Dynein heavy chain 7 axonemal

Overview
NameDynein heavy chain 7 axonemal
Smed IDSMED30022681
Length (bp)12245
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynein heavy chain 7 axonemal (SMED30022681) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynein heavy chain 7 axonemal (SMED30022681) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynein heavy chain 7 axonemal (SMED30022681) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynein heavy chain 7 axonemal (SMED30022681) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022681

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 21

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30022681SMESG000012956.1 SmedASXL_077773SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30022681SMESG000040511.1 SMESG000012956.1 SmedASXL_018113SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30022681SMESG000012956.1 SmedASXL_009335SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30022681SMESG000012956.1 dd_Smed_v4_13792_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30022681SMESG000012956.1 dd_Smed_v4_13792_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30022681SMESG000012956.1 dd_Smed_v4_13792_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30022681SMESG000012956.1 dd_Smed_v4_13792_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30022681SMESG000012956.1 dd_Smed_v4_5350_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30022681SMESG000012956.1 dd_Smed_v4_5350_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30022681SMESG000012956.1 dd_Smed_v4_5350_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30022681SMESG000012956.1 dd_Smed_v4_5350_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30022681SMESG000012956.1 dd_Smed_v4_5350_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30022681SMESG000012956.1 dd_Smed_v6_5350_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30022681SMESG000012956.1 dd_Smed_v4_13792_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30022681SMESG000012956.1 dd_Smed_v4_13792_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30022681SMESG000012956.1 dd_Smed_v4_13792_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022681SMESG000012956.1 dd_Smed_v4_5350_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30022681SMESG000012956.1 dd_Smed_v4_5350_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30022681SMESG000012956.1 dd_Smed_v4_5350_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ventral epidermisSMED30022681SMESG000012956.1 dd_Smed_v4_5350_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30022681SMESG000012956.1 dd_Smed_v4_5350_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Human
Match: DNAH7 (dynein axonemal heavy chain 7 [Source:HGNC Symbol;Acc:HGNC:18661])

HSP 1 Score: 5263.35 bits (13652), Expect = 0.000e+0
Identity = 2623/4051 (64.75%), Postives = 3191/4051 (78.77%), Query Frame = 3
Query:   39 SCETTSQKRGRKGPDLTKLLPTIPMKRVKPEWAQNPPSFTLDGKQK---------INEDAGIELIYELTAKPPTKPRKLKGEDLAFERSQLR-----KDREKFRKALVDMILQGEDRPIKESIETVRLPPLTQEKTPVGMSATEKDILRYYYYIHNGIDTEHVAKMEXXXXXXXXXXXXXXXXAEHPXXXXXXXXXXXXXXXXSVKKAIVDFVLKEPREKETDDTP--IPEHRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVE----------TVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHI-ITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLD 12110
            S E  + K   K P   + LP + M   KP W Q  PSF L  KQ           NE +  E + E   K    P ++    +    S+ +     K+RE FR  LV++I+Q +D  +  ++     P  +    P   SA EKDILRYYYYIH+GIDT+HVA MED W+ ++ +L+   LK    + +  L DE++EDYLLSV+K+IVDFVLK+PREK  D     +P HR E+ ++PKPW +SF+ A  + + HL   NP M  VL+LW  +FK LRLVD++EF   + A+EL  FQ+  MRH+++AKE L+K W  +VQNIYYQGNKKK +P+    A LE FFNCA+ LMT  LQ+L L SM D+T+L+  P                        D     EHPGF++RLIL++  IKFEP + D+  + LNVYD M+K +S V R+E++LYS W        L PIIL EI++ HK  ++ V++ ESV PTEH++ +DKY  LI R+ ++++D  L+E    HS+E+    +  Y  L+++I+Y S ++IRLGMFE+ C+ELIRAL KRA  +C KLL ++   H++ N  L  E+E I  KAL  P NT ++ME+  ++   E   M+ELE++L  S   L FL++Y NF+ +DM LN SVF  + RMG IF+E++K +++K E++Q  LK + ERF+EEL+SY KQ EEF + GD+ ++ +YLKK+Q+L+ KL+ A  +IE FN EEEAFGW  + YP R+++Q+ L PYL+LYETAVEF+  Y+ W EG   KV PDQV+AD+GNY+R L+KLEK F + P    +  KV++KVE+FK+H+PLIQ +  PGLR RHW+ +S IVGY L+  +   +S  +DMNLEP+I +FE ISEAA KE++LEKAMEKM  EW  +EFV+ +YRETGTFIL+SVD+IQ++LDDHI+KTQTMRGSPFIKP+E ++++WE KL+L+Q+ILDEWLKVQATWLYLEPIFSSPDIM+QMPEEGR+FT+VDKTW++IM+ V+ DK VLTV+ I++ML++LKKSNELLE ILKGLN+YLEKKRL+FPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIA + FTETLDITHMKSSE E+V L ++IST+KARGQVEKWL+ELE  MI S+     +    Y    R  WV+ W GQ VL +S  +WT  VQ AI  G +AL+ YLK  N QID+IV LVRG+LS QNR TL AL+VLDVHARDVL +L+++ +++++DF WL QLRYYW EN++ TKMIN+ L+YGYEYLGN+ RLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDY+ALGKFFKGL SCGAW+CFDEFNRIDLEVLSVVAQQILTIQR I A  D LMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFR+VAMMVPDYA+IAEI LYSCGFV ARPL+VKIVATYRLCSEQLSSQ HYDYGMRAVKSVLTAAGNLKLKYP+E+E+IL+LRSIIDVNLPKFL+HDLPLF GI SDLFPGV  P PDY+ L   IK+NC  MNL+ ++FF EKI Q+YEMMIVRHGFMIVGEPFGGKTSAY+VLA AL DICE+GLMEENKVQ T+LNPK++TMGQLYGQFD VSHEWSDGVLAVS+RAFA+S TPDRKWLIFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQ+SP  NLIFEPMDLEVASPATVSRCGM+YMEP  LGWRP+  SW+ +LP +++ I K+    +F+R +   +  I+K    ELSPTSD N+V+SL+NLIDC +D F DE K+ + + R+  + LEG+F F+  WS+GA+  ++ R  F+K+ RELM   + + TR    L            TVP         +P KGTIYDY+F+ E    G GKWE W + +K    I KD  FNEIIVPT DT++Y+ LM LL TH KP +FVGPTGTGKS YI +FLLNQ+NK+IYKP LINFSAQT+A QTQNI+MSKLD+RRKGVFGPP+GK+++VFVDD+NMP RE YGAQPPIELLRQWLDHWNWYDLKD + IKL+D+Q + AMGPPGGGRNP+TPR++RH N ITINEF D++M TIFS IL WH+ I   F  +F     Q++  T+ +YK AM NLLPTPAKSHYLFNLRDFSRVIQGV LS P T E    +KRLW HE+ RVYYDRL+ + DR W  NYI+E+   ++ EDF  LF+ LDFD DG V  DD+RSL++CDF D K  +  Y E+ D++ LR  VE +L+EYN +SKKPMNLVLFRFAIEH+SRISRILKQPRSHALLVGVGGSGRQS+TRLAA MADY +FQVEISK Y +TEW EDLK ILRK  E +   VFLF+D QIK+ESFLED++NLLNAGE+PNL+  DEKQE+C+KMRQ+DRQRDK +QTDGSP+AL+N F+   R QLH+VLAMSPIGDAFRNRLRKFP+LVNCCTIDWFQ+WPEDAL AVA+RFLE++E+ + ++DGCID+CK FHTST  LS+ + +EL RYNYVTPTSYLELISTFK LL+KKR+EV K K+RYEVGLEKL SA+S ++ MQ EL    P+L  ASKEVD+ MI++E++S E +K EKIVK +E IAN+QA A++AIK+ECD DLA A+PILESAL AL+TLT  DIT+V++M SPP GV+LVMEA+C+LKGIK D++ DP+GSGKKIEDFWGP+KRLLG+M+FL+ L  +DKDNIP   M +IR+ Y+ N DF PE+I  ASTA EGLCKWV A++ YDKVAK+VAPKKI L  A  E   AM  L KK+AALKEVQDKL  L + LE NK++K DLEN+VDLCSKKL RAEQLIGGLGGEK RW   A +LG  +INLTGDIL+SSGVVAYLGAFTS++R  +TK+W      + IPCSD  SL+ TLG+ V IR+WNI GLP+D FSI+NGIII N+RRWPLMIDPQ QANKWIKNMEK N+L VIKL++ D+VR LENCIQFGTPVLLEN+GEELDP+LEPLLLKQTFKQGGS CI+LGDS IEY+ DFRFYITTKLRNPHYLPETSVKVTLLNFMITPEG+QDQLLGIVV++ERP+LEEEK  LI Q A NK++LKE+ED+IL VLS+SEGNILEDE+AIK+L+SSK L+NEI++KQ   EETE+KID  R+GY PIAIHS+ILFFS+ADLANI+PMYQYSLTWFINLF LSI+NSEKSE L +RLQ LK +FTYSLY NVCRSLFEKDKLLFSF L  N+L H+  I + EWRFLLTGG+GLDNP+ N   WLP KSWDE+CRLDDL  F  IR+ F+  KD WKK+YDS+EPH++  P+EW ++  + F +M ++RCLRPDK++  +Q F+  R+G+ +IEPPPFDL  +F DSNC +PL+F+LSPGADPMAALLKFADDQG+GG K  SLSLGQGQGPIAMKM+++ +KEGTWV+LQNCHLA SWM  LEK  EEL+PE+THPDFR+WLTSYPS  FPV++LQNGVKMTNE PKGLR NI RSYL DPISD EFFG+ K    +KKLL+GLCFFHA+VQERRKFGP+GWNI YEFNETDLRISVQQLHMF++QY+ + Y+AL+Y+TGECNYGGRVTDDWDRRTL +IL KF+  ++ E+ DYKFD SG Y+ PP  D++ YIEY KTLPL P P +FGM+ NADITKD  ETQLLFD+ILLTQ+R +  G KS+D++V+EV++D+L +LP NFD E  MR+YPT Y QSMNTVLVQEM RFN LL TIR S  NI+KAIKGL VMS+DLEEVV S+L  KIP MWM KSYPSLKPLGSYVNDFLARLKFL  W++ GPPP+FW+SGF+FTQAFLTG QQNYARKYTIPIDLL FDYE+++D+ Y   PEDG ++ GLFLDGA W+RK+K + ESHPK+L D +PV+WLKP K+++IP +PSY++P+YKTSERRG LSTTGHSTNFVIAMTLP+D+P+EHWI RGVALLCQL+
Sbjct:   25 SMEKLASKEKFKAP--ARALPQLSMVSTKPHWQQAAPSFHLSVKQDDESPEPFSVKNEQSHAEYM-ERFGKKGKLPHQVDDSYVGPSTSKSKGKSPHKERENFRSTLVNVIMQ-QDADLDSAV-----PDGSTIPKPTA-SAIEKDILRYYYYIHHGIDTDHVAPMEDSWLEHVLDLVPQHLKV-FTDSIVTLSDEMREDYLLSVRKSIVDFVLKDPREKGDDKKTDELPAHRAEMEILPKPWRKSFLAASSYIRDHLNAMNPTMLAVLDLWHTNFKKLRLVDIKEFHNCQDALELSSFQNIIMRHMDSAKETLLKMWFPEVQNIYYQGNKKKQLPTGDSSAKLESFFNCAAALMTLQLQDLTLVSMQDFTDLIAQPP-----------------------DSVRAFEHPGFIMRLILDNDTIKFEPELSDYIDIFLNVYDVMIKAVSFVPRVETKLYSKWESKSKPTTLKPIILNEIVDAHKEKIKEVIMKESVAPTEHLRLYDKYDFLITRKAERDVDNFLAEN---HSYEKIIDEICKYQKLIEEIQYTSIKTIRLGMFEMHCEELIRALVKRADIICGKLLAKMFRDHQEVNTRLCDEFERIAEKALSTPPNTAELMEMKAYIQKVEVTDMIELEQRLVDSKNCLAFLIEYVNFSPADMRLNNSVFQWYGRMGEIFEEHRKIIKEKIEQYQEGLKLRCERFVEELESYAKQSEEFYSFGDLQDVQRYLKKAQILNGKLDLAADKIEQFNAEEEAFGWLPSVYPQRKKIQDGLNPYLRLYETAVEFSSNYRAWTEGPYHKVNPDQVEADIGNYWRGLYKLEKTFHDSPYALAMTKKVRSKVEDFKQHIPLIQVICNPGLRPRHWEAMSAIVGYPLQPSDDSTVSSFLDMNLEPYIDRFEGISEAASKEYSLEKAMEKMITEWDAVEFVIHSYRETGTFILASVDEIQMLLDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMSQMPEEGRRFTAVDKTWRDIMRSVMQDKHVLTVVTIDRMLERLKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIAKVEFTETLDITHMKSSEGEVVELIEIISTAKARGQVEKWLVELERVMINSIHKVTGDATFAYTKYERINWVRDWPGQTVLCVSQIFWTKEVQTAIPMGIKALEQYLKTCNRQIDDIVTLVRGKLSMQNRVTLGALVVLDVHARDVLSSLVKKNISDDSDFEWLSQLRYYWQENHLETKMINAGLRYGYEYLGNSPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINAGADILMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPNENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNDLLAAIKDNCASMNLQMTAFFSEKILQVYEMMIVRHGFMIVGEPFGGKTSAYRVLAGALNDICEKGLMEENKVQITVLNPKSVTMGQLYGQFDSVSHEWSDGVLAVSFRAFASSVTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPLMLSWVNLLPASVSVIQKEFIMGLFDRMVPVSVEFIRKHTK-ELSPTSDTNLVRSLMNLIDCFMDDFADEVKLKERNDRETYSLLEGIFLFSLIWSVGASCTDDDRLKFNKILRELMESPISDRTRNTFKLQSGTEQTSSKALTVP---------FPEKGTIYDYQFVTE----GIGKWEPWIKKLKEAPPIPKDVMFNEIIVPTLDTIRYSALMELLTTHQKPSIFVGPTGTGKSVYITNFLLNQLNKEIYKPLLINFSAQTTAAQTQNIVMSKLDKRRKGVFGPPLGKRMVVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSMIKLVDIQIMCAMGPPGGGRNPVTPRYMRHFNIITINEFSDKSMYTIFSRILTWHLEICYKFPDEFLDLTTQIVNGTMTLYKEAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETTETTEVIKRLWVHEVLRVYYDRLLDNTDRSWLINYIQEILRNYMYEDFHELFQRLDFDNDGMVEADDLRSLMFCDFHDPKREDTNYREIADVDNLRMIVEIHLEEYNNISKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSVFQVEISKGYDTTEWHEDLKVILRKCAEGEMQGVFLFTDTQIKEESFLEDVSNLLNAGEIPNLFALDEKQEICDKMRQLDRQRDKTKQTDGSPIALFNMFIDHCRSQLHVVLAMSPIGDAFRNRLRKFPALVNCCTIDWFQSWPEDALQAVASRFLEEIEMSEEIRDGCIDMCKSFHTSTIDLSKSFFVELQRYNYVTPTSYLELISTFKLLLEKKRSEVMKMKKRYEVGLEKLDSASSQVATMQMELEALHPQLKVASKEVDEMMIMIEKESVEVAKTEKIVKADETIANEQAMASKAIKDECDADLAGALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAICILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGDMRFLQSLHEYDKDNIPPAYMNIIRKNYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGELKIAMDGLRKKQAALKEVQDKLARLQDTLELNKQKKADLENQVDLCSKKLERAEQLIGGLGGEKTRWSHTALELGQLYINLTGDILISSGVVAYLGAFTSTYRQNQTKEWTTLCKGRDIPCSDDCSLMGTLGEAVTIRTWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQSQANKWIKNMEKANSLYVIKLSEPDYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVAQERPDLEEEKQALILQGAENKRQLKEIEDKILEVLSSSEGNILEDETAIKILSSSKALANEISQKQEVAEETEKKIDTTRMGYRPIAIHSSILFFSLADLANIEPMYQYSLTWFINLFILSIENSEKSEILAKRLQILKDHFTYSLYVNVCRSLFEKDKLLFSFCLTINLLLHERAINKAEWRFLLTGGIGLDNPYANLCTWLPQKSWDEICRLDDLPAFKTIRREFMRLKDGWKKVYDSLEPHHEVFPEEWEDK-ANEFQRMLIIRCLRPDKVIPMLQEFIINRLGRAFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMAALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKEGTWVVLQNCHLATSWMPTLEKVCEELSPESTHPDFRMWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCKKPEEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLNQYEELPYEALRYMTGECNYGGRVTDDWDRRTLRSILNKFFNPELVENSDYKFDSSGIYFVPPSGDHKSYIEYTKTLPLTPAPEIFGMNANADITKDQSETQLLFDNILLTQSRSAGAGAKSSDEVVNEVASDILGKLPNNFDIEAAMRRYPTTYTQSMNTVLVQEMGRFNKLLKTIRDSCVNIQKAIKGLAVMSTDLEEVVSSILNVKIPEMWMGKSYPSLKPLGSYVNDFLARLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNYARKYTIPIDLLGFDYEVMEDKEYKHPPEDGVFIHGLFLDGASWNRKIKKLAESHPKILYDTVPVMWLKPCKRADIPKRPSYVAPLYKTSERRGVLSTTGHSTNFVIAMTLPSDQPKEHWIGRGVALLCQLN 4023          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Human
Match: DNAH12 (dynein axonemal heavy chain 12 [Source:HGNC Symbol;Acc:HGNC:2943])

