPMVCPNEGFISQLLLFEEMGCAMDRTHEKYRQYRLKKLADNLQGSTSEERLKLQADYFDTAEELKKEDVVFKCRKCRQALFKQSGIMKHCVGEGEVAFSWRGKVSTEKTEKPNNPAVCDLSYFIEPVRWMAGSIQDLEGKLSCPKCNCKIGSFLWYGERCPCGSWVAPAFHIQTTKVDMCK 309          
BLAST of dual specificity protein phosphatase 12 vs. TrEMBL
Match: V3ZYI8 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_125232 PE=4 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 1.122e-53
Identity = 107/302 (35.43%), Postives = 164/302 (54.30%), Query Frame = 1
Query:   82 LWLGSYEDASNVDLLKSLQIKYILTVMDSPLLHKMED-FNYKFIKAYDVPNQDLISYFDETSEFIENGRKFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKE-KSFICPNDGFMKQLKIYFNMKCTGDYKSDEYKQFIRLFSPDDINKCTNTVSQAQ-------FNLSKSSTDLIQFKCKKCRFLLFDNSSVVEHSKMKASKTI-----------------TENTICNEEIFIEALPWIDSSSAN-GGKVNCPKCACKLGSYTWVGERCVCGNWVVPAFHIAKQKVDPVKSMSF 906
            L+LG  E A +++ L+   I +I+T+   PL  +  D F  K+I A D+ + DL++Y DE + FI++G   GGVL+HC  G SRS TI+ AY+M    +   +A++K+K  +  + PN GF+ QL +Y +M    D KS+ ++Q+        +NK + +V   Q       ++    S  L  +KC+KCR  LF +S+++ H + K                       + T+C+  +FIE L W+ S   N  GK+ CPKC+ K+GS+ W GERC CG WV PAFHI   KVD  K ++ 
Sbjct:    8 LFLGGVEAALDIESLEKFGITHIITIDIRPLCQETTDKFTTKYIHAMDLEDTDLLTYIDECNSFIDDGLVKGGVLVHCFVGSSRSATIVIAYLMNKLNLTFQEALDKVKTLRPLVKPNQGFLHQLHLYESMGNKIDVKSNCFRQY-------RLNKLSLSVQAGQQISDHKLYSQLDESNSLNSYKCRKCRQALFKSSALLPHMEGKGKAAFDWRSRIEDDENDIDFQNKDKTLCDRSLFIEPLKWMSSYVHNMEGKILCPKCSAKIGSFIWYGERCPCGTWVAPAFHIQSSKVDLCKPINI 302          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Cavefish
Match: dusp12 (dual specificity phosphatase 12 [Source:NCBI gene;Acc:103030551])

HSP 1 Score: 150.214 bits (378), Expect = 1.850e-41
Identity = 96/302 (31.79%), Postives = 155/302 (51.32%), Query Frame = 1
Query:   76 SNLWLGSYEDASNVDLLKSLQIKYILTV-MDSPLLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENG-----RKFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKE-KSFICPNDGFMKQLKIYFNMKCTGDYKSDEYKQFIRLFSPDDINKCTNTVSQAQFNLSKSSTD--LIQFKCKKCRFLLFDNSSVVEH-----------SKMKASKTITENTICNEEIFIEALPWIDSS--SANGGKVNCPKCACKLGSYTWVGERCVCGNWVVPAFHIAKQKVDPVKSMSF*SL 915
            + L +GS  D  + + L +  + +ILTV  + P    +  F+ KF+ A D  + DL+S  D+   FI         K   VL+HC  G SRS  ++TAY+MK  K+   DA  K+++ K  +  N+ F+ QL +Y +M C  D  S  YKQ+ RL    +       + +  F +  + T    + ++C+KCR  LF +SS++ H            ++    +  + T C    FIE + W++ +      G++ CPKC+ KLGS+ W G++C CG WV PAF + K +VD +K +S  +L
Sbjct:   29 TGLCIGSVSDLKDPEALINAGVTHILTVDSEEP---NISGFHKKFVHALDDSSTDLLSRLDDCVHFITEALAASEGKASSVLVHCHVGQSRSAAVVTAYLMKTKKLSLQDAYAKLQQLKPDVKMNEEFLDQLVLYESMNCELDTNSPLYKQY-RLRKVTEKYPELQKLPKEVFAVDPAQTQNTEVVYRCRKCRRTLFRHSSILSHCLGSGASAFSHKRVSVGGSAEDQTQCTS-YFIEPVQWMEEALLGVMDGQLLCPKCSSKLGSFNWYGDQCSCGRWVTPAFQMHKNRVDEIKHISIPAL 325          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Cavefish
Match: dusp12 (dual specificity phosphatase 12 [Source:NCBI gene;Acc:103030551])

HSP 1 Score: 95.5153 bits (236), Expect = 8.871e-22
Identity = 71/246 (28.86%), Postives = 119/246 (48.37%), Query Frame = 1
Query:   76 SNLWLGSYEDASNVDLLKSLQIKYILTV-MDSPLLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGR-----KFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKE-KSFICPNDGFMKQLKIYFNMKCTGDYKSDEYKQFIRLFSPDDINKCTNTVSQAQFNLSKSSTD--LIQFKCKKCRFLLFDNSSVV-----------EHSKMKASKTITENTICNEEIFIEALPWIDSS 753
            + L +GS  D  + + L +  + +ILTV  + P    +  F+ KF+ A D  + DL+S  D+   FI         K   VL+HC  G SRS  ++TAY+MK  K+   DA  K+++ K  +  N+ F+ QL +Y +M C  D  S  YKQ+ RL    +       + +  F +  + T    + ++C+KCR  LF +SS++            H ++    +  + T C    FIE + W++ +
Sbjct:   29 TGLCIGSVSDLKDPEALINAGVTHILTVDSEEP---NISGFHKKFVHALDDSSTDLLSRLDDCVHFITEALAASEGKASSVLVHCHVGQSRSAAVVTAYLMKTKKLSLQDAYAKLQQLKPDVKMNEEFLDQLVLYESMNCELDTNSPLYKQY-RLRKVTEKYPELQKLPKEVFAVDPAQTQNTEVVYRCRKCRRTLFRHSSILSHCLGSGASAFSHKRVSVGGSAEDQTQCT-SYFIEPVQWMEEA 269          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Cavefish
Match: dusp12 (dual specificity phosphatase 12 [Source:NCBI gene;Acc:103030551])