HSP 1 Score: 4037.65 bits (10470), Expect = 0.000e+0
Identity = 2080/3873 (53.71%), Postives = 2720/3873 (70.23%), Query Frame = 3
Query:  606 SVKKAIVDFVLKEPREKETDDT--PIPEHRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEF-DKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENK-----------------------PIPK-----KIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLP-PAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDF--SDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPS-AWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFF-GTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARG-SSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD 12113
            S+K+ +V  VL +P  K  +D   P+PE    L     PW  S++ A      +L++ +P M  +L+L   +F +  L+D    R K   I+ +  +         A+EK+M  W   V N++    KK+ +  V+ +  L+ F++C STLM++ L++L           LR   R +E           +    PK    +    P F + L  +D  ++F P+ +D E  +L++ +++ + + +V  I S L    +G  T + L+  +   ++     T++  +     G  +H + + +KY  L++    + I+   +E    H+F+E+ ++++ +  L  +I    +  I   M  L C++L   L+ +A+     LL+ +   +R+ N  +  E+E I   AL +P  TE+MM+LI +V     + + EL  ++ +S  ++ + +D   F   D+ LN +V     ++  IFDEN + +E  K + +  L  KRE+ I E++   +++EEF    ++  + +Y+   + L  +++ +   ++  NKEEE F W++T YP   +++  + PY K +   +++    K WM+G    +  + ++ADV  + R +FK  K F+ K                         PK      + + V  +++ FKE++P +  L  PG+R RHW+QIS+IVGY L  + G  L K++ +NL P++ +FE IS  A KEF+LEKAM  M   W  + F +  YR+TG  ILSSVD+IQ +LDD I+KTQTMRGSPFIKPFE EIK WE +LI +Q+ +DEWLKVQA WLYLEPIF S DIM QMPEEGR+F +VD+ W++IMK    D +VL    +  +L+KL+  NELLE I+KGLN YLEKKRL+FPRFFFLSNDE+LEILSETKDP RVQPHLKKCFEGIA L F   LDI  M SSE E V L  +ISTS ARG VEKWL+++E  M+ SV   I+   + Y  + R++WV++W GQ VL IS  +WT   Q+ I  G E L  Y K   +Q++EIV LVRG+LSKQ RTTL AL+ +DVHARDV++++I+  V+++ DF WL QLRYYW   N   ++IN  +KY YEYLGN+ RLVITPLTDRCYRTL GA +L+LGGAPEGPAGTGKTETTKDLAKA+A QCVVFNCSDGLDY+A+GKFFKGLAS GAW+CFDEFNRI+LEVLSVVAQQIL IQRAI  +    +FEGTELKL+P C V ITMNPGYAGRSELPDNLK LFR+VAMMVP+YALIAEISLYS GF+NARPL+VKIV TYRLCSEQLSSQ HYDYGMRAVK+VL AAGNLKLKYP+E+EDIL+LRSI DVN PKFL+HD+PLFNGI SDLFPG+  P  DY    +   E C   NL+   FF+EKI Q YEMMIVRHGFM+VGEPF  KT    VLA  L  + E G  EE KV Y  +NPK+ITMGQL+GQFDPVSHEW+DG++A ++R FA S TPDRKW++FDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQ+SP  +LIFE MDL  ASPATVSRCGM+Y+EP+ LGW P+ +SWL  L  P     ++ +   +F   I   +   +K   KEL PTS+ NVV SL  L +  +    +    S    + I  W+   F F+  WSIG + + +GR+ FD   R ++ G   E           VP  +  ++  +  KG +YDY +  + +    G+W HW+EL+K  +   K  K  +IIVPT DT++YT+LM+L +T+ KP LFVGPTGTGKS Y+ D L+N + KD Y P  IN SA+TSANQ QNIIM++LD+RRKGVFGPP+GKK I+F+DD+NMP  E YGAQPPIELLRQ+ D  +WYDLKDT+ I L+D++ I AMGPPGGGRNP+TPR +RH N  +IN F DETM+ IFSSI+ +++ T  F P++    NQ++  T+++YK ++ NLLPTP KSHY FNLRDFSRVI+G LL   + +     M RL+ HE+ RV+YDRL+ D DR W F   + V   H  E F  +F HL   ++  VTE+D+R+L++ D+   D +  ++ YIE+ ++      V+  LDEYNQ  K  MNLV+FR+ +EH+SRI R+LKQ   +ALLVG+GGSGRQSLTRLA SMA   +FQ EISKSY   EWRED+K +LR         VFL +D QIK+E+FLEDI+++LN GEVPN++  DEKQEV E +      +   +  + SP+AL+ FFV R +D LH+V+A SPIGDAFRNRLR+FPSL+NCCTIDWFQ+WPEDAL  VA +FLE +EL +  +   + +CK FHTS   LSE++L EL R+NYVT TSYLELI +F+ LL +KR  V + K+RY  GL+KL  A S +  MQ EL + QPKL EA  E    M ++E +S +   + + VK +E IA+ +A+ A+A+KNEC++DLAEAIP LE+AL AL+TL PADITIV++M +PP GV+LVM AVCV+K IKP++++DPSG+G KI D+WGPSK+LLG+M FL  LK +DKDNIP+ +M+ IR +YL N +F P ++A AS+A EGLCKW+ A+E YD+VAKVVAPKK  L +A       M  LN+KRA L EV+  L+ L          K  LE++V+LC+KKL RA QLIGGLGGEK RW QAA DL + + NLTGD+L+S+GV+AYLGAFTS FR   TK W     +K IPCS++F L  TLGDPV+IR+WNI GLPTD FSI+NG+I++N RRWPLMIDPQGQANKWIKN EK+N L VIKL+D+D++R LENCIQFGTP+LLEN+GEELDP LEPLLL+QTFKQGG  CI+LG+ IIEYSFDF+FYITTKLRNPHY+PE + KV+LLNFMITPEGL+DQLLGIVV++ERPELEEE+N LI QSA NKK+LK++E +IL  LS+SEGNILEDESAIKVL+S+K +SNEI +KQ   E+TE KI E+R GY PIA HS++LFFSIADLANIDPMYQYSLTWF+NL+  SI +S KS+ L++RL+ L  +FTY+LYCN+CRSLFEKDKLLFSF+LC+N+L     I+  E  FLLTGGV L +  +NP   WL  KSW+E+CR  +   F G+RQ F E    W++IYDS EPHN + P    + L +   K+ +LRCLRPDKI  AI N+V +++GKK++EPPPFDL  S+ DSNCT PL+F+LSPGADPMA+LLKFA+D+   G KF+++SLGQGQGPIA KMI+  I+EGTWV LQNCHLA SWM +LEK  E+   ET +  FRLWLTSYPSS FPV ILQNGVKMTNEPP GLR N+ +SYL+DP+SD EFF G      AW+KLLFG+CFFHA+VQER+KFGP+GWNI Y FNE+DLRIS++QL +FI++YD++ ++A+ YLTGECNYGGRVTDDWDRR L+T+L  FY + + E+P YKF  SG Y+APP   YE YIE+IK LP    P +FG+H+N DI+KD Q+T+ LF+S+LLTQ     +G   STD I+ E++ D+LN+LP +FD E+ +RKYP +YE+SMNTVLVQEM RFN L+ TIR++L+++ KAIKG+VVM S LE +  S+L  K+P +W K+SYPSLKPLGSY+ DFLARL FL DW+++G P +FW+SGF+FTQAFLTG  QNYARKYT PIDLL +++E++     D +PEDG Y+ GL+LDGARWDR+  ++ E +PK+L D MP+IW+KP +KS I    +Y+ P+YKTSER+GTLSTTGHSTNFVIAM L TD+P  HWI RGVALLCQLDD
Sbjct:  151 SMKRYLVQSVLVKPPVKSLEDEGGPLPESPVGLDY-SNPWHSSYVQARNQIFSNLHIIHPTMKMLLDLGYTTFADTVLLDFTGIRAK-GPIDCESLKTDLSIQTRNAEEKIMNTWYPKVINLF---TKKEALEGVKPE-KLDAFYSCVSTLMSNQLKDL-----------LR---RTVEGF---------VKLFDPK----DQQRLPIFKIELTFDDDKMEFYPTFQDLEDNVLSLVERIAEALQNVQTIPSWL----SGTSTPVNLDTELPEHVLHWAVDTLKAAVHRNLEGARKHYETYVEKYNWLLDGTAVENIETFQTED---HTFDEYTEFIEKFLSLASEIMLLPQW-IHYTMVRLDCEDLKTGLTNKAKAFANILLNDIASKYRKENECICSEFEAIKEHALKVPETTEEMMDLISYVEKARTVGIEELILRIQESKRQMSYFLDVFLFPQEDLALNATVLMWPRKINPIFDENDELIENAKHKKENELMAKREKLILEIEKESRRMEEFTEFAELERMQQYVTDVRQLQKRIQESEEAVQFINKEEELFKWELTKYPELDKLKVNIEPYQKFFNFVLKWQRSEKRWMDGGFLDLNGESMEADVEEFSREIFKTLKFFQTKLKKELQEKRKAARKRSLEEEKIEEEPKDNATITMCSTVMEQIKAFKEYIPTVSILCNPGMRARHWKQISEIVGYDLTPDSGTTLRKVLKLNLTPYLEQFEVISAGASKEFSLEKAMNTMIGTWEDIAFHISLYRDTGVCILSSVDEIQAILDDQIIKTQTMRGSPFIKPFEHEIKAWEDRLIRIQETIDEWLKVQAQWLYLEPIFCSEDIMQQMPEEGRQFQTVDRHWRDIMKFCAKDPKVLAATSLTGLLEKLQNCNELLEKIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFLPNLDIKAMYSSEGERVELIALISTSAARGAVEKWLIQVEDLMLRSVHDVIAAARLAYPESARRDWVREWPGQVVLCISQMFWTSETQEVISGGTEGLKKYYKELQNQLNEIVELVRGKLSKQTRTTLGALVTIDVHARDVVMDMIKMGVSHDTDFLWLAQLRYYWENENARVRIINCNVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIQQKLVVFVFEGTELKLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNARPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKYPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGIKLPEADYHEFLECAHEACNVHNLQPVKFFLEKIIQTYEMMIVRHGFMLVGEPFAAKTKVLHVLADTLTLMNEHGYGEEEKVIYRTVNPKSITMGQLFGQFDPVSHEWTDGIVANTFREFALSETPDRKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSPQMSLIFETMDLSQASPATVSRCGMIYLEPSQLGWEPLVSSWLNSLKGPLCEPEYQALLRGLFAWLIPPSLNQ-RKKKCKELIPTSNSNVVVSLTRLFEVLLCNVVENDPTS----KHIRVWIMACFIFSLIWSIGGSCDTDGRRVFDTFIRLIILGKDDE---------NPVPDSVGKWECPFDEKGLVYDYMYELKNK----GRWVHWNELIKNTNLGDKQIKIQDIIVPTMDTIRYTFLMDLSITYAKPLLFVGPTGTGKSVYVKDKLMNHLEKDQYFPFYINLSARTSANQVQNIIMARLDKRRKGVFGPPMGKKCIIFIDDMNMPALEKYGAQPPIELLRQFFDCGHWYDLKDTSKITLVDIELIAAMGPPGGGRNPVTPRCIRHFNICSINSFSDETMVRIFSSIVAFYLRTHEFPPEYFVIGNQIVNGTMEIYKQSVENLLPTPTKSHYTFNLRDFSRVIRGCLLIERDAVANKHTMIRLFVHEVLRVFYDRLINDDDRRWLFQLTKTVIKDHFKESFHSIFSHLR-KQNAPVTEEDLRNLMFGDYMNPDLEGDDRVYIEIPNIHHFSDVVDQCLDEYNQTHKTRMNLVIFRYVLEHLSRICRVLKQSGGNALLVGLGGSGRQSLTRLATSMAKMHIFQPEISKSYGMNEWREDMKGLLRNVGMKGQKTVFLITDTQIKEEAFLEDIDSVLNTGEVPNIFAADEKQEVMEGV--RPVAQAGNKHDELSPLALFAFFVNRCKDNLHVVVAFSPIGDAFRNRLRQFPSLINCCTIDWFQSWPEDALERVAVKFLETLELTEVEQQEIVPICKHFHTSIMDLSERFLHELGRHNYVTATSYLELIGSFRQLLTQKRQAVMEAKQRYMNGLDKLAFAESQVGEMQMELVELQPKLEEAKIENANMMQVIEIESVQVEAKRQFVKLDEEIASGKAEEAQALKNECESDLAEAIPALEAALSALDTLKPADITIVKSMKNPPSGVKLVMAAVCVMKDIKPEKISDPSGTGGKILDYWGPSKKLLGDMNFLRDLKEYDKDNIPVTVMQKIRSEYLMNPEFDPPKVAKASSAAEGLCKWIMAMEVYDRVAKVVAPKKARLSEAQKSLAETMELLNQKRAELAEVEHHLENLQMTFLEKTEEKAALEDQVELCAKKLERASQLIGGLGGEKSRWAQAADDLQITYENLTGDVLVSAGVIAYLGAFTSGFRQTCTKDWSMLCKKKKIPCSEEFLLSKTLGDPVKIRAWNIAGLPTDTFSIDNGVIVNNCRRWPLMIDPQGQANKWIKNSEKENQLSVIKLSDSDYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLRQTFKQGGIDCIRLGEVIIEYSFDFKFYITTKLRNPHYMPELATKVSLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKDIEKKILETLSSSEGNILEDESAIKVLDSAKMMSNEITKKQQIAEKTELKIAESREGYRPIAKHSSVLFFSIADLANIDPMYQYSLTWFVNLYINSIHDSNKSKILEKRLRYLNDHFTYNLYCNICRSLFEKDKLLFSFLLCANLLLARKEIEYQELMFLLTGGVSLKSAEKNPDPTWLQDKSWEEICRASEFPAFRGLRQHFCEHIYEWREIYDSKEPHNAKFPAPMDKNLNE-LQKIIILRCLRPDKITPAITNYVTDKLGKKFVEPPPFDLTKSYLDSNCTIPLIFVLSPGADPMASLLKFANDKSMSGNKFQAISLGQGQGPIAAKMIKAAIEEGTWVCLQNCHLAVSWMPMLEKICEDFTSETCNSSFRLWLTSYPSSKFPVTILQNGVKMTNEPPTGLRLNLLQSYLTDPVSDPEFFKGCRGKELAWEKLLFGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISIRQLQLFINEYDTIPFEAISYLTGECNYGGRVTDDWDRRLLLTMLADFYNLYIVENPHYKFSPSGNYFAPPKGTYEDYIEFIKKLPFTQHPEIFGLHENVDISKDLQQTKTLFESLLLTQGGSKQTGASGSTDQILLEITKDILNKLPSDFDIEMALRKYPVRYEESMNTVLVQEMERFNNLIITIRNTLRDLEKAIKGVVVMDSALEALSGSLLVGKVPEIWAKRSYPSLKPLGSYITDFLARLNFLQDWYNSGKPCVFWLSGFFFTQAFLTGAMQNYARKYTTPIDLLGYEFEVIPSDTSDTSPEDGVYIHGLYLDGARWDRESGLLAEQYPKLLFDLMPIIWIKPTQKSRIIKSDAYVCPLYKTSERKGTLSTTGHSTNFVIAMLLKTDQPTRHWIKRGVALLCQLDD 3960          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Human
Match: DNAH3 (dynein axonemal heavy chain 3 [Source:HGNC Symbol;Acc:HGNC:2949])

HSP 1 Score: 3907.45 bits (10132), Expect = 0.000e+0
Identity = 2065/3962 (52.12%), Postives = 2730/3962 (68.90%), Query Frame = 3
Query:  390 TQEKTPVGMSATEKDILRYYYYIHNGIDTEHVAKMEXXXXXXXXXXXXXXXXAEH--PXXXXXXXXXXXXXXXXSVKKAIVDFVLKEPRE-KETDDTPIPEHRKELSV-VPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKK--KLVP--SVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIE----SRLYSDWAGDKT----------KIYLNPIILPEI---------IEKHKSTVRNVLID-------ESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYAN--FNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQ----VEEFQ-NLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFN-----DEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELV-KGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSA-WLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEE-LNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDE-APEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD 12113
            ++EK P     +E D+ RYYYY+ NGI  + +A  E + M  +  L+ N L        L+  L  E + DY  S+ K+IVD++L +P E K      IP    +  +  P PW   + +A K+ ++HL+  NP M ++ ELW   F++LR V   E    K  ++ Q+F     +H   A + L+ KW+     ++    +      P  +     N+E +F   ++ M+  L+ L + S+ D  +L              M  K    F  P +++         +++L + + +I F PS +    L+ + + +++K  + + +++       ++  A D+            ++     + E+         +   +  V + LI          VGP +++  + KY  L++   +Q I   L E  D   F      +K   + +  +      ++ L MF L    L   L +RAQN+ + L+   ++ +R +N  +  +Y  I  K   +PANT++++ LI+F+  +  +T+ +L ++L  ++ERL FLMDYA+  +   D+  N      H R  +  D  K+          +  + + E +  EL+S+RK+     EE + N+  +NE++K L +          A    E  NKEEE    + +TYP+ Q +     PY +L+ TA EF+ K ++WM G +  +  +Q+  ++GN +RT +KL K   + P P+++A  VK K+++FK+++P++     PG++DRHWQQIS+IVGY ++  E  CLS +++     F+ K E I  AA KE++LEK +++MK +W  + F  + YR+T T IL ++DDIQ++LDDH++KTQTM GSPFIKP EAE + WE KLI +QD LD WLK QATWLYLEPIFSS DI+AQMPEEGRKF  VD  WK +M Q + D R+L      +M +KL+++N LLE I KGLN YLEKKRL+FPRFFFLSNDELLEILSETKDP RVQPHLKKCFEGIA L FT+ L+I  M SSE E V     I  + A+G VEKWL ++E  M+AS+R  I  G+  Y   PR  WV +W GQ V+ +S  +WT  V  A+ E    L  +LK +N QI +IV LVRG+LS   R TL AL V+DVHARDV+  L +++V++ NDF W+ QLRYYWV  ++  ++I +   YGYEYLGN+ RLVITPLTDRCYRTL GAL L+LGGAPEGPAGTGKTETTKDLAKA+AKQCVVFNCSDGLDY A+GKFFKGLA  GAW+CFDEFNRI++EVLSVVAQQIL+IQ+AI  +  T +FEGTEL L+PTCAVFITMNPGYAGR+ELPDNLKALFR+VAMMVPDYALI EISLYS GF+++R LA KIVATYRLCSEQLSSQ HYDYGMRAVKSVLTAAGNLKLKYP+E+E +L+LR+++DVNL KFL  D+PLF GI SDLFPGV  P PDY++  K + +N  KM L+   +F+ KI QIYEMM+VRHG+MIVG+P GGKTSAYKVLAAALGD+     MEE  V+Y I+NPKAITMGQLYG FD VSHEW DGVLA ++R  A+S + DRKW+IFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQ++   +LIFEP DLE ASPATVSRCGM+YMEP  LGW+P+ +S++  LP ++T  HK++  D+F   +   +    +   K +  TS I++  S++ L    +D        +      +  + I  WL+G+F F+  W++  T N + RK FD   R L+ G  M++   +   V+           ++P +G+IYD+ FI +      G WE W++ + K ++ +   AK +E+I+PT +T + ++ +   L H+ P LFVGPTGTGKS    +FLL+ + K+ Y PN INFSA+TSANQTQ+IIMSKLDRRRKG+FGPP+GKK +VFVDDLNMP +E YGAQPPIELLRQW+DH  W+D KDTT + ++D+  + AMGPPGGGRN IT RF RHLN I+IN F D+ +  IFSSI++WH   + F   F      L+QAT  +Y+ A+ N LPTP+KSHY+FNLRDFSRVIQGVLL     +++     RLW HE++RV+YDRL+  +DR+ FFN ++E ++    +  + +  HL     GK+ +D+IRSL + D+   +S  K Y E+TDL+ L   +E YL+E+N +SK PM+LV+FRFAIEH+SRI R+LKQ + H LLVG+GGSGRQS  +L+  M  Y+L+Q+EI+K+Y   +WREDLK+I+ +        VFLF+DNQIK ESF+EDIN LLN G+VPN++P DEK ++ EKM+   R + +    + +P+++YNFF++RV +++   LAMSPIGDAFRNRLR FPSL+NCCTIDWFQ+WP DAL  VA +FLEDVELD +++   + +CK F  S + LS  Y  +L R+NYVTPTSYLELI TFK LL+ KR EV   + RY  GL+KL  AAS ++VMQ+EL   QP+L+  S+E  K M+ +E ++ EA  ++ +V+ +E  AN  A  A+ IKNEC+ DLAEA+P LE+AL AL+TL PADI++V++M +PP  V+LVME++C++KG+KP+R  DPSGSGK IED+WG SK++LG++KFLE LK +DKDNIP   MK IRE+++ + +F+P  I   S+ACEGLCKWV A+E YD+VAKVVAPK+  L +A  +    M  LN+KRA LK V D+L+ L ++ E    +K DLE  +++CS+KLVRAE+LI GLGGEKDRW +AA  LG+R+ NLTGD+LLSSG VAYLGAFT  +R +   QWL +  +K IP    FSL  TLGDP++IR+W I GLP D FSI+NGII+SNSRRW LMIDP GQANKWIKNMEK N L VIK +D++++R+LEN +Q GTPVL+ENIGEELD  +EP+LLK TFKQ G   ++LG++IIEYS DF+ YITT+LRNPHYLPE +VKV LLNFMITP GLQDQLLGIV ++E+PELEE+KN+LI +SA NKK LKE+ED+IL VLS S+GNILEDE+AIKVL+SSK LS EI+EKQ     TE +IDE R+GY P+A+HS  +FF I+DLANI+PMYQYSLTWFINL+  S+ +S KSE L  R++ +  +FT S+Y NVCRSLFEKDKLLFS +L   I+K    I E+ W FLLTGG+ LDNP+ NP+  WL  K+W E+ R   L   HG+ +   +    WK IYDS  PH +QLP  W  +      KM +LRCLRPDK+V A++ F+ E +GK YIE P FDL GS+NDS+C +PL+F+LSP ADPMA LLKFADD G GG + +++SLGQGQGPIA KMI   IK+GTWV+LQNCHLA SWM  LEK  EE + PE+T+  FRLWLTSYPS  FPV+ILQNG+KMTNEPPKGLR N+ RSYL+DPISD  FF +      W+K+LFGLCFFHA+VQERR FGP+GWNI YEFNE+DLRIS+ Q+ MF++ Y  V +DAL YLTGECNYGGRVTDD DRR L+++L  FYC ++ ED  Y       YY PP   Y+ YI+Y++ LP+   P VFG+H+NADITKDNQET  LF+ +LLT  R S G GKS  ++V+E++ D+L++LP +FD E VM+ YP  YE+SMNTVL QE++RFN L   +R SL N+ +AIKG V+MSS+LEEV  SML  K+P MW  KSYPSLKPLG YV D LARL F  +W D GPP +FWISGFYFTQ+FLTGV QNYARKYTIPID + F++E+       E  PEDGAY+KGLFL+GARWDRK   I ES PK+L DP+P+IWLKP + +   ++  Y+ P+YKTS RRGTLSTTGHSTN+V+++ LPTD P++HWI RGVA LCQLD+
Sbjct:  221 SKEKKP-----SESDLERYYYYLTNGIRKDMIAPEEGEVMVRISKLISNTLLTSPFLEPLMVVLVQEKENDYYCSLMKSIVDYILMDPMERKRLFIESIPRLFPQRVIRAPVPWHSVYRSAKKWNEEHLHTVNPMMLRLKELWFAEFRDLRFVRTAEILAGKLPLQPQEFWDVIQKHCLEAHQTLLNKWIPTCAQLFTSRKEHWIHFAPKSNYDSSRNIEEYFASVASFMSLQLRELVIKSLEDLVSLF-------------MIHKDGNDFKEPYQEMKFFIPQL-IMIKLEVSEPIIVFNPSFDGCWELIRDSFLEIIKNSNGIPKLKYIPLKFSFTAAAADRQCVKAAEPGEPSMHAAATAMAELKGYNLLLGTVNAEEKLVSDFLIQTFKVFQKNQVGPCKYLNVYKKYVDLLDNTAEQNIAAFLKENHDIDDFVTKINAIKKRRNEIASMNI----TVPLAMFCLDATALNHDLCERAQNLKDHLIQFQVDVNRDTNTSICNQYSHIADKVSEVPANTKELVSLIEFLKKSSAVTVFKLRRQLRDASERLEFLMDYADLPYQIEDIFDNSRNLLLHKRDQAEMDLIKRC---------SEFELRLEGYHRELESFRKREVMTTEEMKHNVEKLNELSKNLNR----------AFAEFELINKEEELLEKEKSTYPLLQAMLKNKVPYEQLWSTAYEFSIKSEEWMNGPLFLLNAEQIAEEIGNMWRTTYKLIKTLSDVPAPRRLAENVKIKIDKFKQYIPILSISCNPGMKDRHWQQISEIVGYEIKPTETTCLSNMLEFGFGKFVEKLEPIGAAASKEYSLEKNLDRMKLDWVNVTFSFVKYRDTDTNILCAIDDIQMLLDDHVIKTQTMCGSPFIKPIEAECRKWEEKLIRIQDNLDAWLKCQATWLYLEPIFSSEDIIAQMPEEGRKFGIVDSYWKSLMSQAVKDNRILVAADQPRMAEKLQEANFLLEDIQKGLNDYLEKKRLFFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIAKLEFTDNLEIVGMISSEKETVPFIQKIYPANAKGMVEKWLQQVEQMMLASMREVIGLGIEAYVKVPRNHWVLQWPGQVVICVSSIFWTQEVSQALAEN--TLLDFLKKSNDQIAQIVQLVRGKLSSGARLTLGALTVIDVHARDVVAKLSEDRVSDLNDFQWISQLRYYWVAKDVQVQIITTEALYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIEVEVLSVVAQQILSIQQAIIRKLKTFIFEGTELSLNPTCAVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYALIGEISLYSMGFLDSRSLAQKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPEENESVLLLRALLDVNLAKFLAQDVPLFQGIISDLFPGVVLPKPDYEVFLKVLNDNIKKMKLQPVPWFIGKIIQIYEMMLVRHGYMIVGDPMGGKTSAYKVLAAALGDLHAANQMEEFAVEYKIINPKAITMGQLYGCFDQVSHEWMDGVLANAFREQASSLSDDRKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMNSKMSLIFEPADLEQASPATVSRCGMIYMEPHQLGWKPLKDSYMDTLPSSLTKEHKELVNDMFMWLVQPCLE-FGRLHCKFVVQTSPIHLAFSMMRLYSSLLDEIRAVEEEEMELGEGLSSQQIFLWLQGLFLFSLVWTVAGTINADSRKKFDVFFRNLIMG--MDDNHPRPKSVKLTK------NNIFPERGSIYDFYFIKQAS----GHWETWTQYITKEEEKVPAGAKVSELIIPTMETARQSFFLKTYLDHEIPMLFVGPTGTGKSAITNNFLLH-LPKNTYLPNCINFSARTSANQTQDIIMSKLDRRRKGLFGPPIGKKAVVFVDDLNMPAKEVYGAQPPIELLRQWIDHGYWFDKKDTTRLDIVDMLLVTAMGPPGGGRNDITGRFTRHLNIISINAFEDDILTKIFSSIVDWHF-GKGFDVMFLRYGKMLVQATKTIYRDAVENFLPTPSKSHYVFNLRDFSRVIQGVLLCPHTHLQDVEKCIRLWIHEVYRVFYDRLIDKEDRQVFFNMVKETTSNCFKQTIEKVLIHLS--PTGKIVDDNIRSLFFGDYFKPESDQKIYDEITDLKQLTVVMEHYLEEFNNISKAPMSLVMFRFAIEHISRICRVLKQDKGHLLLVGIGGSGRQSAAKLSTFMNAYELYQIEITKNYAGNDWREDLKKIILQVGVATKSTVFLFADNQIKDESFVEDINMLLNTGDVPNIFPADEKADIVEKMQTAARTQGEK--VEVTPLSMYNFFIERVINKISFSLAMSPIGDAFRNRLRMFPSLINCCTIDWFQSWPTDALELVANKFLEDVELDDNIRVEVVSMCKYFQESVKKLSLDYYNKLRRHNYVTPTSYLELILTFKTLLNSKRQEVAMMRNRYLTGLQKLDFAASQVAVMQRELTALQPQLILTSEETAKMMVKIEAETREADGKKLLVQADEKEANVAAAIAQGIKNECEGDLAEAMPALEAALAALDTLNPADISLVKSMQNPPGPVKLVMESICIMKGMKPERKPDPSGSGKMIEDYWGVSKKILGDLKFLESLKTYDKDNIPPLTMKRIRERFINHPEFQPAVIKNVSSACEGLCKWVRAMEVYDRVAKVVAPKRERLREAEGKLAAQMQKLNQKRAELKLVVDRLQALNDDFEEMNTKKKDLEENIEICSQKLVRAEKLISGLGGEKDRWTEAARQLGIRYTNLTGDVLLSSGTVAYLGAFTVDYRVQCQNQWLAECKDKVIPGFSDFSLSHTLGDPIKIRAWQIAGLPVDSFSIDNGIIVSNSRRWALMIDPHGQANKWIKNMEKANKLAVIKFSDSNYMRMLENALQLGTPVLIENIGEELDASIEPILLKATFKQQGVEYMRLGENIIEYSRDFKLYITTRLRNPHYLPEVAVKVCLLNFMITPLGLQDQLLGIVAAKEKPELEEKKNQLIVESAKNKKHLKEIEDKILEVLSMSKGNILEDETAIKVLSSSKVLSEEISEKQKVASMTETQIDETRMGYKPVAVHSATIFFCISDLANIEPMYQYSLTWFINLYMHSLTHSTKSEELNLRIKYIIDHFTLSIYNNVCRSLFEKDKLLFSLLLTIGIMKQKKEITEEVWYFLLTGGIALDNPYPNPAPQWLSEKAWAEIVRASALPKLHGLMEHLEQNLGEWKLIYDSAWPHEEQLPGSW--KFSQGLEKMVILRCLRPDKMVPAVREFIAEHMGKLYIEAPTFDLQGSYNDSSCCAPLIFVLSPSADPMAGLLKFADDLGMGGTRTQTISLGQGQGPIAAKMINNAIKDGTWVVLQNCHLAASWMPTLEKICEEVIVPESTNARFRLWLTSYPSEKFPVSILQNGIKMTNEPPKGLRANLLRSYLNDPISDPVFFQSCAKAVMWQKMLFGLCFFHAVVQERRNFGPLGWNIPYEFNESDLRISMWQIQMFLNDYKEVPFDALTYLTGECNYGGRVTDDKDRRLLLSLLSMFYCKEIEED-YYSLAPGDTYYIPPHGSYQSYIDYLRNLPITAHPEVFGLHENADITKDNQETNQLFEGVLLTLPRQSGGSGKSPQEVVEELAQDILSKLPRDFDLEEVMKLYPVVYEESMNTVLRQELIRFNRLTKVVRRSLINLGRAIKGQVLMSSELEEVFNSMLVGKVPAMWAAKSYPSLKPLGGYVADLLARLTFFQEWIDKGPPVVFWISGFYFTQSFLTGVSQNYARKYTIPIDHIGFEFEVTPQETVMENNPEDGAYIKGLFLEGARWDRKTMQIGESLPKILYDPLPIIWLKPGESAMFLHQDIYVCPVYKTSARRGTLSTTGHSTNYVLSIELPTDMPQKHWINRGVASLCQLDN 4116          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Human
Match: DNAH1 (dynein axonemal heavy chain 1 [Source:HGNC Symbol;Acc:HGNC:2940])

HSP 1 Score: 3084.66 bits (7996), Expect = 0.000e+0
Identity = 1682/3689 (45.60%), Postives = 2366/3689 (64.14%), Query Frame = 3
Query: 1212 EHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDW--AGDKTKIYLNPIILPE-IIEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSR--RSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDT-ERITMLELEKKLDKSNERLIFLMD--------YANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQ---NLGDMNEINKYLK--KSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQ----GLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAF---NDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRF---------IAEKQENGFGK--WEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIK-LIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSIL-NW--HIITQNF-------SPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDV-ELDQSLKD--GCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGE-MKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSA-WLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYA-PPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDD--RNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLD 12110
            ++P F++ L+L+ + + +   +E FE  LLN++D+ +    +V ++E  +  D   +GD     L  + L E ++E+ ++T+ + +    +    + KE+ KY  L N ++   +    ++G       E          L +K   DS    SI +G F +  D + ++LSK+ + +   +LD + +   +    + +E+  I RK    P + E++ EL +++    ER+  LE         ER++ +MD          N ++ D N      +  +++    +  ++   + +E+F+      +  F E+L+  +  V  F     +   +EI   ++  K Q+ D +  A +     +N  E  F   +T Y     +    +PYL L+ TA ++    + WM   +  ++ +Q++ +V   ++T+ K  KQF++ P  +++A  ++ ++EEFK ++PLIQ L  PG+R RHW+ +S+ +   +R +  +  ++ ++MNL+  I     ++E AGKE+ +E+A++KM+ EWS + F V+ Y+ T T+IL S D+   +LDDHIV TQ M  SP+ KPFE  I  WE+KL L Q++L+EWL  Q +WLYLEPIFSS DI  Q+P E +++ ++++ WK+IMK    ++ V+ V    +MLD L+  N++L+ + KGL++YLE KR  FPRF+FLS+DELLEILS+TKDPT VQPHL+KCFE IA L+F E L+ITHM S+E E V L   I  S     VE WL E+E  M ASV   I + +  Y   PR +WV  W GQ  +A    YWT+ V +A++ G      + ++   Q+ ++VALVRG+LS+  R  L ALIV++VHA+DV+  LIQE V + NDF W+ QLRYYW  N++  + +N+   YGYEYLGN+ RLVITPLTDRCY TL GALHL  GGAP GPAGTGKTETTKDL KA+A Q VVFNCSD LD++A+GKFFKGLAS GAW+CFDEFNRID+EVLSVVAQQI TIQ+A   + +  MFEG E+ L P+CAVFITMNPGYAGR+ELPDNLKALFR VAMMVPDYA+I EISLYS GF  A  LA KI  T++L SEQLSSQ HYD+GMRAVK+V++AAGNLK + P  +E+++ LR+I DVN+PKFL  DL LF+GI SDLFP +     DY IL++ I+E C   NL+    F+ K  Q+YE  +VRHG M+VG    GK++ Y+VLAAA+  +  Q    G M E  V Y +LNPK+ITMGQLYG+FD ++HEW+DG+ +   RA A ++  ++KW +FDGPVDAIWIENMNTVLDDNKKLCL SGEII+L+ +  ++FE  DL VASPATVSRCGMVY+EP+ LG  P    WL+ LPP +   +++ +  +F  F++  I+ + +   KE+  +++ N+  SLL L+DC    F       KI       I+  +E  F F+  WS+GAT +  GR +F    R       ME  ++ L               L+P +G ++DYR           +E +E  + +  W  W +      ++  D  +  IIVPT DTV+ ++L+++LLT+ KP L +GPTGTGK+  I D LL  +  D Y  + + FSA+TSANQTQ+ I SKLD+RRKGVFGPP+G+  I F+DDLNMP  ETYGAQPPIELLRQW+DH  WYD K   A K L+D+ F+ AMGPPGGGRN +TPR +RH N ++  E  + +   IFS+IL NW   ++ +         +P        L++AT+ VY +  + LLPTPAKSHY FNLRD S+V QG+L++ P  +E+   + RLW HE  RV+ DRLV ++DR WF   +     K   E +++ F         KV     + ++Y DF    S  K Y  +T    + + +E Y+++YNQ++   + LVLF  A+ H+ RISR L+Q   +ALL+GVGGSGR SLTRLA+ MA+Y+ FQ+E+SK+Y  +EWR+D+K++L K+   +    FLFSD QIK ESFLEDINN+LN+G++PNLY  DE+ ++   M +   Q   ++ T  + +A Y     RVR  +H+VL MSPIG+ FR RLR+FPSLVNCCTIDWF  WP +AL +VAT FL ++ EL+ S ++  G I +C   H S      +YL EL+R+NYVTP SYLEL+  F  L+ +K+ E++  K R + GL+KL   + D++ MQ++L    P L EA+K+   TM  ++  +  A +    V+ EE  AN++AK A+AI ++   DL EA+P L++AL +L  L   D+T VR M  PP GV+LV+EAVC++KGIKP +V      G K++D+W P K LL +   FLE L  FDKDNI   ++K I + Y+ N++F+P  IA  S AC  +C+WV A+ KY  VAK V PK+ AL +A ++       L++ +  L+EV+D +  +  +      +K +LE K + C ++L RA +LI GL  EK RW +   +L     N++GD+L+++G VAYLG FT  +R      W+  +   ++P + + +LI TLG+PV+IRSW I GLP D  S+ENG+I   S+RW   IDPQ QANKWIKNMEK N L V KL+D DF+R +EN I+FG P LLEN+GEELDP LEP+LLKQT+KQ G+  +KLGD++I Y  DFR YITTKL NPHY PE S K+TL+NF ++P GL+DQLLG VV+ ERP+LEE KN+LI  +A  +++LK++ED+IL  LS+SEGN ++D   IKVL +SK  + EI  K    E+TE+ ID  R+ Y+P+AI + ILFF ++DLAN+DPMYQYSL WF+N+F   I NSE+++NL++R+ N+  Y TYSLY NVCRSLFEK KL+F+F+LC  I+ ++  I + EWR+LL+GG  +    ENP+  WL  ++W ++  L +L  F      F++    ++ I+DS+EPH + LP  W + L D F K+ VLRCLR DK+ +A+Q+FV   +  ++IEP   +L   F DSN T+PL+F+LSPG DP A L KFA++  F   K  ++SLGQGQGP A  M++  I+ G WV  QNCHLAPSWM  LE+ +E +NP+  H DFRLWLTS PS+ FPV+ILQNG KMT EPP+G+R N+ +SY S      +F  +   +  +K LL  LC FH    ERRKFGP+G+NI YEF + DLRI + QL MF+D+YD + Y  L+Y  GE NYGGRVTDDWDRR ++ IL+ FY   V   P++ +  SG Y+  PP  D  GY+ YIK+LPLN  P +FG+H NA+IT    ET  L  +I+  Q + SS G +  ++IV++V+ ++L ++P   + + VM KYP  YE+SMNTVLVQE++R+N LL  I  +LQ++ KA+KGLVVMSS LE +  S+  + +P +W  K+YPSLKPL S+V D L RL FL  W  +G P +FWISGF+F QAFLTG  QN+ARK+ I ID + FD++++ +      + P+ G Y+ GLFL+GARWD +   + ES PK L   M VIWL P    +  ++  YL P+YKT  R GTLSTTGHSTN+VIA+ +PT +P+ HWI RGVAL+C LD
Sbjct:  655 KNPLFIMDLVLDSSGVHYSTPLEQFEASLLNLFDKGILATHAVPQLEKLVMEDIFISGDP---LLESVGLHEPLVEELRATIASAVSKAMIPLQAYAKEYRKYLELNNNDIASFLKTYQTQGLLAQEVREVV-----LTHLREKEILDSSLPSSIIIGPFYINTDNVKQSLSKKRKALATSVLDILAKNLHKEVDSICEEFRSISRKIYEKPNSIEELAELREWMKGIPERLVGLE---------ERIVKVMDDYQVMDEFLYNLSSDDFNDKWIASNWPSKILGQIELVQQQHVEDEEKFRKIQIMDQNNFQEKLEGLQLVVAGFSIHVEISRAHEIANEVRRVKKQLKDCQQLAML-----YNNRERIFSLPITNYDKLSRMVKEFQPYLDLWTTASDWLRWSESWMNDPLSAIDAEQLEKNVVEAFKTMHKCVKQFKDMPACQEVALDIRARIEEFKPYIPLIQGLRNPGMRIRHWETLSNQININVRPKANLTFARCLEMNLQDHIESISKVAEVAGKEYAIEQALDKMEKEWSTILFNVLPYKATDTYILKSPDEASQLLDDHIVMTQNMSFSPYKKPFEQRINSWENKLKLTQEVLEEWLNCQRSWLYLEPIFSSEDINQQLPVESKRYQTMERIWKKIMKNAYENREVINVCSDLRMLDSLRDCNKILDLVQKGLSEYLETKRSAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIARLLFQEDLEITHMYSAEGEEVQLCFSIYPS---SNVEDWLREVERSMKASVHDIIEKAIRAYPTMPRTQWVLNWPGQVTIAGCQTYWTMEVAEALEAGNLRSQLFPQLCQ-QLSDLVALVRGKLSRMQRAVLSALIVIEVHAKDVVSKLIQENVVSVNDFQWISQLRYYWTNNDLYIRAVNAEFIYGYEYLGNSGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRVERFMFEGVEIPLVPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYAMITEISLYSFGFNEASVLAKKITTTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENPSMNEELICLRAIRDVNVPKFLQEDLKLFSGIVSDLFPTIKEEDTDYGILDEAIREACRNSNLKDVEGFLTKCIQLYETTVVRHGLMLVGPTGSGKSTCYRVLAAAMTSLKGQPSISGGMYE-AVNYYVLNPKSITMGQLYGEFDLLTHEWTDGIFSSFIRAGAITSDTNKKWYMFDGPVDAIWIENMNTVLDDNKKLCLSSGEIIKLTEAMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLMPFIECWLRKLPPLLKP-YEEHFKALFVSFLEESISFV-RSSVKEVIASTNCNLTMSLLKLLDCFFKPFLPREGLKKIPSEKLSRIVELIEPWFIFSLIWSVGATGDSSGRTSFSHWLRL-----KMENEQLTL---------------LFPEEGLVFDYRLEDAGISGTNDSEDEEEEYKQVAWVKWMD-SSAPFTMVPDTNYCNIIVPTMDTVQMSHLLDMLLTNKKPVLCIGPTGTGKTLTISDKLLKNLALD-YISHFLTFSARTSANQTQDFIDSKLDKRRKGVFGPPLGRNFIFFIDDLNMPALETYGAQPPIELLRQWMDHGGWYDRKIIGAFKNLVDINFVCAMGPPGGGRNTVTPRLMRHFNYLSFAEMDEVSKKRIFSTILGNWLDGLLGEKSYRERVPGAPHIAHFTEPLVEATIMVYATITSQLLPTPAKSHYTFNLRDLSKVFQGMLMADPAKVEDQVQLLRLWYHENCRVFRDRLVNEEDRSWFDQLL-----KRCMEQWEVTF--------NKVCP--FQPILYGDFMSPGSDVKSYELITSESKMMQVIEEYIEDYNQINTAKLKLVLFMDAMSHICRISRTLRQALGNALLLGVGGSGRSSLTRLASHMAEYECFQIELSKNYGMSEWRDDVKKVLLKAGLQNLPITFLFSDTQIKNESFLEDINNVLNSGDIPNLYTADEQDQIVSTM-RPYIQEQGLQPTKANLMAAY---TGRVRSNIHMVLCMSPIGEVFRARLRQFPSLVNCCTIDWFNEWPAEALKSVATVFLNEIPELESSQEEIQGLIQVCVYIHQSVSKKCIEYLAELTRHNYVTPKSYLELLHIFSILIGQKKLELKTAKNRMKSGLDKLLRTSEDVAKMQEDLESMHPLLEEAAKDTMLTMEQIKVDTAIAEETRNSVQTEEIKANEKAKKAQAIADDAQKDLDEALPALDAALASLRNLNKNDVTEVRAMQRPPPGVKLVIEAVCIMKGIKPKKVPG-EKPGTKVDDYWEPGKGLLQDPGHFLESLFKFDKDNIGDVVIKAI-QPYIDNEEFQPATIAKVSKACTSICQWVRAMHKYHFVAKAVEPKRQALLEAQDDLGVTQRILDEAKQRLREVEDGIATMQAKYRECITKKEELELKCEQCEQRLGRAGKLINGLSDEKVRWQETVENLQYMLNNISGDVLVAAGFVAYLGPFTGQYRTVLYDSWVKQLRSHNVPHTSEPTLIGTLGNPVKIRSWQIAGLPNDTLSVENGVINQFSQRWTHFIDPQSQANKWIKNMEKDNGLDVFKLSDRDFLRSMENAIRFGKPCLLENVGEELDPALEPVLLKQTYKQQGNTVLKLGDTVIPYHEDFRMYITTKLPNPHYTPEISTKLTLINFTLSPSGLEDQLLGQVVAEERPDLEEAKNQLIISNAKMRQELKDIEDQILYRLSSSEGNPVDDMELIKVLEASKMKAAEIQAKVRIAEQTEKDIDLTRMEYIPVAIRTQILFFCVSDLANVDPMYQYSLEWFLNIFLSGIANSERADNLKKRISNINRYLTYSLYSNVCRSLFEKHKLMFAFLLCVRIMMNEGKINQSEWRYLLSGG-SISIMTENPAPDWLSDRAWRDILALSNLPTFSSFSSDFVKHLSEFRVIFDSLEPHREPLPGIWDQYL-DQFQKLLVLRCLRGDKVTNAMQDFVATNLEPRFIEPQTANLSVVFKDSNSTTPLIFVLSPGTDPAADLYKFAEEMKF-SKKLSAISLGQGQGPRAEAMMRSSIERGKWVFFQNCHLAPSWMPALERLIEHINPDKVHRDFRLWLTSLPSNKFPVSILQNGSKMTIEPPRGVRANLLKSYSS---LGEDFLNSCHKVMEFKSLLLSLCLFHGNALERRKFGPLGFNIPYEFTDGDLRICISQLKMFLDEYDDIPYKVLKYTAGEINYGGRVTDDWDRRCIMNILEDFYNPDV-LSPEHSYSASGIYHQIPPTYDLHGYLSYIKSLPLNDMPEIFGLHDNANITFAQNETFALLGTIIQLQPKSSSAGSQGREEIVEDVTQNILLKVPEPINLQWVMAKYPVLYEESMNTVLVQEVIRYNRLLQVITQTLQDLLKALKGLVVMSSQLELMAASLYNNTVPELWSAKAYPSLKPLSSWVMDLLQRLDFLQAWIQDGIPAVFWISGFFFPQAFLTGTLQNFARKFVISIDTISFDFKVMFEAPSELTQRPQVGCYIHGLFLEGARWDPEAFQLAESQPKELYTEMAVIWLLPTPNRKAQDQDFYLCPIYKTLTRAGTLSTTGHSTNYVIAVEIPTHQPQRHWIKRGVALICALD 4264          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Human
Match: DNAH6 (dynein axonemal heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:2951])