HSP 1 Score: 94.7449 bits (234), Expect = 2.306e-21
Identity = 71/246 (28.86%), Postives = 119/246 (48.37%), Query Frame = 1
Query:   76 SNLWLGSYEDASNVDLLKSLQIKYILTV-MDSPLLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGR-----KFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKE-KSFICPNDGFMKQLKIYFNMKCTGDYKSDEYKQFIRLFSPDDINKCTNTVSQAQFNLSKSSTD--LIQFKCKKCRFLLFDNSSVV-----------EHSKMKASKTITENTICNEEIFIEALPWIDSS 753
            + L +GS  D  + + L +  + +ILTV  + P    +  F+ KF+ A D  + DL+S  D+   FI         K   VL+HC  G SRS  ++TAY+MK  K+   DA  K+++ K  +  N+ F+ QL +Y +M C  D  S  YKQ+ RL    +       + +  F +  + T    + ++C+KCR  LF +SS++            H ++    +  + T C    FIE + W++ +
Sbjct:   44 TGLCIGSVSDLKDPEALINAGVTHILTVDSEEP---NISGFHKKFVHALDDSSTDLLSRLDDCVHFITEALAASEGKASSVLVHCHVGQSRSAAVVTAYLMKTKKLSLQDAYAKLQQLKPDVKMNEEFLDQLVLYESMNCELDTNSPLYKQY-RLRKVTEKYPELQKLPKEVFAVDPAQTQNTEVVYRCRKCRRTLFRHSSILSHCLGSGASAFSHKRVSVGGSAEDQTQCT-SYFIEPVQWMEEA 284          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Cavefish
Match: dusp6 (dual specificity phosphatase 6 [Source:NCBI gene;Acc:103030496])

HSP 1 Score: 92.8189 bits (229), Expect = 3.190e-20
Identity = 65/181 (35.91%), Postives = 102/181 (56.35%), Query Frame = 1
Query:   79 NLWLGSYEDASNVDLLKSLQIKYILTVMDS-P-LLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGR-KFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIK-EKSFICPNDGFMKQLKIYFNMKCTGDYKSDEYKQFIRLFSPDDINKCTNTVSQAQFNLSKSSTDLIQF 609
            +L+LG  +D++N+D+L+   IKYIL V  + P L     +F YK I   D  +Q+L  +F E   FI+  R +  GVL+HCLAGISRS T+  AY+M+   +  NDA + +K +KS I PN  FM QL               ++++ + + SP D N+ T+  SQA +  + ++ ++ Q 
Sbjct:  252 HLYLGCAKDSTNLDILEEFGIKYILNVTPNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGQKCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLL--------------DFERTLGIQSPCD-NRATSAPSQALYFSTPTNHNVFQL 417          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Cavefish
Match: dusp6 (dual specificity phosphatase 6 [Source:NCBI gene;Acc:103030496])

HSP 1 Score: 92.0485 bits (227), Expect = 4.441e-20
Identity = 65/181 (35.91%), Postives = 102/181 (56.35%), Query Frame = 1
Query:   79 NLWLGSYEDASNVDLLKSLQIKYILTVMDS-P-LLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGR-KFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIK-EKSFICPNDGFMKQLKIYFNMKCTGDYKSDEYKQFIRLFSPDDINKCTNTVSQAQFNLSKSSTDLIQF 609
            +L+LG  +D++N+D+L+   IKYIL V  + P L     +F YK I   D  +Q+L  +F E   FI+  R +  GVL+HCLAGISRS T+  AY+M+   +  NDA + +K +KS I PN  FM QL               ++++ + + SP D N+ T+  SQA +  + ++ ++ Q 
Sbjct:  212 HLYLGCAKDSTNLDILEEFGIKYILNVTPNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGQKCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLL--------------DFERTLGIQSPCD-NRATSAPSQALYFSTPTNHNVFQL 377          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Sea Lamprey
Match: dusp7 (dual specificity phosphatase 7 [Source:ZFIN;Acc:ZDB-GENE-030131-5457])

HSP 1 Score: 92.0485 bits (227), Expect = 1.193e-21
Identity = 57/128 (44.53%), Postives = 78/128 (60.94%), Query Frame = 1
Query:   79 NLWLGSYEDASNVDLLKSLQIKYILTVMDS-P-LLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGR-KFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIK-EKSFICPNDGFMKQL 450
            +L+LG  +D+SN++ L    I+YIL V  + P    ++ DF YK I   D  NQ+L  +F E   FI+  R K  GVL+HCLAGISRS T+  AY+M+   +  NDA + +K +KS I PN  FM QL
Sbjct:  103 HLFLGCAQDSSNMEALAQHGIRYILNVTPNLPNTFERIADFKYKQIPISDHWNQNLSQFFPEAIAFIDEARNKQCGVLVHCLAGISRSVTVTVAYLMQKLSLPLNDAYDFVKHKKSNISPNFNFMGQL 230          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Sea Lamprey
Match: dusp22b (dual specificity phosphatase 22b [Source:NCBI gene;Acc:100002272])

HSP 1 Score: 81.6481 bits (200), Expect = 5.943e-19
Identity = 45/130 (34.62%), Postives = 79/130 (60.77%), Query Frame = 1
Query:   82 LWLGSYEDASNVDLLKSLQIKYILTVMDSPLLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGR-KFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIK-EKSFICPNDGFMKQLKIYFN 465
            L+LG+ +D++++  L+   I +IL+V D+     +E+  Y  I+  D P+Q+L  +F +  +FI   R +  G L+HCLAG+SRS T++ AYIM    +   +A+  +K  ++   PN GF +QL+++ N
Sbjct:   12 LYLGNIKDSADLKQLRDHNITHILSVHDAAR-EALEEMTYLCIQVSDTPSQNLTQHFKDCIQFIHKCRMEKKGCLVHCLAGVSRSVTMVVAYIMTVTSLGWEEAMVAVKTARTCANPNLGFQQQLQMFQN 140          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Sea Lamprey
Match: dusp6 (dual specificity phosphatase 6 [Source:ZFIN;Acc:ZDB-GENE-030613-1])