HSP 1 Score: 2639.76 bits (6841), Expect = 0.000e+0
Identity = 1526/3753 (40.66%), Postives = 2230/3753 (59.42%), Query Frame = 3
Query: 1218 PGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPII----------LPEIIEKHK------STVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSF-EEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRE---LMKEYEEIGRKALGLPANTEQMMELIKFVSDT-ERITMLELEKKLDKSNERLIFLM-------DYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNL---GDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEE-GMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRET-GTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFT-------------------ETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWF-GQGVLAISMYYWTIYVQDAIK----EGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWV--ENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEE--NKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDI-YKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSD--AKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVEL-DQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTM--IIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDN--PHENPSAWLPPKSWDELCRLDD-LSVFHGIRQRFIEQKDS--------------WKKIYDSVEPHNQQL--------PDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEEL-NPETTHPD-FRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGG-GKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQ----SMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEIL----DDRNYDEA------------------PEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD 12113
            P F+  L+L    + FEPS+EDF   +L   +     + SV  +    Y D     T  Y+N  +          L  + E  K      S ++  +         +   F+K++         ++  L  +  D + F E+  KY K + D V        R++ L + + +   L+R     +   C ++L+ ++   RQS ++   ++ E ++   K   +P  T + +  + F+ +  ERI  LE E  +     +L+          D+A F T    +  S+    N +    D++  + E   ++F  +L    E    E++  + Q ++ Q L    D ++I   L   Q +   L+    + + + K    F  +V+ +   +EV   L+    L+++  E++   ++W++   + ++P+ ++  V  Y + + +LEK       P  +  ++K KVE+ KE +P+I  L  P L+ RHW  I   V  TL + E  + L +L  +++  F  + + IS  A  E  LE  ++K+++ W   EFV++ +R++   FIL   DDIQ++LDD  +   T+  S ++ P +  + +W+ +L L    L+EWL  Q  WLYLE IF++PDI  Q+P E + F  VDK+WKEIM++V      L       +L+  + +N LL+ I K L  YLE KR+ FPRF+FLSNDELLEIL++T++P  VQPHL+KCF+ I+ L F                     T DI  M S E E V+L   +   KARG VE+WL ++E  M  S+R      + DY+   R +WV      Q +L +S   W   + + ++       +AL  + KVN  +++ + A+V+G L K +R  L ALI +DVHARD++  L+Q +V     F W  QLRYYW    +N + +M  S   YGYEYLG   RLVITPLTDRCY  L GAL L LGGAP GPAGTGKTETTKDLAKA+A QCVVFNCSDGLDY  +G+FF GLA  GAW CFDEFNRID+EVLSV+AQQ++TI+ A  A+    MFEG E+KL  TCA FITMNPGYAGR+ELPDNLKALFR  AMMVP+YALIAE+ LYS GF +++ LA K+   Y+LCSEQLS Q HYD+GMRAVKSVL  AG+LK + PD +ED++++R++ D NLPKFL  D  LF+GI SDLFPGV  P  DY IL   I +   + NL+     + K+ Q YE M+VRHG M+VG   GGKT+ Y++LA  LG++ + G+       V+  +LNPK+ITMG+LYG+ + ++ EW DG++A+S RA    T+ D KW+I DGPVDA+WIENMNTVLDDNK LCL + E I+L+P  +++FE  DL VASPATVSRCGMV+++P  L W P   +W+K +   +T+  ++   ++F+R++D G+  I K   + + P  DI+ V +L  L++  I    D   ++ M+Q  + T L   F F Y WS+G    E    +FD   R   +     + R+                   P+ G ++      + +      WE      K     ++D  F E++VPTTDTV+Y YLM  LL      LF G TG GKS  I   LLN++ +   Y P  +NFSAQTS+ +TQ II SKL+R+RK + G P  K+I++FVDDLNMP  + YG+QPPIELLRQ+ D   +YD       ++ D+  I A  PPGGGRNP+TPRF+RH + + +    + ++  IF +ILN  +   +F P  K + + +++A++++Y     +LLPTPAKSHY+FNLRD S+ +QG+L   P TI E   + RL+ HE  RV++DRL+ ++D+ +F   + E++NKH     D+ +  L+            + +I+ DF    A  +++ Y ++ D+E     ++ YLD+YN  + K + LV F+ AIEHVSRI+R+++Q R +ALLVGVGG+G+QSLTRLAA +  Y   Q+E+S+ Y    + EDL+++ + +   D + VFLF+D QI  E FLEDINN+LN+GEVPNL+  DE ++V   +     +  ++  ++G+   ++ +F+ +VR +LHIVL MSP+G+AFR+R R FPSLVNCCTIDWF  WP +AL +V+  F   V+  ++ LK+    +C   H S   ++E+Y  EL R  Y TPTSYLELI+ + ++L +KR ++   + R + GL KL      +  M+ +L   +P L+  S++V+  M  + V+Q+S  A +    V+ +EA A  +A+  +AI ++   DL EA+P L++A KAL++L  ADI+ +R    PP  V  VMEA+ +L   KPD               W  +K+LLG+  FL+ L  +DK+NI   I+  + +KY+ N DF PE++   S AC+ +C WV A++ Y +V KVV PK+  L  A  E +  M++L +K+A L++V+D+++ L +E +     K  L   + L   +LVRA +L   L  E+ RW ++         N+TG++ +++  VAY GAFT+ +R    + W+ D     IP    FSLI  LGDP EIR WN  GLP D  S ENGI+++  RRWPLMIDPQ QAN+WI+N E K+ L++IKLTD++F+RILEN I+ G PVLLE + E LDP LEP+LLKQ F  GG + I+LGDS I+Y  +FRFY+TTK+ NPHYLPE  +KVT++NF +T  GL+DQLL  VV  E+P LEE++ KLI +   +K +LK +E++IL +L TSEGNIL++E  I  L  SK  S  I  +    E TEQ I+ AR  Y P+A   ++++F IA L+ IDPMYQYSL +F  LFN +I+ S K+ENLQQRL  L      + Y NV R LFE+ KL++SF+LC  +++    + + EW F L G  GL+   P +  + WLP  +W   C L++   VFHG+ Q  +    S              W+  Y  ++  ++ +         D W+  L  SF+K+ +++C + +K+V A+ +FV E +GK++IE PP DLP  + D +C +PL+FILS G+DPM A  +FA + G+   + +S+SLGQGQGPIA KM++  +K G WV LQNCHLA SWM  +E+ ++   +P++   D FRL+L+S PS+TFPV +LQN VK+TNEPPKGLR NI R++     S   FF  +     W++++FG+CFFHAI+QER+KFGP+GWNI YEFN++D   ++  L ++  +   + +DAL Y+TGE  YGGRVTD WD+R L TIL++F+  +  E+ DYK+ +SG Y+AP     + + +YI+ LPL  +P +FGMH+NA++    +ET  L ++IL  Q R S+GG GKS D+IV E+ A V  R+P   + E        K  Q    S+ TVL QE+ RFN LL  I +SL+ + KAI G VVMS ++E+V  S L +++P +W   +YPSLKPLGS+V D + R  F+  W   G P  +WISGF+F Q FLTG  QN+ARKY +PID L F Y ++    D     EA                  PEDG  V G+F+D +RWD K  +I ++ P  +   +PV+  +P +  + P+   Y  P+YKT  R GTLSTTGHSTNFV+ + LP+ + +++WI +G ALLCQL +
Sbjct:  511 PMFLTELMLTVQSLLFEPSLEDFLDGILGAVNHCQNTVLSVPNLVPDSYFDAF---TSPYINNKLEGKTCGTGPSLAAVFEDDKNFHTIISQIKETIQAAFESARIYAATFEKFQIFFKENESLDLQALKLQEPDINFFSEQLEKYHKQHKDAVA---LRPTRNVGLLLIDTR---LLREKLIPSPLRCLEVLNFMLP--RQSKKKVDAIIFEAQDAEYKLEFVPTTTTEYVHSLLFLDEIQERIESLEDEGNIVTQMYKLMEQYQVPTPPEDFAVFAT----MKPSIVAVRNAI----DKSVGDRESSIKQFCVHLGSDLEELNNEVNEVKLQAQDPQILDISADQDKIRLILNNLQSVLADLQKRAFQYKSYQKN---FKVEVSKFEALEEVSAELKLKQLLWDSFSEWDKLQQEWLKSKFDCLDPEVLNGQVSKYAKFVTQLEKGLP----PNSVVPQLKYKVEKMKEKLPVIIDLRNPTLKARHWAAIEQTVDATLVDAEIPLTLERLSQLHVFDFGQEIQDISGQASGEAALEAILKKVEDSWKTTEFVILPHRDSKDVFILGGTDDIQVLLDDSTINVATLASSRYLGPLKTRVDEWQKQLALFNQTLEEWLTCQRNWLYLESIFNAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRLPNALRAATQPGLLETFQNNNALLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDSISKLEFALMPPAEGKIPGIDGEPEKVYTNDILAMLSPEGERVSLGKGL---KARGNVEEWLGKVEEAMFTSLRRLCKAAIADYQGKLRTDWVVAGHPSQVILTVSQIMWCRDLTECLETEHSNHIQALKNFEKVNFERLNALAAIVQGSLPKLHRNILTALITIDVHARDIVTELVQSKVETVESFDWQRQLRYYWDIDLDNCVARMALSQYTYGYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKLSRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPFAMMVPNYALIAEVILYSEGFESSKILARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPDLNEDVVLIRALQDSNLPKFLTDDALLFSGIISDLFPGVQIPEHDYGILQSTIVDVMNRQNLQPEMCMVRKVIQFYETMLVRHGVMLVGPTGGGKTTVYRILAETLGNLQKLGIENSFYQAVKTYVLNPKSITMGELYGEVNNLTLEWKDGLMALSVRAAVNDTSEDHKWIISDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPQIHMLFEVQDLRVASPATVSRCGMVFVDPEELKWMPYVKTWMKGISKKLTEETQEYILNLFQRYVDEGLHFINKKCSQAI-PQVDISKVTTLCCLLESLILG-KDGVNLA-MEQTKLNTILCQTFVFCYLWSLGGNLTENYYDSFDTFIRTQFDDN--PDARL-------------------PNSGDLWSIHMDFDTKR--LDPWERIIPTFK----YNRDVPFFEMLVPTTDTVRYGYLMEKLLAVKHSVLFTGITGVGKSV-IAKGLLNKIQESAGYVPVYLNFSAQTSSARTQEIIESKLERKRKNILGAPGNKRIVIFVDDLNMPRLDRYGSQPPIELLRQYQDFGGFYDRNKLFWKEIQDVTIISACAPPGGGRNPVTPRFIRHFSMLCLPMPSEHSLKQIFQAILNGFL--SDFPPAVKQTASSIVEASVEIYNKMSVDLLPTPAKSHYVFNLRDLSKCVQGILQCDPGTIREEIQIFRLFCHECQRVFHDRLINNEDKHYFHVILTEMANKHFGIAIDLEY-FLN------------KPIIFGDFIKFGADKADRIYDDMPDIEKTANVLQDYLDDYNLTNPKEVKLVFFQDAIEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHICGYKCLQIELSRGYNYDSFHEDLRKLYKMAGVEDKNMVFLFTDTQIVVEEFLEDINNILNSGEVPNLFEKDELEQV---LAATRPRAKEVGISEGNRDEVFQYFISKVRQKLHIVLCMSPVGEAFRSRCRMFPSLVNCCTIDWFVQWPREALLSVSKTFFSQVDAGNEELKEKLPLMCVNVHLSVSSMAERYYNELRRRYYTTPTSYLELINLYLSMLSEKRKQIISARDRVKNGLTKLLETNILVDKMKLDLSALEPVLLAKSEDVEALMEKLAVDQES--ADQVRNTVQEDEATAKVKAEETQAIADDAQRDLDEALPALDAANKALDSLDKADISEIRVFTKPPDLVMTVMEAISILLNAKPD---------------WPSAKQLLGDSNFLKRLLEYDKENIKPQILAKL-QKYINNPDFVPEKVEKVSKACKSMCMWVRAMDLYSRVVKVVEPKRQKLRAAQAELDITMATLREKQALLRQVEDQIQALQDEYDKGVNEKESLAKTMALTKARLVRAGKLTAALEDEQVRWEESIQKFEEEISNITGNVFIAAACVAYYGAFTAQYRQSLIECWIQDCQSLEIPIDPSFSLINILGDPYEIRQWNTDGLPRDLISTENGILVTQGRRWPLMIDPQDQANRWIRNKESKSGLKIIKLTDSNFLRILENSIRLGLPVLLEELKETLDPALEPILLKQIFISGGRLLIRLGDSDIDYDKNFRFYMTTKMPNPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPRLEEQRIKLIVRINTDKNQLKTIEEKILRMLFTSEGNILDNEELIDTLQDSKITSGAIKTRLEEAESTEQMINVAREKYRPVATQGSVMYFVIASLSEIDPMYQYSLKYFKQLFNTTIETSVKTENLQQRLDVLLEQTLLTAYVNVSRGLFEQHKLIYSFMLCVEMMRQQGTLSDAEWNFFLRGSAGLEKERPPKPEAPWLPTATWFACCDLEESFPVFHGLTQNILSHPISIRLGSFETYINPQKWEG-YSKMKHEDKHMRQEKEAAHQDPWSAGL-SSFHKLILIKCCKEEKVVFALTDFVIENLGKQFIETPPVDLPTLYQDMSCNTPLVFILSTGSDPMGAFQRFARESGY-SERVQSISLGQGQGPIAEKMVKDAMKSGNWVFLQNCHLAVSWMLAMEELIKTFTDPDSAIKDTFRLFLSSMPSNTFPVTVLQNSVKVTNEPPKGLRANIRRAFTEMTPS---FFEENILGKKWRQIIFGICFFHAIIQERKKFGPLGWNICYEFNDSDRECALLNLKLYCKE-GKIPWDALIYITGEITYGGRVTDSWDQRCLRTILKRFFSPETLEE-DYKYSESGIYFAPMADSLQEFKDYIENLPLIDDPEIFGMHENANLVFQYKETSTLINTILEVQPRSSTGGEGKSNDEIVQELVASVQTRVPEKLEMEGASESLFVKDLQGRLNSLTTVLGQEVDRFNNLLKLIHTSLETLNKAIAGFVVMSEEMEKVYNSFLNNQVPALWSNTAYPSLKPLGSWVKDLILRTSFVDLWLKRGQPKSYWISGFFFPQGFLTGTLQNHARKYNLPIDELSFKYSVIPTYRDQAAVIEAAKTVQFGQELPMDMELPSPEDGVLVHGMFMDASRWDDKEMVIEDALPGQMNPVLPVVHFEPQQNYK-PSPTLYHCPLYKTGARAGTLSTTGHSTNFVVTVLLPSKRSKDYWIAKGSALLCQLSE 4158          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Celegans
Match: che-3 (Cytoplasmic dynein 2 heavy chain 1 [Source:UniProtKB/Swiss-Prot;Acc:Q19542])

HSP 1 Score: 997.653 bits (2578), Expect = 0.000e+0
Identity = 863/3261 (26.46%), Postives = 1540/3261 (47.22%), Query Frame = 3
Query: 2586 HWQQISDIVGYTLRNEEGMCLSKL-------IDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLM---LDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLD-ITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGP----------EALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNP---GYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEI-------IVPTTDTVKYTYLMNLLLT--HDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQ-----TQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPG-GGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREV-SNKHLNEDFDMLFKHLDFDEDGKVTEDDIRS---LIYCDFSD-----AKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLS--EKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMK----VIREKYLTNDDFKPERIAVASTACEGLCKWVFA-------LEK---YDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPS---AWLPPKSWDELCRLDDL--SVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECN---YGGRVTDDWDRRTLITILQKFYCIQ-VNEDPDYKFDDSGFYYAPPDL-DYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVS--ADVLNRLPPNFDTEIVMRKYPTKYEQS--MNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIP----GMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFD------NGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDR-NYDEAP-EDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALL 12098
            HW ++   +G       G  + KL       +  N+     + + ++  A  E  +  A++++    +  EF +  Y+ +    L  + + +     L D     Q+++ SP+   F  +   WE++L  +   L +  ++Q  W+YLEPIF        +P E  +F+ VD  ++ I+  V  D R++++   + +   L++  + L    K LNQ+LE+KR  FPRF+F+ +D+LLEIL ++ +P  +Q H+KK F+GI  + F+ T + I  M SSE E V L   +   +   QVE WL EL  +M  +++   ++ + D + +     + K+  Q +       ++  +++ +              E L AY    N ++D+ V+ ++          L++LI+  +H  DV+  L+  Q  + N + W  QLR+Y V   ++ + ++S  +Y YEY GN  +LV TPLTD+CY TL  A+++ LGG P GPAGTGKTE+ K LA  + +Q +VFNC +G+D  ++G+ F G+  CGAW CFDEFNR+D  VLS V+ QI TIQ AI ++  +  F G  ++++P  A+F+T+NP   GY GR ++PDNLK LFR+V M  PD  LI+   LYS GFV+A  LA KIV+ ++L  + LS Q HYD+G+RA+K VL   G L+    +++E  L++++++   L K    D   FN +  D+F  V + +  ++ L + +     +M ++     MEK+ Q+YE M  R G ++VG    GK++ +K+L  +L       ++ +  ++ T  NPKA+   +L G  D  + EWSDG++ ++ R   T  T    W++ DG +D  W+E +N+VLDDN+ L + SGE IQ   + N +FE   L+ ASPATVSR GM+Y+    +  + I  SWL        D+H  M + I E F      C+K     ++S  +   ++K+ L  +           K S+   + ++    G            T   E R+ F K    ++  GM            +VP P          K   YD R       +G   +          D +S++    E+        V T DT +Y+ ++   L   + +  L  G TG GK   +     N     +     +  SAQ+S++       QN + +     R  V+ P     +I+F+  +N+P  + YG    + LL+Q L +  ++D  +   + + ++QF+G+M P G G    I+ R    L  +++N      + +I+ + L   I+ +    + +   N+++    D+Y    +N  PT +   +LF+ RD +  +    +SL     +   ++ +   E  R++ DRL T+ D+  F   +R V      NE   ++FK   +   G V   +  +   L   + SD     AKS N+   E+ +                     P+   L  F     + I R+L  P  H  L G  G GR+   RL A M +  +F   ++ ++++ ++  +LK  + ++   + H V +  D+Q+++  FL+ IN+LL +G VP L+     Q+  + +  +  +        G   AL  F   R+R  +H+VL +    + F+  + + P+++  C + +   +  ++L  +    +E                +   T+  +L+     L+ L  +  + P  Y + +  F  LL  KR  +  +  R + G+ KL  A  +++ MQK+       L E   E D+ +  + +  + A  Q+  ++  +A    +    E  K + D  L E  P+++ A +A+ ++    ++ +R++ +PP+ VR +++AV +  GI              ++  W   ++ L +    + +  FD + I   I K    ++++K   ++ F+      AS A   L  WV A       LEK    +     +       EK M   +  + S+++    + E++ K +VL +E     + K+DL+ + D     +  A  L+  L GE +RW       G     +    L++S  + YLG  +     EK ++ L   M K       F  ++      E  +W   GLP D+ S+ENG I+  S   PL+ID  GQ + ++    +K+  +  K    D +  +E  I+FG  +++++I  E D  L P+L K    QG    I  G   I+++ DF+ Y  T+       P + V++ ++NF  T   L  QLL + +  E+PELEE  + L++ +   K +L+ LE  +L  L++S+GN+LE+ + +  LN SKE +  I +     E+  +++   +  YVP+++ ++ LFFS ++L   +PMY YS+   ++LF  +I + E   +   R++ L      +++ ++ R +F +D+L+F+    +  +    + +  EW   L  GV +D   +  +    W+ P     L R+     S+F+  +   I+   +W +   +++  N   P    E     F K+  ++ ++P+++ + + +FV + +    I PP F+L   F +S  T P+LFIL+ GADP   L +FA         + S+S+GQGQ   A + I+    +G W+ L N HL    +  +    + L+  T H +FRLWLT+   + FP  +LQ  +K+T EPP G+R N+ R+Y        +   ++K++   +  +F L + HA++QERR F P GW   YEF  +D+R++      F++Q  + + D  +++ G      YGGR+ +D+D + L + L   +C + +N     +        A  ++ +Y G+I   K++P   EP +FG+ +N   +    E      SI  T A G +    S  D  D++S    +  +L  + D  +  R+ PT    +  ++ VL  E +   +L+  +  S+ ++ K++K   + S  +++ + S++  + P     MW   S P+      Y+N  + + +     F+          PI + S  ++   FL  ++Q  +R+  IP+D L     IL       + P +    V+GL L GA +D  L+    S     Q P+  +       S I  +   + P+Y +SER          ++ + ++ +P  +  + W +  VAL 
Sbjct: 1170 HWHEMFRFLGLP----RGTTIEKLKFADLLSVSKNIIENTDQLKQLNSRAQGEVAIRDAIQELTLWAAQTEFTLADYKHSNGQNLKIIKEWKESINSLKDSQALLQSLKSSPYYSQFTDKTAVWETRLADLDVFLAQMNEIQRKWIYLEPIFGR----GALPSEASRFSRVDSEYRAILNDVSKDARLVSLCSRQSLKKSLEQIVDQLNRCQKALNQFLEQKRTAFPRFYFIGDDDLLEILGQSTNPQVIQTHMKKLFQGINRVQFSSTGETIISMVSSEGETVPLSKAV---RIVPQVESWLQELSDEMRRTLKDLTAQAVADAQPS-----LAKYPSQVLCLAEEVKFSASIENNLNGSSDLNSFKSQLLEKLKAY---TNMKVDDKVSDLK----------LKSLILDLIHHIDVVDQLLTNQAKSINSWTWQRQLRFYLVNGGIVLRQVSSEFEYTYEYQGNYAKLVHTPLTDKCYLTLTQAMYMGLGGNPYGPAGTGKTESVKALAALMGRQVLVFNCDEGIDVTSMGRIFTGIVECGAWGCFDEFNRLDSTVLSAVSMQIQTIQGAIKSRAGSCTFGGKNVQVNPNSAIFVTLNPAGKGYGGRQKMPDNLKQLFRAVVMGKPDNELISSTILYSEGFVDATALARKIVSVFQLSRQMLSKQQHYDWGLRALKVVLGGCGALRRTQTNKNETDLVVQALLLNTLSKLTFSDSERFNSLIDDIFSNVTKEMTKFEELVEPLGVAAQEMGIKLGDKQMEKVFQLYEQMRQRIGVVVVGAAGSGKSTIWKILQRSL-------ILTKKPLKVTQFNPKAVNRSKLLGNMDMDTREWSDGIITMAARE-VTKDTSVHHWIVCDGDIDPEWVEALNSVLDDNRLLTMPSGERIQFGSNVNFLFETDSLQFASPATVSRMGMIYISEEDVTPKDIVASWL---VKTTEDLHADMPSWIEEHFW----RCLKWVRSHKISGITSFAILKNGLTHL-----------KASKTKTQFLVLLFNGFL---------PTVTPENRQEFAK---GVVFQGM------------SVPDP----------KNICYDERI------DGIMSY---------TDDVSQNVTKEEVEREDLRPFVQTADTQRYSDIIGSWLQSGNRESFLITGTTGCGKQQLLKHCFQNDPESQLAS---LYCSAQSSSSHLLQLIQQNCVQASNPTGR--VWRPKDRPNMILFLKGINLPAPDKYGTNELLALLQQLLTYQGFFD-HNLEWVSIENIQFVGSMNPIGDGAAVSISNRLFSLLRCVSLNTTDSSQLTSIYRTYLT-PILEEVGERNSEIIANRMV----DIYNKVQSNFRPTDSVV-FLFSPRDLTNWV----VSLLRHELDQGKLEAVICFEARRIFADRLPTENDKLKFEEILRNVIPISQANE--TVIFKEKVYVTTGTVVPGESNTGLPLTPINMSDFNQLLAKSINRFAFEIANFNC------------------PLTSQLAFFC----ACIDRVLTGPGGHLFLPGRPGFGRRDSVRLVAHMHNIQVFSPPVTANFSAKQFDNELKNAITQAVTNNEHVVLILEDHQLRKNIFLQAINSLLASGNVPGLFT----QQELDGLVALVSEAANQASFTG---ALQQFLAHRIRSLVHVVLILEVEANDFKINITENPAILKHCNVIFADRFDRNSLVEIPKIQMES---------------QGITTTDAILTGFNDVLVNLPEHLSIQPIKYRQFVENFFQLLGYKRLTLSVRLERLKGGVSKLNEARDEVAKMQKKAGKKSKLLAEKQAEADEALKAITESMSGAEDQKLSMEQLKAATEKENVRIEEQKAKIDEQLKEVQPLIDEARRAVGSIKSESLSEIRSLRAPPEAVRDILQAVLLFMGI--------------LDTSWEAMRKFLSKSGVKDDIMNFDANRITNEIHKKVTALVKQK---SNSFEEANAKRASAAAAPLAAWVKANLEYSKILEKIAPLEGEKNKLVKNLKKAEKQMENLSKGLQSVDE---VVGELKRKFEVLMKEA---TQIKVDLDREQD----TIRIAGTLVESLSGEFERWKIQIETFGEEQSKMELCSLITSAFITYLGGCS-----EKDRKSLLKSMCKMFNMPPTFKPLSFASLETEQLNWKTKGLPADQLSLENGSILFTSCHAPLIIDRSGQVSLFLSKFLEKS--ETFKAAQPDLMTQIELAIRFGKTIIIDDI-VEFDSALIPILRKDLSSQGPRQVISFGGKSIDFNPDFKIYFCTRDEKVDIRPNSYVQLNIVNFTTTISALSAQLLDVAIHLEKPELEERSSSLLRDAELKKLELEGLEQLLLQQLASSQGNLLENTALLDSLNKSKESAEIITKSIVESEQLHKELTTQKDIYVPLSLFTSSLFFSFSNLQFHNPMYNYSVNTIMHLFGKTIKSCEDKSS--TRVETLARQMQLTVFYHISRGIFRQDRLMFAVAFINATMPK--MFQPKEWE--LFTGVLVDESTDLSALRVQWISPDRLQSLARIRTHLPSLFNNFQ---IQDDATWNEFSKTLQCEN-AFPKN-VELKMTHFQKVLFIQAVKPERLYNCLMDFVLKTLNIPSINPPAFELKHIFQESESTEPILFILADGADPSQELSEFASSMNV---PYHSISMGQGQEIAAYEAIRESASKGEWLCLNNLHLM---LQAVPSIFKHLSLTTPHENFRLWLTTEGDARFPSMMLQQSLKITFEPPPGVRNNLLRTY-------TQIDRSTKNVITCQS-IFVLAWLHALLQERRTFIPQGWTKFYEFGASDVRVA----KSFVEQLTANKAD-WEFVRGILKFVIYGGRIENDFDFKVLDSYLNVLFCDEKINGRAGSQLVKGIDLLATTNVQEYIGHIS--KSVPSVDEPYLFGLPENIKYSWQIVEADRTISSI-RTLALGDTKNALS--DQSDKISQIVSLWKKLCQSDD--LPKRELPTAIRSADPISEVLCLETINALSLIKQLHRSIGHVAKSMKTPSLASPAVQKTIQSLVFQQTPDEWDSMWAGPSDPA-----DYLNVVVKKTRGTLQLFESSKSSSLLSSPIDF-SDLFYPNIFLNALRQTTSRQIKIPLDQL-----ILSSAWTPSQLPAKQCVQVQGLLLQGATFDSFLRETTVSSAAYSQAPIVFLAWTSESSSTITGEQIQV-PVYSSSER----------SDLICSVNMPC-RGADQWNIAAVALF 4169          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 669.078 bits (1725), Expect = 0.000e+0
Identity = 529/2079 (25.44%), Postives = 967/2079 (46.51%), Query Frame = 3
Query: 5811 GKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRR--KGVFGPPV--GKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGG-GRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSL-PNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIY-CDFSDAKSSNKEYIEVTDLEL---LRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQS--------------------LKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVD---KTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDL----EN-KVDLCS--KKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSE--NLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRF-LLTGGVGLDNPHENPSAWLPPKSWDELCRLDDLSVFH-----------GIRQRFIEQKDSWKKIYDSVEPHNQQ--LPDEWAER------LKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFD--LPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQG-PIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQY---------DSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNED-----PDYKFDDSGFYYAPPDLDYE----GYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDI-------VDEVSADVLNRLPPNFDTEIV-MRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFL--SDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEI 11768
            G W+ W   V   +  S      +++VPT DTV++  L+   L   KP +  GP G+GK+  ++  L +Q   ++     +NFS+ T+            + RR   GV   PV   + +++F D++N+P  + YG Q  I  LRQ ++   +Y   D + + L  +QF+GA  PP   GR+P+T RFLRH+  + ++ +  +T +       N  ++    +P  +   +QL  A +DVY ++  +      + HY+++ R+ +R ++G+  ++ P        + RLW HE  R++ DRLVT+++REW    +   + ++             F    ++ E   R L+Y C  S      + Y+ VT  EL   +   ++G+ +E     +  + LVLF   ++HV RI RI +Q + H LL+G  G+G+ +L+R  A +    +FQ+++   YT+ ++ ED++ +LR++   +    F+  ++ +    FLE +N LL  GEVP L+  DE   +  ++++  +++  I  +      LY +F Q+V   LH+V  M+P G   R R    P+L N C ++WF  W E+AL  V +     ++LD++                     +D  ++   + H + +  +E    +  R    TP  +L+ I  F +L  +KR++++++K    +GL K+      +  +QK L+    +L E  +  +   K M+  +Q++ E  K  + ++ E A   +Q K     K   +NDLA+  P +  A  A++ +  + +  V++M SPP  V+L +EA+C+L              G+ +   W   ++++ +  F+  +  FD + +   I+K + EKY+ N D++ +++  AS AC  + KW  A   Y  +          +E   NE         KK    K V  ++  L E +   K     L    EN K DL S  +K+ R+ +L+  L  E+DRW   +     +  +L GD LLSS  +AY G +    R E   +W + V+   +      + I  L    +   W +  LP D+   EN I++    R+PL+IDP GQA ++I       N+Q     D  F + LE+ ++FG  +L++++ E  DP+L P+L ++  + GG + I +GD  I+ S  F+ ++ T+     + P+   +VT +NF +T   L  Q L  V+  ERP++++++N L++       +L+ LE  +L  L+ S+G IL+D S I+ L   K  + E+A+K A  ++   ++D     Y  ++   + ++ ++  L  I  +Y YSL + + +F   +   E S   +  +RL+ + +    +++  V R +   DK+L + +L    ++ +      E  F LL G       ++   + +P         LD L+V +           G    F   + +   +   +   N +  +P  W +       L  + N + V+  LRPD+++++    V       +++       L    N+ + + P+L   + G D    +   A +      +  S+++G  +G   A   +    K G WVLL+N HLAPSW+  LEK +  + P   H  FRL+LT+      P +IL+    +  EP  GL+ N+ RS  S P   +    T +      +L   +C+ HA+VQER ++ P+GW+  YEF++ DLR++   L   +D           + + +  L+ L  +C YGG++ + +D+  L  +L+  +  +  E      P Y  DDS F    P++  +    G++E +K   L   P   G+  NA+     +  + +  ++L       +      +++       + E++   L  LP     EIV MR+     +  +     +E+   + LL  IR  L  I    +     +++   +  S+ K ++P  W + + P    +  ++ D   RLK L      DN     FW+ G +  +A++T  +Q  A+  T  ++ L+    I
Sbjct: 1553 GDWQPWLSKVPTMEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAALRSQQEMEVVN---VNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVD-YPGQTSLQQIYGTFNRAML--KMTPAVRGLADQLTNAMVDVYLASQEHF-TQDDQPHYVYSPRELTRWVRGISEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVDTTAERY-------------FGNACRLDEALKRPLLYSCWLS------RNYVPVTREELQDYVSARLKGFYEE-----ELDVKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILDSHDE---LYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELA---EQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICIL-------------LGENVGTDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQM-EKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHK-------VEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLLMRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGG-------LDFLTVENKKSIAKARKVVGFENVFAHLQHNSAAVTSWLTNDNPESNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVET---NRQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQLEKRLHSMKP---HAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTKAPTERS-----RLYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLF---TPNMSKKDQMIGWVEELKNEQL---PAWLGLPNNAEKVLLTKRGESMLRNMLKVTDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPK----EIVKMRRTVENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQANTWSLEQLNLHIHI 3544          

HSP 2 Score: 581.637 bits (1498), Expect = 4.005e-166
Identity = 351/970 (36.19%), Postives = 532/970 (54.85%), Query Frame = 3
Query: 2547 LIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFS-SPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASL-VFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRK--------EWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQ---NRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNM------ITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQD-TLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPD-------ED--EDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNL-------ESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPD---RKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVL 5339
            L+  L    L++RHW Q+   +     N   + L ++ D ++       + I   A  E  LE+ + +M+  W   E  ++ Y +  T ++   DD+   L +H      M+ SP+ K FE   + W+ KL  +  + D W+ VQ  W+YLE +FS S +I   +P E  +F ++      +MK+V A  R+L V+ ++     L++  ++L  I K L +YLE++R  FPRF+F+ +++LLEI+  +KD TR+Q HLKK F GI ++ +  E   IT   S E E V L  ++ST   R  +  WL  LEA+M  ++   ++  L  +     +        EW+ K+  Q +   +  +W   ++  + +G  A +    V  + +  +  L    L +Q    R  ++ALI   VH RD    L+  ++   NDF WL  +R+Y+    +      + KM NS   YG+EYLG   RLV TPLTDRCY T+  ALH  LGG+P GPAGTGKTE+ K L   + +  +VFNC +  D+ A+G+   GL   GAW CFDEFNR++  +LS V+QQI TIQ A+ A  D ++   G  L ++    +FITMNPGY+GRS LPDNLK LFRS+AM  PD  LIA++ L+S GF  A  LA KIV  + LC EQLS Q HYD+G+RA+K VL +AGN+K    D       ED  E  ++++S+ +  +PK +N D+ L   + SD+FPG++        L + +   C +  L       E  S +++K+ Q+Y++  + HG M+VG    GKT A+KVL  AL         E  +    +++ KA++   LYG  DP + EW+DG+     R    +   +   R+W+IFDG VD  W+EN+N+VLDDNK L L +GE + + P+  +IFE  DL+ A+ ATVSRCGMV+     +    +F  +L ++
Sbjct:  434 LVAELKSEALKERHWHQMMKEMRVNW-NLSDLTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNY-QNKTRLIKGWDDLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEEDRSITAFHSREGEKVDLVKIVSTKDVR--INDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADGKGAEN----VEQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALER------WENVEGVAHVIDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVVTSEMLFERYLSII 1389          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 669.078 bits (1725), Expect = 0.000e+0
Identity = 531/2079 (25.54%), Postives = 970/2079 (46.66%), Query Frame = 3
Query: 5811 GKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRR--KGVFGPPV--GKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGG-GRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSL-PNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIY-CDFSDAKSSNKEYIEVTDLEL---LRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDL---CKMF-----------------HTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVD---KTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDL----EN-KVDLCS--KKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSE--NLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRF-LLTGGVGLDNPHENPSAWLPPKSWDELCRLDDLSVFH-----------GIRQRFIEQKDSWKKIYDSVEPHNQQ--LPDEWAER------LKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFD--LPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQG-PIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFID---------QYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNED-----PDYKFDDSGFYYAPPDLDYE----GYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDI-------VDEVSADVLNRLPPNFDTEIV-MRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFL--SDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEI 11768
            G W+ W   V   +  S      +++VPT DTV++  L+   L   KP +  GP G+GK+  ++  L +Q   ++     +NFS+ T+            + RR   GV   PV   + +++F D++N+P  + YG Q  I  LRQ ++   +Y   D + + L  +QF+GA  PP   GR+P+T RFLRH+  + ++ +  +T +       N  ++    +P  +   +QL  A +DVY ++  +      + HY+++ R+ +R ++G+  ++ P        + RLW HE  R++ DRLVT+++REW    +   + ++             F    ++ E   R L+Y C  S      + Y+ VT  EL   +   ++G+ +E     +  + LVLF   ++HV RI RI +Q + H LL+G  G+G+ +L+R  A +    +FQ+++   YT+ ++ ED++ +LR++   +    F+  ++ +    FLE +N LL  GEVP L+  DE   +  ++++  +++  I  +      LY +F Q+V   LH+V  M+P G   R R    P+L N C ++WF  W E+AL  V +     ++LD++  +G + L   C++                  H + +  +E    +  R    TP  +L+ I  F +L  +KR++++++K    +GL K+      +  +QK L+    +L E  +  +   K M+  +Q++ E  K  + ++ E A   +Q K     K   +NDLA+  P +  A  A++ +  + +  V++M SPP  V+L +EA+C+L              G+ +   W   ++++ +  F+  +  FD + +   I+K + EKY+ N D++ +++  AS AC  + KW  A   Y  +          +E   NE         KK    K V  ++  L E +   K     L    EN K DL S  +K+ R+ +L+  L  E+DRW   +     +  +L GD LLSS  +AY G +    R E   +W + V+   +      + I  L    +   W +  LP D+   EN I++    R+PL+IDP GQA ++I       N+Q     D  F + LE+ ++FG  +L++++ E  DP+L P+L ++  + GG + I +GD  I+ S  F+ ++ T+     + P+   +VT +NF +T   L  Q L  V+  ERP++++++N L++       +L+ LE  +L  L+ S+G IL+D S I+ L   K  + E+A+K A  ++   ++D     Y  ++   + ++ ++  L  I  +Y YSL + + +F   +   E S   +  +RL+ + +    +++  V R +   DK+L + +L    ++ +      E  F LL G       ++   + +P         LD L+V +           G    F   + +   +   +   N +  +P  W +       L  + N + V+  LRPD+++++    V       +++       L    N+ + + P+L   + G D    +   A +      +  S+++G  +G   A   +    K G WVLL+N HLAPSW+  LEK +  + P   H  FRL+LT+      P +IL+    +  EP  GL+ N+ RS  S P   +    T +      +L   +C+ HA+VQER ++ P+GW+  YEF++ DLR++   L   +D         + + + +  L+ L  +C YGG++ + +D+  L  +L+  +  +  E      P Y  DDS F    P++  +    G++E +K   L   P   G+  NA+     +  + +  ++L       +      +++       + E++   L  LP     EIV MR+     +  +     +E+   + LL  IR  L  I    +     +++   +  S+ K ++P  W + + P    +  ++ D   RLK L      DN     FW+ G +  +A++T  +Q  A+  T  ++ L+    I
Sbjct: 2485 GDWQPWLSKVPTMEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAALRSQQEMEVVN---VNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVD-YPGQTSLQQIYGTFNRAML--KMTPAVRGLADQLTNAMVDVYLASQEHF-TQDDQPHYVYSPRELTRWVRGISEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVDTTAERY-------------FGNACRLDEALKRPLLYSCWLS------RNYVPVTREELQDYVSARLKGFYEE-----ELDVKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILDSHDE---LYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELA---EQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICIL-------------LGENVGTDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQM-EKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHK-------VEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLLMRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGG-------LDFLTVENKKSIAKARKVVGFENVFAHLQHNSAAVTSWLTNDNPESNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVET---NRQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQLEKRLHSMKP---HAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTKAPTERS-----RLYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLF---TPNMSKKDQMIGWVEELKNEQL---PAWLGLPNNAEKVLLTKRGESMLRNMLKVTDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPK----EIVKMRRTVENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQANTWSLEQLNLHIHI 4476          

HSP 2 Score: 582.793 bits (1501), Expect = 3.179e-166
Identity = 351/970 (36.19%), Postives = 532/970 (54.85%), Query Frame = 3
Query: 2547 LIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFS-SPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASL-VFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRK--------EWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQ---NRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNM------ITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQD-TLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPD-------ED--EDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNL-------ESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPD---RKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVL 5339
            L+  L    L++RHW Q+   +     N   + L ++ D ++       + I   A  E  LE+ + +M+  W   E  ++ Y +  T ++   DD+   L +H      M+ SP+ K FE   + W+ KL  +  + D W+ VQ  W+YLE +FS S +I   +P E  +F ++      +MK+V A  R+L V+ ++     L++  ++L  I K L +YLE++R  FPRF+F+ +++LLEI+  +KD TR+Q HLKK F GI ++ +  E   IT   S E E V L  ++ST   R  +  WL  LEA+M  ++   ++  L  +     +        EW+ K+  Q +   +  +W   ++  + +G  A +    V  + +  +  L    L +Q    R  ++ALI   VH RD    L+  ++   NDF WL  +R+Y+    +      + KM NS   YG+EYLG   RLV TPLTDRCY T+  ALH  LGG+P GPAGTGKTE+ K L   + +  +VFNC +  D+ A+G+   GL   GAW CFDEFNR++  +LS V+QQI TIQ A+ A  D ++   G  L ++    +FITMNPGY+GRS LPDNLK LFRS+AM  PD  LIA++ L+S GF  A  LA KIV  + LC EQLS Q HYD+G+RA+K VL +AGN+K    D       ED  E  ++++S+ +  +PK +N D+ L   + SD+FPG++        L + +   C +  L       E  S +++K+ Q+Y++  + HG M+VG    GKT A+KVL  AL         E  +    +++ KA++   LYG  DP + EW+DG+     R    +   +   R+W+IFDG VD  W+EN+N+VLDDNK L L +GE + + P+  +IFE  DL+ A+ ATVSRCGMV+     +    +F  +L ++
Sbjct: 1366 LVAELKSEALKERHWHQMMKEMRVNW-NLSDLTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNY-QNKTRLIKGWDDLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEEDRSITAFHSREGEKVDLVKIVSTKDVR--INDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADGKGAEN----VEQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALER------WENVEGVAHVIDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVVTSEMLFERYLSII 2321          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 669.078 bits (1725), Expect = 0.000e+0
Identity = 531/2079 (25.54%), Postives = 970/2079 (46.66%), Query Frame = 3
Query: 5811 GKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRR--KGVFGPPV--GKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGG-GRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSL-PNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIY-CDFSDAKSSNKEYIEVTDLEL---LRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDL---CKMF-----------------HTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVD---KTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDL----EN-KVDLCS--KKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSE--NLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRF-LLTGGVGLDNPHENPSAWLPPKSWDELCRLDDLSVFH-----------GIRQRFIEQKDSWKKIYDSVEPHNQQ--LPDEWAER------LKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFD--LPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQG-PIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFID---------QYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNED-----PDYKFDDSGFYYAPPDLDYE----GYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDI-------VDEVSADVLNRLPPNFDTEIV-MRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFL--SDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEI 11768
            G W+ W   V   +  S      +++VPT DTV++  L+   L   KP +  GP G+GK+  ++  L +Q   ++     +NFS+ T+            + RR   GV   PV   + +++F D++N+P  + YG Q  I  LRQ ++   +Y   D + + L  +QF+GA  PP   GR+P+T RFLRH+  + ++ +  +T +       N  ++    +P  +   +QL  A +DVY ++  +      + HY+++ R+ +R ++G+  ++ P        + RLW HE  R++ DRLVT+++REW    +   + ++             F    ++ E   R L+Y C  S      + Y+ VT  EL   +   ++G+ +E     +  + LVLF   ++HV RI RI +Q + H LL+G  G+G+ +L+R  A +    +FQ+++   YT+ ++ ED++ +LR++   +    F+  ++ +    FLE +N LL  GEVP L+  DE   +  ++++  +++  I  +      LY +F Q+V   LH+V  M+P G   R R    P+L N C ++WF  W E+AL  V +     ++LD++  +G + L   C++                  H + +  +E    +  R    TP  +L+ I  F +L  +KR++++++K    +GL K+      +  +QK L+    +L E  +  +   K M+  +Q++ E  K  + ++ E A   +Q K     K   +NDLA+  P +  A  A++ +  + +  V++M SPP  V+L +EA+C+L              G+ +   W   ++++ +  F+  +  FD + +   I+K + EKY+ N D++ +++  AS AC  + KW  A   Y  +          +E   NE         KK    K V  ++  L E +   K     L    EN K DL S  +K+ R+ +L+  L  E+DRW   +     +  +L GD LLSS  +AY G +    R E   +W + V+   +      + I  L    +   W +  LP D+   EN I++    R+PL+IDP GQA ++I       N+Q     D  F + LE+ ++FG  +L++++ E  DP+L P+L ++  + GG + I +GD  I+ S  F+ ++ T+     + P+   +VT +NF +T   L  Q L  V+  ERP++++++N L++       +L+ LE  +L  L+ S+G IL+D S I+ L   K  + E+A+K A  ++   ++D     Y  ++   + ++ ++  L  I  +Y YSL + + +F   +   E S   +  +RL+ + +    +++  V R +   DK+L + +L    ++ +      E  F LL G       ++   + +P         LD L+V +           G    F   + +   +   +   N +  +P  W +       L  + N + V+  LRPD+++++    V       +++       L    N+ + + P+L   + G D    +   A +      +  S+++G  +G   A   +    K G WVLL+N HLAPSW+  LEK +  + P   H  FRL+LT+      P +IL+    +  EP  GL+ N+ RS  S P   +    T +      +L   +C+ HA+VQER ++ P+GW+  YEF++ DLR++   L   +D         + + + +  L+ L  +C YGG++ + +D+  L  +L+  +  +  E      P Y  DDS F    P++  +    G++E +K   L   P   G+  NA+     +  + +  ++L       +      +++       + E++   L  LP     EIV MR+     +  +     +E+   + LL  IR  L  I    +     +++   +  S+ K ++P  W + + P    +  ++ D   RLK L      DN     FW+ G +  +A++T  +Q  A+  T  ++ L+    I
Sbjct: 2485 GDWQPWLSKVPTMEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAALRSQQEMEVVN---VNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVD-YPGQTSLQQIYGTFNRAML--KMTPAVRGLADQLTNAMVDVYLASQEHF-TQDDQPHYVYSPRELTRWVRGISEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVDTTAERY-------------FGNACRLDEALKRPLLYSCWLS------RNYVPVTREELQDYVSARLKGFYEE-----ELDVKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILDSHDE---LYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELA---EQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICIL-------------LGENVGTDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQM-EKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHK-------VEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLLMRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGG-------LDFLTVENKKSIAKARKVVGFENVFAHLQHNSAAVTSWLTNDNPESNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVET---NRQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQLEKRLHSMKP---HAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTKAPTERS-----RLYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLF---TPNMSKKDQMIGWVEELKNEQL---PAWLGLPNNAEKVLLTKRGESMLRNMLKVTDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPK----EIVKMRRTVENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQANTWSLEQLNLHIHI 4476          

HSP 2 Score: 582.793 bits (1501), Expect = 3.179e-166
Identity = 351/970 (36.19%), Postives = 532/970 (54.85%), Query Frame = 3
Query: 2547 LIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFS-SPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASL-VFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRK--------EWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQ---NRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNM------ITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQD-TLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPD-------ED--EDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNL-------ESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPD---RKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVL 5339
            L+  L    L++RHW Q+   +     N   + L ++ D ++       + I   A  E  LE+ + +M+  W   E  ++ Y +  T ++   DD+   L +H      M+ SP+ K FE   + W+ KL  +  + D W+ VQ  W+YLE +FS S +I   +P E  +F ++      +MK+V A  R+L V+ ++     L++  ++L  I K L +YLE++R  FPRF+F+ +++LLEI+  +KD TR+Q HLKK F GI ++ +  E   IT   S E E V L  ++ST   R  +  WL  LEA+M  ++   ++  L  +     +        EW+ K+  Q +   +  +W   ++  + +G  A +    V  + +  +  L    L +Q    R  ++ALI   VH RD    L+  ++   NDF WL  +R+Y+    +      + KM NS   YG+EYLG   RLV TPLTDRCY T+  ALH  LGG+P GPAGTGKTE+ K L   + +  +VFNC +  D+ A+G+   GL   GAW CFDEFNR++  +LS V+QQI TIQ A+ A  D ++   G  L ++    +FITMNPGY+GRS LPDNLK LFRS+AM  PD  LIA++ L+S GF  A  LA KIV  + LC EQLS Q HYD+G+RA+K VL +AGN+K    D       ED  E  ++++S+ +  +PK +N D+ L   + SD+FPG++        L + +   C +  L       E  S +++K+ Q+Y++  + HG M+VG    GKT A+KVL  AL         E  +    +++ KA++   LYG  DP + EW+DG+     R    +   +   R+W+IFDG VD  W+EN+N+VLDDNK L L +GE + + P+  +IFE  DL+ A+ ATVSRCGMV+     +    +F  +L ++
Sbjct: 1366 LVAELKSEALKERHWHQMMKEMRVNW-NLSDLTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNY-QNKTRLIKGWDDLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEEDRSITAFHSREGEKVDLVKIVSTKDVR--INDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADGKGAEN----VEQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALER------WENVEGVAHVIDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVVTSEMLFERYLSII 2321          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Celegans
Match: dhc-3 (Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G5EDV4])