HSP 1 Score: 84.3445 bits (207), Expect = 4.163e-18
Identity = 52/127 (40.94%), Postives = 72/127 (56.69%), Query Frame = 1
Query:   82 LWLGSYEDASNVDLLKSLQIKYILTVMDSP--LLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGR-KFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIK-EKSFICPNDGFMKQL 450
            L+LG   D++N+  L    I+YIL V  +         DF YK I   D  +Q+L  +F E   FI+  R K  GVL+HCLAGISRS T+  AY+M+   +  NDA + ++ +K+ I PN  FM QL
Sbjct:  227 LYLGCARDSTNLAALAEHGIRYILNVTPNVPNAFESRRDFVYKQIPVPDHWSQNLSQFFPEAIAFIDEARQKKCGVLVHCLAGISRSVTVTVAYLMQTLNLSLNDAYDLVRNKKANISPNFNFMGQL 353          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006071.1 (pep scaffold:Pmarinus_7.0:GL479824:161791:175185:-1 gene:ENSPMAG00000005490.1 transcript:ENSPMAT00000006071.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.337 bits (194), Expect = 4.556e-18
Identity = 48/122 (39.34%), Postives = 71/122 (58.20%), Query Frame = 1
Query:  103 DASNVDLLKSLQIKYILTVMDSPLLHKMEDFNYKFIKAYDVPN----QDLISYFDETSEFIENGRKFG-GVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIK-EKSFICPNDGFMKQL 450
            DA ++  L+ L I  +L V      ++    +YK + A D  N    Q+L  YF+E  EFIE+  + G G+L+HC AG+SRS TI+ AY+MKH ++   DA + +K ++  I PN  FM QL
Sbjct:    1 DAQDLSKLQRLGIGLVLNVTAH---YERGGLHYKRLPANDSDNDSDKQNLRQYFEEAFEFIEDAHRRGQGLLVHCQAGVSRSATIVIAYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQL 119          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Sea Lamprey
Match: dusp10 (dual specificity phosphatase 10 [Source:ZFIN;Acc:ZDB-GENE-041014-271])

HSP 1 Score: 77.0258 bits (188), Expect = 1.273e-16
Identity = 55/127 (43.31%), Postives = 77/127 (60.63%), Query Frame = 1
Query:   82 LWLGSYEDASNVDLLKSLQIKYILTVMDS-PLLH-KMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGRKFG-GVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIK-EKSFICPNDGFMKQL 450
            L+LG+ +DA ++  L+ L I YI+ V    PL H +     YK + A D   Q+L  YF+E  EFIE   + G G+LIHC AG+SRS TI+ AY+MKH ++   DA + +K ++  I PN  FM QL
Sbjct:   54 LFLGNEQDAQDLAQLQRLNIGYIINVTSHLPLYHYERGALRYKRLPATDSCKQNLRQYFEEAFEFIEEAYQSGKGLLIHCQAGVSRSATIVIAYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQL 180          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Yeast
Match: YVH1 (Dual specificity protein phosphatase; regulates growth, sporulation, and glycogen accumulation in a cAMP-dependent protein kinase cascade dependent manner; mutants are defective in 60S ribosome assembly; positively regulates pre-autophagosomal structure (PAS) formation upon nitrogen starvation or rapamycin treatment [Source:SGD;Acc:S000001465])

HSP 1 Score: 115.931 bits (289), Expect = 1.972e-29
Identity = 94/325 (28.92%), Postives = 142/325 (43.69%), Query Frame = 1
Query:  121 LLKSLQIKYILTVMDSPLLHK---MEDFNYKFIKAYDVPNQDLISYFDETSEFIEN------------------GRKFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIK-EKSFICPNDGFMKQLKIYFNMKCTGD--------YKSDEYKQFIRLFSPDDINKCTNTVSQAQFNLSKSSTDLIQF-----------KCKKCRFLLFDNSSVVEHSKMKASKT----------------ITENTICNEEIFIEALPWIDSSSANG----GKVNCPKCACKLGSYTWVGERCVCGNWVVPAFHIAKQKVD--PVKSMSF 906
            L     I +IL+V+   ++ +    + +  K I   D    D++ YFDET+ FI+                     + G V  HC AG+SRS T + AY+M  + +  + A+  +K +K  + PN+ FM+QL ++  M   GD        YK  + KQ I+L  P      +N+     F  S+SS DL +            +CKKCR  L  ++S + H       +                I E+       FIE L W+           GK +CP C+ K+G Y W G RC CG WV+PA H+   KVD  P++S + 
Sbjct:   33 LGAEFNITHILSVIKFQVIPEYLIRKGYTLKNIPIDDDDVTDVLQYFDETNRFIDQCLFPNEVEYSPRLVDFKKKPQRGAVFAHCQAGLSRSVTFIVAYLMYRYGLSLSMAMHAVKRKKPSVEPNENFMEQLHLFEKM--GGDFVDFDNPAYKQWKLKQSIKL-DPSGSELVSNS---GMFKDSESSQDLDKLTEAEKSKVTAVRCKKCRTKLALSTSFIAHDPPSKESSEGHFIKRAANSHRIIDIQESQANCSHFFIEPLKWMQPELQGKQELEGKFSCPGCSSKVGGYNWKGSRCSCGKWVIPAIHLQTSKVDQFPLQSTAL 351          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Yeast
Match: MSG5 (Dual-specificity protein phosphatase; exists in 2 isoforms; required for maintenance of a low level of signaling through the cell integrity pathway, adaptive response to pheromone; regulates and is regulated by Slt2p; dephosphorylates Fus3p; MSG5 has a paralog, SDP1, that arose from the whole genome duplication [Source:SGD;Acc:S000004998])

HSP 1 Score: 48.1358 bits (113), Expect = 1.386e-6
Identity = 36/113 (31.86%), Postives = 55/113 (48.67%), Query Frame = 1
Query:  298 VLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKEKSF-ICPNDGFMKQLKIYFNMKCTGDYKSDEYKQFIRLFSPDDI-----NKCTNTVSQAQF-------NLSKSSTD 597
            +L+HC  G+SRS +++ AYIM+++ +  NDA  K+K  +  I PN G + QL  +  M         E  + + +   DDI     +  T + S A F       NLS S  D
Sbjct:  315 ILVHCQCGVSRSASLIVAYIMRYYGLSLNDAYNKLKGVAKDISPNMGLIFQLMEWGTMLSKN--SPGEEGETVHMPEEDDIGNNEVSSTTKSYSSASFRSFPMVTNLSSSPND 425          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Nematostella
Match: EDO34381 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPK6])