HSP 1 Score: 241.121 bits (614), Expect = 8.782e-63
Identity = 148/420 (35.24%), Postives = 244/420 (58.10%), Query Frame = 3
Query: 7677 KYLLELSRYNYV-TPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRW----IQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAE---KTKQWLHDVMEKSIPCSDKFSLITTLGDPV 8912
            K L +LS +  + T    L+++ST   L  KKR EV+K   +YE G+EK++ A   ++ MQ EL   QP+LV  S E    M  +E+++ +     ++V   E  AN+ A  A+++K E + +LA AIP LESA++ALET+T +D++ ++TM  PP  VRL MEAVC+L G+KP ++ +    G+ + D+W   ++LL ++ FL  +++F +D +    +K+IREKYL+ ++F PE +   S A EGLC+WV A++ Y++++K+V PK+  L KA       +  L  KR AL +V +KL+ L+++     ++K +LE+++  C  ++ RAE+L+  L GEKD+W        H+  +      G    SS  +   G      R +   KT + L   +E +IPC  K +L+  + DP+
Sbjct: 2083 KVLDDLSDFKMINTRAEKLKMVSTITKLAKKKREEVRKTMTKYEKGMEKMKRAEEQVAGMQGELLRLQPQLVRTSIETSMLMSTIEKETIDVENAREVVAANENKANEAATKAQSLKAESEAELASAIPALESAVEALETMTQSDVSSLKTMRFPPYAVRLCMEAVCILLGVKPAKITNE--IGEVVNDYWVSGQKLLSDIHFLAKIRSFARDTVSKKTVKLIREKYLSKEEFDPENVKQCSLAAEGLCRWVLAIDMYNQISKIVEPKRERLRKAEVLVKQHLKQLEVKRKALLKVTEKLQGLSDQFSQMCQKKQELESQISSCEVRMERAERLVQALSGEKDKWKNKITYITHEDSLSVPYSVG----SSLALHVFGKLPIDQREKELRKTMRSLFPRLEVTIPCDLK-TLVMLVEDPI 2495          

HSP 2 Score: 156.377 bits (394), Expect = 3.780e-37
Identity = 116/467 (24.84%), Postives = 229/467 (49.04%), Query Frame = 3
Query: 2541 MPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLD-KLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGL--VDYKATPRKEWVKKWFGQGVLAISMYY---WTIYVQDAIKEGP-EALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVN-LIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLG 3917
            +P++  +    ++DRHW+ I      +++ E    +S+L++MN      KFE +   A KE  LE ++EKMK++W    FV       G  +L++  ++ + +  H+ ++QT+  SP        I+ W   L+ +   +  + +    W  +E +FS+ DI  QMP E R F  +   W  I  Q+  ++ +L  + + + L+ +L +   L   +  G + YL KKR  FPR F LS++ +L ++ ++++P   + ++   F  + +      ++I  + S++ E ++L   ++ + ++  VEKW+ EL++ +  ++R  I   +  ++YK +P    V+    + +   ++Y    +T  +++++K+     L + LK+        V      L K +R     ++     +   LVN L+ EQV   +D+ W  QLRYYW   N+  ++     +Y YE  G
Sbjct:  692 LPVLGAISCQAMKDRHWKMILQDSETSVKVEGNPLVSELLEMNFIEKADKFEQVGAQAEKERVLETSIEKMKSQWVTATFVT----HQGGELLTT--ELNVQMQAHLARSQTILSSPHAFSILDHIRHWLDTLLNLNTFVHLYKQCDTRWRKIEGVFSTEDIAYQMPHEFRTFKKISLRWLHINNQITEERPILEQMDLVQQLNLELSELEVLFGRMENGFHAYLRKKRAVFPRLFALSDELVLSLICDSREPANCKSYIPLLFPSLTTFDQNTKMEIISV-STKLETISLVKPVNVNLSKRHVEKWMHELDSQIKYTLRTRIRLLIEKMNYKLSP----VETILNEPIQVAAVYLKIAFTWQMENSMKQNSLTILASELKICIRDCQHAV------LHKHDRWEFLPVLYHIYKSSTHLVNKLMNEQVIFIDDYRWTSQLRYYWHLENVFIRVGTVSTRYDYEVQG 1141          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Fly
Match: Dhc36C (gene:FBgn0013810 transcript:FBtr0304742)

HSP 1 Score: 4259.14 bits (11045), Expect = 0.000e+0
Identity = 2190/3980 (55.03%), Postives = 2828/3980 (71.06%), Query Frame = 3
Query:  282 LRKDREKFRKALVDMILQGEDRPIKESIETVRLPPLTQEKTPVGMSATEKDILRYYYYIHNGIDTEHVAKMEXXXXXXXXXXXXXXXXAEHPXXXXXXXXXXXXXXXXSVKKAIVDFVLKEPREKETDDTPI-----PEHRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDT-VIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAI--KEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQG----LY------------PHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPH-NQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQV-NEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQ------ARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILD----DRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPT--DKPEEHWIMRGVALLCQL 12107
            +R +RE FR+ LV++IL  +D    E      +P   QE         E++ILRYYYYI +GIDT HV+ +    +  + +L+   L  +    L +   E++ DY+ ++KKA+VDFVL+           +        R+E+  +   W   +        K L+  +  +  +LELW + +K+  L+D +E    ++   L  F + C  HI+  K  L + W  ++ +   + +K+  +P ++    ++RFFNC + LMT  L+++ + S+ +Y +        I    H                      +PGF + ++L D   I+F PS    ++ LL V D +M  I  + RIES+LY+D    K KI+L P +   I+++ K+ +  +L ++ +GP   +++FD +  LIN    + +   +   E   +FE++A  + +Y +   +I  +    IR+G +E   D+ I  L    + +   LL R++   +     L KEY+ I +KAL +P +T ++M+L  +V   E   + E+E +L  +   +++LMD+  ++  ++  N + F  + ++ SIF++++  + +K  E+Q  LK + E F  EL +Y +QV+ +   GD+ ++++Y K++ VLD +L  A+  I+  N+EE ++GWD++ YP+R++  + L+PY  L++   +F  K+  WM   +   +PD++D DV N+YR + KL+KQ  + PI  ++   VK ++E F+EHMP+I TL  PG++ RHW+ +S+I+G+ ++    + L K+I+  L+ ++PKFE+ISE+A KE NLE+AM KM NEW  +EF +  YR++GTF L++VDDIQ++LDD I+KTQTM+ SP+IKPFEA+I  WE+KL+L+Q+ILDEWL+VQATW+YLEPIFSSPDI  QMPEEGR+F++VDK WKE+MKQV  D +V+ V+QI+KM DKLKK+  LLE I KGLN YLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQ HLKKCFEGIA+L FTE LD+T M+SSE E VTL DVISTSKARGQVEKWLLELE DM  SV   +SE    Y    R  WV  W GQ V +IS+ YWT+ + +    +E  E L  YL+    QI++IV LVRG L+ QNR TL AL+VLDVHARDVL  ++  QV +  DF WLCQLRYYW +NN+ T+MIN  L YGYEYLGNT RLV+TPLTDRCYRTLF AL+LHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDY+ALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQR I +   TL+FEGT L LDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALI+EI LYS GF+ A+PL+VKIVATYRLCSEQLS+Q HYDYGMRAVKSVL AAG LKL+Y DE+EDIL+LRSI DVNLPKFLN D+PLF GI SDLFPG   P  DY + NK  +  C + N + + F +EK+QQ+YEM++VRHG M+VG PFGGKT+ Y+VLA AL +  E+    ENK  YT++NPKAITMGQLYGQFD VSHEWSDG+LAV+YR FA S +PDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLS +TNL+FEPMDLEVASPATVSRCGM+Y+EP+SLGW P+  SW   LP A   + K++ + +  RF    +  I +   KE++PTSD N++ SL+N  +C ID F DE  ++ +   D     EG+F F+  WS+G + + + R+ F+ + R LM               +T P  L D  G    LY            P +G+++DYR+I E    G GKW+ W + V     I +D   N+II+ T ++V+   +++LL  H KP + VGPTGTGKS Y+ID++L +M+   YKP LI+FSAQTSANQTQ+IIMSKLD+RRKGVFGPP+  + ++FVDD++MP++E YGAQPPIELLR  LDH  WYD K+   +KLIDLQ I AMGPP  G N +TPRF R  N I+I++F+++ + TIFS I+ WH+ T+ FS +F P +++++ ATL +Y  A  NLLPTPAKSHYLFNLRDFSRVIQGVLLS+P   E+   M+RLW HE+ RVY DRLV D DR W F  I        N D   LF  L  ++D  + E D R LIYCDF++ K+  K Y+EV DLE LR+ VE YL EYN MSKKPMNLVLFRFAIEH+SRI RI+KQPRSHALL+GVGGSGRQSLTRLA+ + DY+LFQVEI++ Y   E+ ED+K ILRK   ++ H VFLF+D QIK ESFLEDI+NLLN+GEVPNL+  +EK EV EKM QID+QRDK  QTDGSPVAL+NFFV   +DQLHIVLAMSPIGDA RNR+RKFPS+VNCCTIDWFQ+WPEDAL AV+TRFL   +L    +   ID+C  FHTST+ LS K+   L RYNYVTPTSYLELI TFK LL +KR  +   + RY  G+ +L  AA  ++VMQ++L   +PKL EAS+ V + +  V   S  A +Q +IVK +E+ A +QA  A+ IK+ECD  L EA+PILESAL AL TLT ADI +V+TM SPP GVR+VMEAVC+LK +KPD+V +PSG G  +ED+WGPSKR+L +MKFL+ L  FDKDNIP+ +MK + ++ L+N+ F P++I  ASTACEGLC+WV AL KYD VAK+VAPKK+AL +A   YN AM +LN+K A L +V+  L  + + L+   R+   L  + + C+KKL RA++LI GLGGE+ RW + A  L   F ++TGD+L+SSGVV+YLG FT  FR ++ ++W+   +   + C+  F L   LG+PVEIR WNI GLPTD FSIE+ I++ N+RRWPLMIDPQGQANKWIKN EK N L VI+L  AD+ R++EN IQFG PVLLENIGEELDP+LE +L K  FKQGG++CIKLGDS+IEY+  FRFY+TTKLRNPHYLPE +VKVTLLNFMIT +GLQDQLLGI V+RERP+LE EKN LI Q A+NK+ LKE ED+IL VLS++E NILEDE+A+++L+S+K L+N+I+EKQ   E TE++ID ARL YVPIA HSTILFF+I +LANIDPMYQYSL WF+NL+  SIDN+EK +++  RL +L+++FTYSLY N+CRSLFE+DKLLFS IL  N++KHD+ I   EW FLLTGGVGL+NP++NP+ WL  ++WDELCRL +L+ F G+R+ F E    WK  +DS  P  N+ +P  W  R+   F K+ +LR  RPDK+V A+ NFV   +G+++++PP FDL  SF DS+C  PL+FIL+PG+DP A LLKFA+DQGFG  +  SLSLGQGQGPIAMKMI  G+K G WV+LQNCHLA S+M +LEK  E L P+ THPDFRLWLTSYP+  FPV +LQNG+KMTNEPPKGLR NI RS +SDPISD E++ +      +K+L++ LCFFHA++QERR FGPIGWNI YEFNETDLRIS+ QL MF++QY++V YDAL+YLTGECNYGGRVTDDWDRRTL TIL KFYC  V + +  Y  D++G YY P   + + Y+ + + LP    P +FG H NADI KD +ET +L    LLTQ               + +++V  V+ D+L++LP  FD +  + KYPT Y QSMNTVLVQEMVRFN LL+TIR+SL  +RK IKGLVVMS  +E V  S+L +KIP MW  KSYPSLKPLGSYV DFL RL+FL  WFD+G P  FW+SGF+FTQAFLTG QQNYARKY I IDLL FDYE+L      R     PEDG +V G+FL+GARWDR  K + ES P+ L D MP+IWLKP+K+ ++P + +YL PMYKT+ERRG LSTTGHSTNFV+AM L    + P  HWI+RG ALLCQL
Sbjct:  110 MRLEREHFRRKLVELILHMDDDQDPELAAQCAVPFPDQE---------EREILRYYYYIKHGIDTIHVSPLSKKILKRITDLVPPLLY-KWQTALNENIAEVRADYVFAMKKAVVDFVLRHTVLDRLTKEGVGGKYDTAERREVQSMTNFWRYRYDENRNVLMKTLFCIHRSVASILELWSMKYKDKSLIDSKELAKVESPFSLFTFVYLCGSHIDNGKTLLEESWYGEIHSSLLKASKRGQLPDIRRFTLVKRFFNCVAALMTQQLEDICIRSLKEYAD-------FICDYGH---------------------SNPGFEISVMLADEDTIQFNPSFSKVQSELLRVIDSIMLSIQMLPRIESKLYTDLIVSK-KIFLTPTVPESIVQETKNRICAMLEEQRIGPELRLQDFDPFIDLINGSDAERVGNFM---ESDATFEQYADMVYEYKEKEDRIAKEVWAVIRMGFYEFHRDKFITHLESLCRQLQLDLLARMVTDQQARITRLGKEYDAIAKKALTVPKDTAELMQLKAYVVHAEENLVPEMEARLKVNMSEILWLMDHTLYSPLEIKNNSNSFQWYLKLPSIFEQHRAIIAEKVIEYQELLKKRIELFRRELQNYYEQVQTYDTWGDIKQLSRYKKRAGVLDQRLVQAMETIDQINEEETSYGWDLSQYPMRKKAHDQLKPYKTLFDAGQDFMDKWDLWMHSQVGSFDPDEIDGDVSNFYRIIQKLDKQMGDHPITMQLIQDVKAQIEAFREHMPIINTLGNPGMKARHWELVSEIIGFPIKVSPELTLEKIIEYQLDEYVPKFEAISESATKENNLERAMAKMVNEWEGVEFSISPYRDSGTFKLAAVDDIQILLDDQIIKTQTMKSSPYIKPFEADIIKWEAKLMLLQEILDEWLRVQATWMYLEPIFSSPDIQQQMPEEGRRFSAVDKIWKELMKQVSQDPKVMVVVQIDKMNDKLKKAYSLLEVIQKGLNAYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQIHLKKCFEGIATLNFTEELDVTAMRSSEREEVTLVDVISTSKARGQVEKWLLELEIDMKKSVHHKVSEAFYSYLKMLRHVWVLTWPGQCVQSISLTYWTLEITECFESEEPKENLAKYLQKCVLQINKIVDLVRGDLNTQNRITLGALVVLDVHARDVLAEIVANQVEDLQDFQWLCQLRYYWEDNNLDTRMINCSLPYGYEYLGNTPRLVVTPLTDRCYRTLFAALNLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRGINSGSPTLVFEGTTLTLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALISEIELYSYGFLTAKPLSVKIVATYRLCSEQLSTQCHYDYGMRAVKSVLKAAGALKLRYRDENEDILVLRSIKDVNLPKFLNQDIPLFQGITSDLFPGTVLPEADYVLFNKCTQMACERQNKQCTPFVLEKVQQLYEMIVVRHGLMLVGYPFGGKTTTYRVLAEAL-ECMEKTDGSENKAIYTVINPKAITMGQLYGQFDAVSHEWSDGILAVNYRIFAISDSPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSNTTNLVFEPMDLEVASPATVSRCGMIYLEPSSLGWEPLVASWKNTLPAAFHTVSKQLISMLISRFCPI-LLFILRKSLKEIAPTSDANLMVSLMNFFECFIDDFRDEKYVANVSDLDFRAQTEGIFLFSCIWSLGGSLDADSREKFNIIFRALME--------------KTFPQSLYDTYGVPEDLYVESLAKPFIFPIPKQGSVFDYRYIKE----GKGKWKPWQDDVNSAPPIPRDIPVNQIIIQTNESVRIGAVLDLLNRHGKPIMLVGPTGTGKSVYVIDYMLKKMDLSFYKPLLISFSAQTSANQTQDIIMSKLDKRRKGVFGPPLNSRFVIFVDDVSMPLKENYGAQPPIELLRMMLDHMMWYDRKNIVPMKLIDLQMIVAMGPPSTG-NTVTPRFQRFFNVISIDDFNNDILNTIFSKIVLWHLDTRGFSKEFDPCIDEIVGATLTIYNDAKLNLLPTPAKSHYLFNLRDFSRVIQGVLLSVPEATEDVNSMRRLWVHEVLRVYGDRLVEDADRSWLFENICSTVKSCFNTDPSRLFGRL-VEKDKSLQESDFRQLIYCDFTNPKADTKNYVEVQDLEELRRVVEAYLVEYNNMSKKPMNLVLFRFAIEHLSRICRIIKQPRSHALLIGVGGSGRQSLTRLASHICDYELFQVEITRLYGPYEYHEDIKAILRKIGASEMHGVFLFTDVQIKDESFLEDISNLLNSGEVPNLFTNEEKIEVQEKMAQIDKQRDKAVQTDGSPVALFNFFVTTCKDQLHIVLAMSPIGDALRNRIRKFPSIVNCCTIDWFQSWPEDALLAVSTRFLASEDLTALERRTAIDMCMEFHTSTQELSAKFFSRLHRYNYVTPTSYLELIQTFKALLSQKRNNITNNRNRYLTGISQLDIAAQQVAVMQEQLIALEPKLKEASEIVAEQVAKVTADSKLAEEQREIVKLDESAAKEQAAVAQEIKDECDAKLGEALPILESALAALNTLTTADIAVVKTMKSPPIGVRIVMEAVCILKDVKPDKVPNPSGLG-TVEDYWGPSKRVLSDMKFLDSLLNFDKDNIPVEVMKKLAQRILSNEAFDPDKIKSASTACEGLCRWVIALTKYDVVAKIVAPKKLALAEAEATYNAAMKTLNEKLAMLAKVEANLAAIQKILDEQLRQYGILLAEHEACTKKLQRAQELISGLGGERTRWSETAKMLQASFKSVTGDVLISSGVVSYLGPFTIDFRVDQIRKWVTKCLNFGVTCTADFQLAVVLGEPVEIRFWNICGLPTDAFSIESAIMMKNARRWPLMIDPQGQANKWIKNYEKNNKLCVIRLNQADYTRVMENAIQFGLPVLLENIGEELDPVLESVLQKTLFKQGGALCIKLGDSVIEYNHSFRFYMTTKLRNPHYLPEVAVKVTLLNFMITTQGLQDQLLGITVARERPDLEAEKNNLIVQGADNKRMLKETEDQILEVLSSAE-NILEDETAVQILSSAKALANDISEKQVITEATEKQIDIARLSYVPIAEHSTILFFTIVELANIDPMYQYSLVWFVNLYMSSIDNTEKVDDIAARLLDLRNHFTYSLYVNICRSLFERDKLLFSLILNINMMKHDNRIDNAEWMFLLTGGVGLENPYKNPTTWLGVQNWDELCRLTNLTNFKGLREDFNENSAQWKPFFDSKSPQDNKDIPKSWDNRVS-VFQKLLLLRVFRPDKLVPAVLNFVSGELGERFVDPPQFDLMASFADSHCCVPLIFILTPGSDPTATLLKFAEDQGFGTNRLFSLSLGQGQGPIAMKMIDEGVKMGNWVVLQNCHLAASFMPLLEKICENLLPDATHPDFRLWLTSYPADHFPVVVLQNGIKMTNEPPKGLRSNILRSMISDPISDPEWYESCTQPRIFKQLIYSLCFFHAVIQERRYFGPIGWNIPYEFNETDLRISLMQLRMFLNQYETVNYDALRYLTGECNYGGRVTDDWDRRTLKTILDKFYCPAVIDLETPYYLDETGLYYVPVFKEVDLYLNFTRDLPQISAPAIFGFHANADIMKDQKETDMLLSHTLLTQDTSASSDDSGGSKALTPEEVVTNVATDILDKLPKLFDRDAALLKYPTLYHQSMNTVLVQEMVRFNVLLNTIRTSLITLRKGIKGLVVMSPAVEAVYKSVLIAKIPAMWAGKSYPSLKPLGSYVTDFLRRLEFLQHWFDHGAPSTFWLSGFFFTQAFLTGAQQNYARKYVISIDLLAFDYEVLTVEEPQRQGLSGPEDGVFVYGIFLEGARWDRTGKYLAESRPRELFDTMPLIWLKPLKRVDLPERHNYLCPMYKTAERRGVLSTTGHSTNFVVAMLLLCNPNTPVSHWIIRGTALLCQL 4022          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Fly
Match: Dnah3 (gene:FBgn0035581 transcript:FBtr0289982)