HSP 1 Score: 172.94 bits (437), Expect = 6.596e-51
Identity = 113/289 (39.10%), Postives = 153/289 (52.94%), Query Frame = 1
Query:   79 NLWLGSYEDASNVDLLKSLQIKYILTVMDSPLLHKMEDFNYK---FIKAYDVPNQDLISYFDETSEFIENGRKFG-GVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKE--KSFICPNDGFMKQLKIYFNMKCTGDYKSDEYKQFIRLFSPDDINKCTNTVSQAQFNLS-KSSTDLIQ--FKCKKCRFLLFDNSSVVEH---------SKMKASKTITENTICNEEIFIEALPWIDSS--SANGGKVNCPKCACKLGSYTWVGERCVCGNWVVPAFHIAKQKVD 885
             L+ G+ EDA N   LK   I  +LT+ DS  L  ++D   K   F+   D PN DL+S+ DE   FIE+G K    VL+HCLAG+SRS  ++ AYIMK  ++  +DA+ K+ E   S I PN GF+ QLKIY  M C  +  S  +KQ+        I   T   S A F L  KS  +  Q  +KCKKCR  LF++ S VEH          K   +   T   +C   +FIE + W+ S       GK+ CPKC+ +LGS+ W G +C C  W+ PAF   K ++D
Sbjct:    7 GLYAGTREDAMNYCQLKEAAINRVLTI-DSQSLPDLQDDRQKKSLFVYCLDEPNADLLSHLDECIRFIEDGIKHEEPVLVHCLAGVSRSIAVILAYIMKSDQVSLDDAVNKMSEIYSSEISPNQGFLDQLKIYEEMGCKVNTSSALFKQYRLQLLASQIQG-TIFTSCALFILEFKSPMERSQNIYKCKKCRVTLFNSGSTVEHETGSMPFNWQKKDQTHLNTSMPLCTS-LFIEPVEWMLSGLQGTVAGKICCPKCSARLGSFNWAGMQCSCAAWITPAFQFHKNRID 292          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Nematostella
Match: EDO37000 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGZ1])

HSP 1 Score: 89.7373 bits (221), Expect = 1.278e-21
Identity = 54/132 (40.91%), Postives = 77/132 (58.33%), Query Frame = 1
Query:   82 LWLGSYEDASNVDLLKSLQIKYILTVMDSPL----LHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGRKFGG-VLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKEKS-FICPNDGFMKQLKIY 459
            L+LGS E A++ DL+  L IK+IL +  +P+      + ED  YK I+  D   +D+  +FDE   FI+  R  G  VL+HC AG+SRS T+  AY+M+H  +  N+A + +KEK   I PN  FM  L  Y
Sbjct:    5 LFLGSEEGAADEDLIDRLAIKFILNL--TPVCPNFFSEREDIIYKRIQINDSYQEDIGQHFDEAIAFIDEARSRGSSVLVHCHAGVSRSATVTVAYVMQHLGLSLNEAYQFVKEKRPTISPNLNFMGHLLKY 134          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Nematostella
Match: EDO34920 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN01])

HSP 1 Score: 89.3521 bits (220), Expect = 2.413e-21
Identity = 54/136 (39.71%), Postives = 80/136 (58.82%), Query Frame = 1
Query:   82 LWLGSYEDASNVDLLKSLQIKYILTVMDS--PLLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGR-KFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIK-EKSFICPNDGFMKQLKIYFNMKCT 477
            L+LG+  D+ + + L+   I +IL++ D+  PL    ED  YK I A D P+QDL+ +F E  EFI + R K    L+HC+AGISRS TI  AYIM   ++     ++ I+  +S   PN GF +QL+ ++N   T
Sbjct:   12 LYLGNIRDSKDAEQLQEHNITHILSIHDNANPL---REDIMYKCIHAADSPDQDLMPFFQECIEFIHSCRVKEMNCLVHCIAGISRSTTICAAYIMTITELSWRQTLQAIRANRSIANPNYGFKRQLQDFYNKHLT 144          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Nematostella
Match: EDO45432 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTA2])

HSP 1 Score: 88.9669 bits (219), Expect = 8.546e-20
Identity = 56/127 (44.09%), Postives = 74/127 (58.27%), Query Frame = 1
Query:   82 LWLGSYEDASNVDLLKSLQIKYILTVM-DSP-LLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGR-KFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIK-EKSFICPNDGFMKQL 450
            L+LGS +DASN++LL+  +I Y+L V  D P     +E F YK +   D    +L   F E   FI+ GR K   VL+HCLAGISRS TI  AY+M    +  N+A + +K  KS + PN  FM QL
Sbjct:  193 LYLGSEKDASNIELLRKHKISYVLNVTHDRPNTFAHIEGFKYKNLPVEDNLMANLTELFPEAFAFIDEGRQKSSNVLVHCLAGISRSVTITIAYLMSSQHLSLNEAYDFVKARKSNVSPNFNFMGQL 319          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Nematostella
Match: EDO35438 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLH2])

HSP 1 Score: 79.7221 bits (195), Expect = 3.951e-18
Identity = 43/124 (34.68%), Postives = 70/124 (56.45%), Query Frame = 1
Query:   82 LWLGSYEDASNVDLLKSLQIKYILTVMDSPLLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGRKFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKE-KSFICPNDGFMKQL 450
            L+LGS + A   + L+   I +IL V    +    +DF YK I+  D+P  DL++   +  +FI +G + G VL+HC AG+SRS  ++ AY+M    +    A   ++E +  + PN+GF +QL
Sbjct:    5 LFLGSQDGAHCYEELQRNNITHILNVATGVVNVFAKDFTYKNIELLDLPETDLVAQLPQMFQFINDGLQAGAVLVHCNAGVSRSPAVVIAYLMHKRLLSLGQAFNVVREQRPCVKPNEGFWRQL 128          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Medaka
Match: dusp12 (dual specificity phosphatase 12 [Source:NCBI gene;Acc:101155145])

HSP 1 Score: 160.614 bits (405), Expect = 1.022e-45
Identity = 94/290 (32.41%), Postives = 154/290 (53.10%), Query Frame = 1
Query:   79 NLWLGSYEDASNVDLLKSLQIKYILTVMD---SPLLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGRKFGGV-LIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKE-KSFICPNDGFMKQLKIYFNMKCTGDYKSDEYKQFIRLFSPDDINKCTNTVSQAQF--NLSKSSTDLIQFKCKKCRFLLFDNSSVVEHSKMKASKTITENTICN-------EEIFIEALPWIDSS--SANGGKVNCPKCACKLGSYTWVGERCVCGNWVVPAFHIAKQKVDPVKSM 900
             +++G+  D ++   L +  + +IL+V      P +    +F  K+I A D    DL+SY D  + FI+   K GG  L+HC AG SRS TI+TAY+MK   +   +A +++K  K  +  N GF +QL++Y +M C  D  S  YKQ+ RL    +       V +  F  + + SS+  + ++C+KCR  LF  SS++ H     +   +     N          FIE + W++ +      G++ CPKC+ KLGS++W G++C CG WV PAF + + +VD ++ +
Sbjct:    7 GVYIGTAADLNDCQALAAASVTHILSVESVDPGPQIPATGNFIRKWINALDEETTDLLSYLDACNIFIDEAVKGGGATLVHCHAGRSRSATIVTAYLMKKHHLAFPEAYQRLKSVKQDVQVNRGFEEQLQLYESMLCQVDTSSALYKQY-RLNKIAERYPELQQVPRDIFANDPAHSSSSEVSYRCRKCRRTLFRGSSILSHPVGDGASAFSHKKTSNLSGEVQCTSYFIEPVQWMEQALLGVMNGQLLCPKCSSKLGSFSWCGDQCSCGRWVTPAFQLHRNRVDEIRQI 295          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Medaka
Match: dusp7 (dual specificity phosphatase 7 [Source:NCBI gene;Acc:101158099])

HSP 1 Score: 91.2781 bits (225), Expect = 8.542e-20
Identity = 61/152 (40.13%), Postives = 85/152 (55.92%), Query Frame = 1
Query:   82 LWLGSYEDASNVDLLKSLQIKYILTVMDS-PLLHKME-DFNYKFIKAYDVPNQDLISYFDETSEFIENGR-KFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIK-EKSFICPNDGFMKQL-----KIYFNMKCTGDYKSDEYKQF 510
            L+LG  +D++N+D+L    IKYIL V  + P + + E DF YK I   D  +Q+L  +F E   FI+  R K  G+L+HCLAGISRS T+  AY+M+   +  NDA + +K +KS I PN  FM QL      +  N  C     S  + Q 
Sbjct:  214 LYLGCAKDSANLDVLSKYNIKYILNVTPNLPNMFEHEGDFKYKQIPISDHWSQNLSQFFPEAISFIDEARSKKCGILVHCLAGISRSVTVTVAYLMQKLNLSLNDAYDFVKRKKSNISPNFNFMGQLLDFERTLGLNSPCDNHSASPPHDQL 365          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Medaka
Match: dusp6 (dual specificity phosphatase 6 [Source:NCBI gene;Acc:101164462])

HSP 1 Score: 90.1225 bits (222), Expect = 1.920e-19
Identity = 56/128 (43.75%), Postives = 79/128 (61.72%), Query Frame = 1
Query:   79 NLWLGSYEDASNVDLLKSLQIKYILTVMDS-P-LLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGR-KFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIK-EKSFICPNDGFMKQL 450
            +L+LG  +D++N+D+L+   IKYIL V  + P L     +F YK I   D  +Q+L  +F E   FI+  R +  GVL+HCLAGISRS T+  AY+M+   +  NDA + +K +KS I PN  FM QL
Sbjct:  214 HLYLGCAKDSTNLDVLEEYGIKYILNVTPNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGQKRGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQL 341          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Medaka
Match: ENSORLT00000014597.2 (dual specificity protein phosphatase 7 [Source:NCBI gene;Acc:101175078])

HSP 1 Score: 87.8113 bits (216), Expect = 9.818e-19
Identity = 56/129 (43.41%), Postives = 77/129 (59.69%), Query Frame = 1
Query:   82 LWLGSYEDASNVDLLKSLQIKYILTVMDSPLLHKMED----FNYKFIKAYDVPNQDLISYFDETSEFIENGR-KFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIK-EKSFICPNDGFMKQL 450
            L+LG  +D++N+D+L    I YIL V  +P L  M +    F YK I   D  +Q+L  +F E   FI+  R K  G+L+HCLAGISRS T+  AY+M+   +  NDA + +K +KS I PN  FM QL
Sbjct:  194 LYLGCAKDSANLDVLGQYNITYILNV--TPNLPNMFEHDGHFRYKQIPISDHWSQNLSQFFPEAISFIDEARSKRCGILVHCLAGISRSVTVTVAYLMQRLNLSLNDAYDFVKRKKSNISPNFNFMGQL 320          
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Medaka
Match: si:ch211-203d1.3 (slingshot protein phosphatase 3 [Source:NCBI gene;Acc:101173795])

HSP 1 Score: 87.0409 bits (214), Expect = 4.276e-18
Identity = 50/141 (35.46%), Postives = 77/141 (54.61%), Query Frame = 1
Query:   82 LWLGSYEDASNVDLLKSLQIKYILTVMDSPLLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGRKFG-GVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKE-KSFICPNDGFMKQLKIYFNMKCTGDYKSDE 498
            L+LGS  +A+N + L+   + YIL V         E F Y  I+ YDV + +L+ ++ +T  FI   RK G  VL+HC  G+SRS + + AY MK  +     A+  ++E +S + PN+GFMKQL+ Y  +      +  E
Sbjct:  308 LYLGSEWNAANFEELQKNNVGYILNVTREIDNFFPESFTYMNIRVYDVESTNLLPHWPDTYNFINTARKTGQAVLVHCKMGVSRSASTVIAYAMKQQRWSLETALTYVRECRSIVNPNEGFMKQLQTYNGILTASQMRHSE 448          
BLAST of dual specificity protein phosphatase 12 vs. Planmine SMEST
Match: SMESG000014789.1 (SMESG000014789.1)

HSP 1 Score: 573.933 bits (1478), Expect = 0.000e+0
Identity = 277/277 (100.00%), Postives = 277/277 (100.00%), Query Frame = 1
Query:   76 SNLWLGSYEDASNVDLLKSLQIKYILTVMDSPLLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGRKFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKEKSFICPNDGFMKQLKIYFNMKCTGDYKSDEYKQFIRLFSPDDINKCTNTVSQAQFNLSKSSTDLIQFKCKKCRFLLFDNSSVVEHSKMKASKTITENTICNEEIFIEALPWIDSSSANGGKVNCPKCACKLGSYTWVGERCVCGNWVVPAFHIAKQKVDPVKSMSF 906
            SNLWLGSYEDASNVDLLKSLQIKYILTVMDSPLLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGRKFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKEKSFICPNDGFMKQLKIYFNMKCTGDYKSDEYKQFIRLFSPDDINKCTNTVSQAQFNLSKSSTDLIQFKCKKCRFLLFDNSSVVEHSKMKASKTITENTICNEEIFIEALPWIDSSSANGGKVNCPKCACKLGSYTWVGERCVCGNWVVPAFHIAKQKVDPVKSMSF
Sbjct:    6 SNLWLGSYEDASNVDLLKSLQIKYILTVMDSPLLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGRKFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKEKSFICPNDGFMKQLKIYFNMKCTGDYKSDEYKQFIRLFSPDDINKCTNTVSQAQFNLSKSSTDLIQFKCKKCRFLLFDNSSVVEHSKMKASKTITENTICNEEIFIEALPWIDSSSANGGKVNCPKCACKLGSYTWVGERCVCGNWVVPAFHIAKQKVDPVKSMSF 282          
BLAST of dual specificity protein phosphatase 12 vs. Planmine SMEST
Match: SMESG000001338.1 (SMESG000001338.1)

HSP 1 Score: 155.221 bits (391), Expect = 5.890e-44
Identity = 99/283 (34.98%), Postives = 142/283 (50.18%), Query Frame = 1
Query:   82 LWLGSYEDASNVDLLKSLQIKYILTVMDSPL---LHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGRKFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKEK-SFICPNDGFMKQLKIYFNMKCTGDYKSDEYKQFIRLFSPDDINKCTNTVSQAQFNLSKSSTDLIQFKCKKCRFLLFDNSSVVEH------------SKMKASKTITENTICNEEIFIEALPWIDSSSANGGKVNCPKCACKLGSYTWVGERCVCGNWVVPAFHIAKQKV 882
            L+LG Y+DA+N D+L    I +ILTV +  L    HK   F Y F++       DL+S F ET+EFIE G   GGVLIHC  G++RS T++ A+IM   K    +A + +K K + ICP D FM QL++Y  M    D     Y+ +   F+       +    ++ F       +   F+C KC+F LF   ++  H            S  +  +     T  NE I++E + W+D +S + G VNCP C  K+G Y   GE C CG WV PA  I +  +
Sbjct:    8 LFLGGYDDATNSDILMKNNITHILTVHELKLSRNYHK--GFQYMFVETKSDQEIDLLSRFVETNEFIEKGMNSGGVLIHCQFGMARSATLVIAFIMSLQKTTVQEAFDFVKRKRNIICPTDSFMYQLRLYEFMNYKLDLSIPIYRLYKNFFA------ISKKFDKSNFVFGSIDRNQKIFQCYKCKFDLFSEGNINFHLSEENEIDFILSSFFECLEEKNMKTCKNENIYVELMDWMDLNSVSRGDVNCPGCNMKIGKYCLNGEFCSCGIWVFPAVFIDRLSI 282          
BLAST of dual specificity protein phosphatase 12 vs. Planmine SMEST
Match: SMESG000078269.1 (SMESG000078269.1)

HSP 1 Score: 86.2705 bits (212), Expect = 3.375e-18
Identity = 51/143 (35.66%), Postives = 87/143 (60.84%), Query Frame = 1
Query:   82 LWLGSYEDASNVDLLKSLQIKYILTVMDSPLLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENG-RKFGGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKEKSFIC-PNDGFMKQL-KIYFNMKCTGDYKSDEY 501
            L+LG+  D++++++L+  +I +IL V  +   ++ + F YK + A D   QD+ +Y+DE  +FI+    K G VL+HC AG+SRS TI+ AY++KH K+     I  ++ K  I  PN  F+ QL + Y +++   + +S EY
Sbjct:  232 LFLGNEMDSNDIEVLQEKKITHILNVTTNVPFYREDLFVYKRLSATDCNRQDMRAYYDEAIQFIDEAYSKNGKVLVHCWAGVSRSATIVAAYLLKHTKLSVLQTIMFLQSKRPIVEPNFNFLGQLERFYCDLEKGVESRSKEY 374          
BLAST of dual specificity protein phosphatase 12 vs. Planmine SMEST
Match: SMESG000070817.1 (SMESG000070817.1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.841e-17
Identity = 51/128 (39.84%), Postives = 74/128 (57.81%), Query Frame = 1
Query:   82 LWLGSYEDASNVDLLKSLQIKYILTVMDSPLLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGRKFGGV-LIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIK-EKSFICPNDGFMKQLKIY 459
            L+LGS  +ASN + L   +I +IL V         + F Y+ I  +D  +  L+ +FD   +FI   +   GV L+HC  GISRS +I+ +YIMK F +    A+E +K ++  I PNDGFM+QLK Y
Sbjct:  312 LYLGSTYNASNFEELVKNKITHILNVTRESENFFRDQFEYENILVFDNEDTKLLKHFDLCHKFITQAKIINGVCLVHCQRGISRSASIVISYIMKEFNMTFEKALEFVKGKRDCIKPNDGFMQQLKTY 439          
BLAST of dual specificity protein phosphatase 12 vs. Planmine SMEST
Match: SMESG000035381.1 (SMESG000035381.1)

HSP 1 Score: 79.337 bits (194), Expect = 5.555e-16
Identity = 55/140 (39.29%), Postives = 81/140 (57.86%), Query Frame = 1
Query:   82 LWLGSYEDASNVDLLKSLQIKYILTV-MDSPLLHKMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGRKFGG-VLIHCLAGISRSGTILTAYIMKH-FKIDPNDAIEKIK-EKSFICPNDGFMKQLKIYFNMKCTGDYK 489
            L+LG+  DA N   L + +I ++L V + +  L +++ F  K I   D   QDLI +F +  +FIE  RK  G +L+HC AGISRS TI+ AY+M H   +D N+A + +K  ++ I PN  FM QL  + N    G +K
Sbjct:  221 LYLGNELDALNSTFLTNNKITHVLNVTIKASFLDEIK-FKSKRINCNDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLINGTFK 359          
The following BLAST results are available for this feature:
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DUSP123.955e-4234.34dual specificity phosphatase 12 [Source:HGNC Symbo... [more]
DUSP195.192e-2139.84dual specificity phosphatase 19 [Source:HGNC Symbo... [more]
DUSP62.912e-2044.88dual specificity phosphatase 6 [Source:HGNC Symbol... [more]
DUSP94.851e-2044.53dual specificity phosphatase 9 [Source:HGNC Symbol... [more]
DUSP94.851e-2044.53dual specificity phosphatase 9 [Source:HGNC Symbol... [more]
back to top
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Y54F10BM.133.020e-2039.84pep chromosome:WBcel235:III:2329577:2331183:-1 gen... [more]
C24F3.21.722e-1726.64pep chromosome:WBcel235:IV:10222472:10223745:1 gen... [more]
vhp-13.190e-1538.81Tyrosine-protein phosphatase vhp-1 [Source:UniPro... [more]
vhp-13.190e-1538.81Tyrosine-protein phosphatase vhp-1 [Source:UniPro... [more]
vhp-13.431e-1538.81Tyrosine-protein phosphatase vhp-1 [Source:UniPro... [more]
back to top
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MKP-43.220e-3126.41gene:FBgn0031044 transcript:FBtr0074741[more]
MKP-43.220e-3126.41gene:FBgn0031044 transcript:FBtr0332481[more]
CG100892.190e-1835.07gene:FBgn0036369 transcript:FBtr0075823[more]
CG100892.501e-1835.07gene:FBgn0036369 transcript:FBtr0075821[more]
CG100892.501e-1835.07gene:FBgn0036369 transcript:FBtr0075822[more]
back to top
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dusp121.550e-4434.44dual specificity phosphatase 12 [Source:ZFIN;Acc:Z... [more]
dusp121.550e-4434.44dual specificity phosphatase 12 [Source:ZFIN;Acc:Z... [more]
dusp122.731e-4134.38dual specificity phosphatase 12 [Source:ZFIN;Acc:Z... [more]
dusp123.800e-2031.13dual specificity phosphatase 12 [Source:ZFIN;Acc:Z... [more]
dusp68.727e-2043.85dual specificity phosphatase 6 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fcn34.235e-4332.88ficolin 3 [Source:Xenbase;Acc:XB-GENE-6054553][more]
npc1l12.141e-2041.73NPC1 like 1 [Source:Xenbase;Acc:XB-GENE-964011][more]
usp488.938e-2044.09ubiquitin specific peptidase 48 [Source:Xenbase;Ac... [more]
lrit29.161e-2043.75leucine-rich repeat, Ig-like and transmembrane dom... [more]
eci14.281e-1944.19enoyl-CoA delta isomerase 1 [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dusp126.720e-4133.00dual specificity phosphatase 12 [Source:MGI Symbol... [more]
Dusp193.878e-2139.06dual specificity phosphatase 19 [Source:MGI Symbol... [more]
Dusp68.491e-2044.09dual specificity phosphatase 6 [Source:MGI Symbol;... [more]
Dusp99.539e-2044.53dual specificity phosphatase 9 [Source:MGI Symbol;... [more]
Dusp72.051e-1844.53dual specificity phosphatase 7 [Source:MGI Symbol;... [more]
back to top
BLAST of dual specificity protein phosphatase 12 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9JIM4|DUS12_RAT3.498e-4334.56Dual specificity protein phosphatase 12 OS=Rattus ... [more]
sp|Q9UNI6|DUS12_HUMAN1.899e-4134.34Dual specificity protein phosphatase 12 OS=Homo sa... [more]
sp|Q9D0T2|DUS12_MOUSE4.701e-4033.00Dual specificity protein phosphatase 12 OS=Mus mus... [more]
sp|O13632|PVH1_SCHPO4.378e-3731.32Tyrosine-protein phosphatase yvh1 OS=Schizosacchar... [more]
sp|Q9VWF4|DUSK4_DROME3.228e-3026.41Dual specificity protein phosphatase MPK-4 OS=Dros... [more]
back to top
BLAST of dual specificity protein phosphatase 12 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JIV52.875e-6139.20dual specificity protein phosphatase 12 OS=Lingula... [more]
A0A210QP867.036e-5637.87Dual specificity protein phosphatase 12 OS=Mizuhop... [more]
A0A5K3ETZ79.473e-5539.30Uncharacterized protein OS=Mesocestoides corti OX=... [more]
K1QLY74.547e-5437.29Dual specificity protein phosphatase 12 OS=Crassos... [more]
V3ZYI81.122e-5335.43Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
back to top
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dusp121.850e-4131.79dual specificity phosphatase 12 [Source:NCBI gene;... [more]
dusp128.871e-2228.86dual specificity phosphatase 12 [Source:NCBI gene;... [more]
dusp122.306e-2128.86dual specificity phosphatase 12 [Source:NCBI gene;... [more]
dusp63.190e-2035.91dual specificity phosphatase 6 [Source:NCBI gene;A... [more]
dusp64.441e-2035.91dual specificity phosphatase 6 [Source:NCBI gene;A... [more]
back to top
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dusp71.193e-2144.53dual specificity phosphatase 7 [Source:ZFIN;Acc:ZD... [more]
dusp22b5.943e-1934.62dual specificity phosphatase 22b [Source:NCBI gene... [more]
dusp64.163e-1840.94dual specificity phosphatase 6 [Source:ZFIN;Acc:ZD... [more]
ENSPMAT00000006071.14.556e-1839.34pep scaffold:Pmarinus_7.0:GL479824:161791:175185:-... [more]
dusp101.273e-1643.31dual specificity phosphatase 10 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
YVH11.972e-2928.92Dual specificity protein phosphatase; regulates gr... [more]
MSG51.386e-631.86Dual-specificity protein phosphatase; exists in 2 ... [more]
back to top
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO343816.596e-5139.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO370001.278e-2140.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349202.413e-2139.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454328.546e-2044.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354383.951e-1834.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of dual specificity protein phosphatase 12 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dusp121.022e-4532.41dual specificity phosphatase 12 [Source:NCBI gene;... [more]
dusp78.542e-2040.13dual specificity phosphatase 7 [Source:NCBI gene;A... [more]
dusp61.920e-1943.75dual specificity phosphatase 6 [Source:NCBI gene;A... [more]
ENSORLT00000014597.29.818e-1943.41dual specificity protein phosphatase 7 [Source:NCB... [more]
si:ch211-203d1.34.276e-1835.46slingshot protein phosphatase 3 [Source:NCBI gene;... [more]
back to top
BLAST of dual specificity protein phosphatase 12 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014789.10.000e+0100.00SMESG000014789.1[more]
SMESG000001338.15.890e-4434.98SMESG000001338.1[more]
SMESG000078269.13.375e-1835.66SMESG000078269.1[more]
SMESG000070817.11.841e-1739.84SMESG000070817.1[more]
SMESG000035381.15.555e-1639.29SMESG000035381.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022703 ID=SMED30022703|Name=dual specificity protein phosphatase 12|organism=Schmidtea mediterranea sexual|type=transcript|length=1254bp
TTGGAATAATTAAAATAAAATTGTTTAAATATTATATTGTAAAATGAATT
AATTTTAATCATGAAAGAAATAATATCAAATTTATGGCTTGGATCATACG
AAGATGCATCAAATGTAGATTTGTTGAAATCATTGCAAATAAAGTACATA
TTAACAGTAATGGATAGTCCATTGTTACATAAAATGGAAGACTTTAATTA
CAAATTTATTAAAGCTTATGATGTTCCAAACCAAGACCTTATTTCTTATT
TCGATGAAACCAGTGAATTCATTGAAAATGGTAGAAAATTTGGTGGAGTT
CTAATTCATTGTCTTGCCGGAATTTCAAGAAGTGGAACTATTTTAACAGC
TTATATAATGAAACATTTTAAAATTGATCCAAACGATGCAATTGAGAAAA
TTAAAGAAAAGTCATTTATATGCCCAAATGATGGATTTATGAAACAATTA
AAGATATATTTCAACATGAAATGCACCGGTGATTACAAAAGCGATGAGTA
CAAACAATTTATCCGTCTATTTTCTCCAGATGATATCAATAAATGTACAA
ATACAGTTTCGCAAGCTCAATTTAATTTATCAAAATCTTCTACTGATTTA
ATCCAATTCAAATGCAAAAAGTGCAGATTTTTGTTATTCGACAATTCAAG
TGTTGTCGAGCACAGTAAAATGAAAGCTTCGAAAACAATAACCGAGAACA
CTATTTGCAACGAGGAAATATTTATTGAAGCTCTTCCTTGGATTGATAGC
AGCAGTGCAAATGGTGGAAAGGTTAACTGTCCGAAATGTGCTTGCAAATT
GGGCTCCTATACCTGGGTCGGAGAACGATGCGTTTGTGGCAATTGGGTCG
TGCCTGCATTTCACATTGCCAAGCAAAAGGTTGATCCAGTCAAATCGATG
AGTTTTTAATCACTTTCCGAAGAATTAAAAATTTATCAAGGAAACATTTA
GAATAAAAAACGACTTTGATAATATTCTTAAGTTTAGATTTATATCGATT
TTTAATTATAGATTTTCTATTGTATTGTCGATCGATTTTTAACCTGTTTT
GTGTAGATTTTTATGGTCATTTTTGTTTTTTATCGGATAGAGGGTTTTAT
TGGGCTTGTTGGTGGTTTTAAGGCGGTTTTGGATTGTAATTTGATAATTC
GTCGGTTTTCTGATAATTGGACGTCTTTAGTTTTTGGCGTTTATTTGGAT
AATATTTTTTAGTGCAAATGGATTCATGTTGGTTGTAATTCGCTTAGTTT
CGTT
back to top

protein sequence of SMED30022703-orf-1

>SMED30022703-orf-1 ID=SMED30022703-orf-1|Name=SMED30022703-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=283bp
MKEIISNLWLGSYEDASNVDLLKSLQIKYILTVMDSPLLHKMEDFNYKFI
KAYDVPNQDLISYFDETSEFIENGRKFGGVLIHCLAGISRSGTILTAYIM
KHFKIDPNDAIEKIKEKSFICPNDGFMKQLKIYFNMKCTGDYKSDEYKQF
IRLFSPDDINKCTNTVSQAQFNLSKSSTDLIQFKCKKCRFLLFDNSSVVE
HSKMKASKTITENTICNEEIFIEALPWIDSSSANGGKVNCPKCACKLGSY
TWVGERCVCGNWVVPAFHIAKQKVDPVKSMSF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
GO:0008138protein tyrosine/serine/threonine phosphatase activity
GO:0016791phosphatase activity
GO:0004725protein tyrosine phosphatase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR003595Tyr_Pase_cat
IPR020422TYR_PHOSPHATASE_DUAL_dom
IPR016278DUSP12
IPR000340Dual-sp_phosphatase_cat-dom
IPR029021Prot-tyrosine_phosphatase-like
IPR016130Tyr_Pase_AS
IPR000387TYR_PHOSPHATASE_dom
IPR011528NERD
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
GO:0016311dephosphorylation
GO:0035335peptidyl-tyrosine dephosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020422Dual specificity protein phosphatase domainSMARTSM00195dsp_5coord: 1..136
e-value: 2.2E-36
score: 136.9
IPR020422Dual specificity protein phosphatase domainPROSITEPS50054TYR_PHOSPHATASE_DUALcoord: 1..130
score: 31.585
IPR003595Protein-tyrosine phosphatase, catalyticSMARTSM00404ptp_7coord: 41..190
e-value: 0.002
score: 19.4
IPR016278Dual specificity protein phosphatase 12PIRSFPIRSF000941DUSP12coord: 1..282
e-value: 2.3E-70
score: 234.9
IPR000340Dual specificity phosphatase, catalytic domainPFAMPF00782DSPccoord: 8..134
e-value: 9.9E-29
score: 99.8
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 1..143
e-value: 4.9E-43
score: 148.7
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 3..136
NoneNo IPR availablePANTHERPTHR45848FAMILY NOT NAMEDcoord: 6..279
NoneNo IPR availablePANTHERPTHR45848:SF2DUAL SPECIFICITY PROTEIN PHOSPHATASE 12coord: 6..279
NoneNo IPR availableCDDcd14498DSPcoord: 3..131
e-value: 1.91247E-52
score: 165.797
IPR016130Protein-tyrosine phosphatase, active sitePROSITEPS00383TYR_PHOSPHATASE_1coord: 82..92
IPR000387Tyrosine specific protein phosphatases domainPROSITEPS50056TYR_PHOSPHATASE_2coord: 58..117
score: 14.169