HSP 1 Score: 3146.68 bits (8157), Expect = 0.000e+0
Identity = 1692/3584 (47.21%), Postives = 2316/3584 (64.62%), Query Frame = 3
Query: 1620 DLVKKIE------YDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRK-----QVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENN-----MITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDIC--EQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVL--PPAITDIHKKMWADIFERFIDAGIACI-XXXXXXELSPTSDINVV-KSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQ---DYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQ-----------------------------------SLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENP-SAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKM---CVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELN-PETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLS-----AWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQ------ARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILD-DRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKS--EIPNKPS-------YLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD 12113
            +L+KK++      Y  R  I L +F L    +  +L    + + + ++D     +   NR + +E EE+  KA   P  T +++ L  +++D   + +  ++ ++    +R++FL+ +   ++ +++LN   F     +  + D +   +   ++  +  L+ +R  F + L   ++     ++ E +++  + E+ + +    +L T +E      +  N EE     DV+ +P+  E+   + P  KL++T+ EF   Y  WM    E +  D V   V N ++ ++KL +Q    P+ K+ A +++ K+E+F+ ++P++ ++   GL  RHW QIS I+G  +  +    L  +ID+++   +P+ E I+ AAGKE++L   +  M+ +W  + F V+ YR++ T IL+S+DDIQ +LDDHI++TQ M+ SPFI    ++  DWE++L+L+Q+I+D W +VQ TW+YLEPIFSS DIM QMP EGR F +VDK W++IMK  + D+ V+   +  +ML+   K+ E LE++ KGLN YLE+KRL+F RFFFLSNDELLEILSETKDP RVQPHL+KCFEGI SL F + ++I  M S E E V L   I+   A G VE WL E+E  M+ SV+  + E   DY    R  WV  W GQ V  IS   WT  V++AI+   + L AYL+ +N QI ++V LVR  L    R  ++ALIVLDVH RDV+  L   ++ N  DF W+ QLRYYW  N      +   M+ + ++YG EYLGN  RLV+TPLTDRCYRTL GAL L LGGAPEGPAGTGKTET KDLAKAVAK+CVVFNCSDGLDY ALGKFFKGLA  GAW+CFDEFNRI+LEVLSVVAQQILTIQRAIG +     FE T LKLDPTC++FITMNPGYAGR+ELPDNLK LFR+VAMMVPDYA+I EI+LYS GF  AR L+ KIV  Y+LCSEQLSSQ HYDYGMRAVKSVL A+ +L+  Y D  E  ++LR+I+DVNLPKFL  D+ LF GI  DLFPGV  P+P    + K++  N    NL+++ +++EKI QIYEM++VRHG MIVG   GGKT+AY+VLA  L ++   E+  ++E  V + I+NPKAITMGQLYG+FDPVSHEW DGVLA ++R        +R W++FDGPVDA+WIEN+NTVLDDNKKLCLMSGEI+Q++   N++FEP DLE ASPATVSRCGM+YMEP+ LGWR +  S++ VL     + DI+  ++ D+ E  + A +  + +     ELSP        +  L+ ++          K  Q +Q     W + +F F + W+  +    +G+K FD L R+++ G             E  P P     +   ++P K    DYRF  ++ EN +  W+   +      +  ++A+ +E+IVPT +T   +Y     ++     L VGPTGTGKS  I   LL  M K     N+INFSA+TSA   Q+ IMSKLDRRRKGVFGP +GKK  VF DD+ MP ++TYG+Q P+ELLR WLDH  W DL DTT I+L+D+  + AMG  GG  N I PR  RH+  + ++ F D T++ IF++I +WH  ++ +          L +A + VY+ A+ + LPTPAKSHY F+LRD +RV QG+++  P  + +P  + RLW HE +RV+YDRLV  QDR+       +    +L    +  F     +   K+T++D+R+L Y ++ +  +  K Y E    E L K ++ YL EYN  S  PM+LV+FRFAIEHVSR+SR+L+ PR + L+VG+GGSGR+S  RLAA +AD  L  V++SKSYT T+WR+DLK+IL  ++   NH VFLFSD Q   E ++EDIN +LN G++PNLY  ++K  + E M  + +Q  KI   D  P  +Y +++ R+R+QLHI LA SPIGD+F+ R+R +PSL+NCCTIDW+  WPE+AL+ V   F+  + L++                                    L+   +D    FH S    SEK  LEL+R NYVTP++YLEL+  F+    +K  E+ + + RY  GLEKL  AA  +  MQ  L D QPKL   S+E D+ M+ +E+++ EA K++++V  +EA AN+ A AA+AIK++C+ DLAEAIP +E+AL+AL TL PADI IV++M +PP GV+L MEAVCV++GIKPDR  DP  SG  +ED+WGPS R+L +MKFL+ LK FDKDNIP PI+K IREKY+ + DF PE+I  AS ACEG+C+WV A++ YDKVA++V PKK AL +A  E +  M  LN KRA L+ + DKL+ L +      R K  LE+++D C KKL RAE+L+GGLGGEK RW +AA +L     N+ GD+LL+ G  AYLG FT+ +R      W      K IP S+ FSL TTLG P+ IR+W++ GLP D FS+ENGII++NS R+ L+IDPQ QANKWIKNMEK NNL+VIK +DA+++++LE  I FG PVL+EN+GE+LD  L P+L K   K  G + IK GD +IEY+ +FR YITT LRNP Y PE  V VT+LNFMIT +GL++QLL IVV+ ERP+L+E+K +LI +SA N+  L  +E +IL VLSTSEGN+LEDE+AI +L+SSK LS +I EKQ     TE +ID AR  Y+P++ HS ILFF I++LAN+DPMYQYSL+WF+NLF  +I  + KS+ L +RL+NL  YFT S+Y NVCRSLFEKDKL+ S ++C  IL     +++    F LTGG+G      NP  AWLP KSW  +C+  DL     + Q      D W   YD+  P   QLP        ++ N M    V++ LRPDK+V A++ F+   + + ++EPPPFDL  SF DS+   PL+F+LS G+DPMA+L  FA  +     K +++SLGQGQGP A KMI    + G WV+LQNCH+A SWMG LE+   +    +  + D+RLW TSYPS+ FPV++LQN VKMTNEPPKGLR N+ RS+ SDP+   +FF  +   S      W + +F L FFHA+VQERR+FGP+GWNI YEFNE+DL+IS+ QL MFI+Q  S+ +    YLTGECNYGGRVTDD DRR ++++L   Y     E+ +Y    SG Y  P        IEY+ + PL+P P V+G+H+NADI ++ +ET  L   +LLTQ       + SS GG   D  +  +   VL +LP  F+ + V + YP  Y  SMNTVL QE++RFN LLS IR SL N+ KA+ G + M  +LE    SM+  K+P  W+KKSYPSLKPLGSYV+D LARL F  +W DNG P ++WISGFYFTQ+F+TGV QNY+RK    ID++  ++ +   +      P+ GAY++G+F++GARW+RK K ++ES  KVL D +PVI+L+P+ K+  ++P   +       Y  P+YKTSERRG LSTTGHSTNFV+ + L   +   HWI RG A LCQLDD
Sbjct:  847 ELLKKLQAVSDTTYYLRDFIPLNLFMLDNRHVKLSLRMYVREIYDFIIDFYKALNWNENRAICEELEEMSMKAGERPEETPEVVALQNYINDCREMRIFAIKDEIKNVLKRVVFLLTHTYLSSDELHLNSRTFILPGELEEVLDLSAARLAVVRDNLELALRERRMEFEKLLAQEKRTMDGFRIREIRDVLTLEELKERVDTVDLLFTTIENLSREAKAINTEETLLQIDVSAFPLLAEIIEKMEPIEKLWKTSYEFEKDYLIWMFERFECLNADGVREQVENMHKIMYKLSRQLAYNPVAKRAAEQMRMKIEKFRVYLPVLDSICRHGLEKRHWDQISKILGRKVNPKLFPTLKDMIDVDIMSILPQLEEIANAAGKEYDLNNGLRIMQADWRDVMFEVLQYRDSDTHILASLDDIQTLLDDHIMRTQAMKRSPFITALGSKADDWEARLLLIQNIIDAWTQVQITWMYLEPIFSSEDIMRQMPLEGRNFKAVDKLWRKIMKHTLKDRHVMAATEYPEMLEVFTKAIEDLETVTKGLNTYLEQKRLFFARFFFLSNDELLEILSETKDPMRVQPHLRKCFEGIGSLTFDDNMEIVEMVSDEEERVALVRKINPQLANGLVEMWLKEVEMVMLDSVKEQMREAWEDYAMVERISWVVSWPGQVVQGISCMAWTYEVEEAIET--KELPAYLEKSNLQIADLVQLVRTDLQAGVRIAVEALIVLDVHDRDVVKYLTDCRITNIQDFDWISQLRYYWKVNEKNEDWVCVSMVVTDVEYGMEYLGNLPRLVVTPLTDRCYRTLMGALKLCLGGAPEGPAGTGKTETCKDLAKAVAKKCVVFNCSDGLDYKALGKFFKGLAQSGAWACFDEFNRIELEVLSVVAQQILTIQRAIGRKVVKFFFEDTMLKLDPTCSIFITMNPGYAGRTELPDNLKVLFRTVAMMVPDYAMIGEITLYSNGFDMARNLSQKIVQAYKLCSEQLSSQSHYDYGMRAVKSVLLASASLRRLYVDLPEPEIVLRAIVDVNLPKFLEQDISLFIGIYMDLFPGVELPMPQRGDILKWLHINLADRNLQATPWYLEKILQIYEMLLVRHGLMIVGGSMGGKTTAYQVLAQTLRNVSTDEEATLKEFPVTFRIINPKAITMGQLYGRFDPVSHEWYDGVLAKTFREQVQGPKGERAWVMFDGPVDAVWIENLNTVLDDNKKLCLMSGEIMQMTKLMNMMFEPADLEQASPATVSRCGMIYMEPSQLGWRALHKSFINVLVNKVGLGDIYMTLFEDMTEWLVPAALEFLPQCKQMLELSPIYQYQTFSRFFLHFLE----------KHKQFNQ----AWFQQMFLFCFAWAYCSALTGQGQKTFDALLRKVIYGSN-----------ENFPKPKYFSLNRGQMFPEKLLFLDYRF--DEAEN-WWTWQKSDDSASTTSNFPENAQISELIVPTKETGYISYWQEFCISKSYAMLVVGPTGTGKSAIITSNLL-AMPKFANLVNVINFSARTSAQMVQDTIMSKLDRRRKGVFGPSLGKKCTVFCDDVAMPSKDTYGSQAPLELLRTWLDHGYWSDLVDTTKIELVDMTLMCAMGTLGGS-NFIFPRLYRHMFVVAVDSFEDSTIVRIFTTIGDWH-FSKGYPEKVALLSRGLSEAMVSVYRDAIRSFLPTPAKSHYSFSLRDITRVFQGIVMVPPKRMPDPEKLGRLWAHETYRVFYDRLVDQQDRDRLLVMAVDACKSNLRFPLEQAFGE-RIEPGEKLTDNDLRNLFYGNYMEPDAEPKFYDEGDTYEKLEKLMKYYLREYNSFSSTPMDLVMFRFAIEHVSRVSRVLQMPRGNILMVGMGGSGRRSSARLAAYIADCRLMTVQVSKSYTITDWRDDLKKILMSASFNLNHTVFLFSDAQATDEGYVEDINGILNTGDLPNLYQLEDKATIMENMANVAKQLGKIL--DTLPSEVYAYYIDRIREQLHIALAFSPIGDSFKERIRVYPSLINCCTIDWYMPWPEEALSRVGVYFVSSMNLNRPHGEETQEPVQSKDAADPDEEEVRRETVGVEREQTQLEADLVDCVMYFHQSVVDASEKCYLELNRRNYVTPSAYLELLKAFRTFYTRKLDEITRLRDRYTTGLEKLDFAAGQVGEMQTNLYDLQPKLKVLSEETDRIMVNIERETAEAEKKKEVVGADEAAANEAAAAAQAIKDDCETDLAEAIPAMEAALEALNTLKPADIFIVKSMKNPPYGVKLTMEAVCVIRGIKPDRKPDP--SGHMVEDYWGPSMRMLSDMKFLDSLKTFDKDNIPPPIIKRIREKYIADRDFVPEKIKAASMACEGICRWVRAMDVYDKVARIVMPKKAALAEAEGELSQQMEKLNAKRAELQVILDKLQKLNDFFAEKSREKKRLEDEIDNCEKKLNRAEKLLGGLGGEKTRWSEAAKNLHESISNIVGDVLLAGGCTAYLGYFTTEYRVNILDDWNALCKRKHIPSSETFSLATTLGHPMTIRAWSLAGLPADNFSVENGIIVTNSSRYSLLIDPQVQANKWIKNMEKNNNLKVIKQSDANYMQVLELAITFGQPVLIENVGEKLDSNLTPILEKNVIKHKGGLFIKSGDQMIEYNPNFRLYITTCLRNPRYPPEVMVMVTVLNFMITEQGLREQLLAIVVAHERPDLQEKKEQLIIESARNRDALYTIESKILEVLSTSEGNVLEDENAINILSSSKILSEDIQEKQVIAVATEIEIDAARQQYIPVSKHSAILFFCISELANVDPMYQYSLSWFLNLFVNTILKAPKSDQLSERLKNLNDYFTKSIYTNVCRSLFEKDKLVISLVMCLGILVSQGRVEKAALLFFLTGGIGYKTIPPNPLGAWLPDKSWASVCKAADLEGLKNLPQMMETYSDEWHNFYDASNPDQLQLPAP-----HNTVNDMYFLIVIKSLRPDKLVPAVRAFITRNLDRSFVEPPPFDLAASFADSSPKIPLVFLLSAGSDPMASLFMFAKQRNM-YDKLKTISLGQGQGPRAEKMIMEAARHGQWVVLQNCHVAISWMGDLERICNDTTLTDGANHDYRLWCTSYPSAVFPVSVLQNSVKMTNEPPKGLRANMHRSFTSDPLMRDKFFTNAFLFSDSANKCWLRGVFALVFFHAVVQERREFGPLGWNIPYEFNESDLKISLLQLKMFINQSQSIPFRGHVYLTGECNYGGRVTDDKDRRLILSLLNMIYNPNTIEEDNYALSQSGTYRVPLSPTRLNSIEYVSSFPLSPHPEVYGLHENADINRNVKETNALISGVLLTQTDLMASVKASSSGGAKEDPAI-AICKQVLKQLPEEFNIDEVSKTYPVIYTNSMNTVLRQELIRFNRLLSYIRKSLVNVGKAVVGQIAMIPELERTHASMVIGKLPADWLKKSYPSLKPLGSYVSDLLARLAFFQEWIDNGEPMVYWISGFYFTQSFITGVLQNYSRKNRFQIDMILIEFAVTKFEVQVPGTPDIGAYIRGIFIEGARWNRKTKEVDESFSKVLFDTLPVIYLRPVLKALEDLPRSTAGGEPETIYDCPVYKTSERRGVLSTTGHSTNFVMYLQLRCSRKPMHWINRGTACLCQLDD 4385          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Fly
Match: Dhc62B (gene:FBgn0013811 transcript:FBtr0303106)

HSP 1 Score: 3076.19 bits (7974), Expect = 0.000e+0
Identity = 1614/3630 (44.46%), Postives = 2307/3630 (63.55%), Query Frame = 3
Query: 1374 AGDKTKIYLNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEF-DKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDF----NKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENK-------------------------PIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKE----GPEALDAYLKVNNSQIDEIVALVRG-QLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEEN---KVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPP-PLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKH--LDFDEDGKVTEDDIRSLIYCDFSDAKS--SNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVEL-DQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPS-AWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFF-GTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYI-KTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILL---TQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD 12113
              D  KI +N   L ++I+K    V+N+++       ++++ F DKY +L + +    ++  LSE    H FEE+   +  Y   ++ +  +      + M  +  +  I  L   A+N+  ++   +I  H ++  ++  E+E+I  +AL +P +TE+++E  +++   ++  + EL  ++    +    +++    +    +L I   +    +  I D N    EQ K  F+ +L+   ++   ++D     + +   + DM+  +K+ + S ++       +   +D+    NKEE+ F   +T YP    ++  + P+ +L +  +E+      W +G  E +EP  V+    +Y +   K +K +  K                         P+P ++ T +   +++F   + ++ T+  P LR RHW+++S+I G+ +  + G  L K+++  L+P + +FE IS  A KE  L  A++ M  EW    F    Y+ETG  ILSS+DDIQ +LDDHI+KT  MRGS F+KP E E++ W  K++ V + LD+W KVQA +LYL PIFSS DI+AQMPEEGR F  V++T+   M  V+    V+    +  +L+ L+K+NELLE I  G++ YLEKKRLYFPRFFFL+NDE+LEILSETKDP RV PHL KCFEGI SL F    ++  M SS+ E +   + +ST+ A G VEKWL+ +E +M+ +VR         Y    R EWV +W    VLAIS  YW   V   ++         +  + +  + ++++IV LVR  ++S  NR T+++LIV+DVHA+DV  +LI+ +V++E DF WL Q+RYYW ++    ++IN+ + +  EYLGN+ RLVITPLTDRCYRTL GA  LHL GAPEGPAGTGKTETTKDLAKA+A QC VFNCSDGLDY A+GKFFKGLASCGAW+CFDEFNRI+LEVLSVVAQQIL I +A+ +     MFEGTEL L+P C V ITMNPGYAGRSELPDNLK LFRSVAMMVPDYA+I EISLYS GFV+AR LAVKIV TYRLCSEQLSSQ HYDYGMRAVK+VL+A GN+K +YPDE EDIL+LRS+IDVNLPKFL+ D+PLF GI SD+FPG+  P  DY ++    K  CL+  LE +  F+ K+ Q YEM+IVRHGFM+VGEP  GK+   +VLA  L  +  +   + N    VQ  I+NPK+ITM QLYG FDP+S+EW+DG++A  +R FA + TPDRKW+IFDGPVDA+WIENMNTVLDDNKKLCL SGE+I +S   +++FE MDL  ASPATVSRCGM+YMEP++LGWR    SWLK   P   D     +     +++        +    +     + N + +  +L D QI    +E    +  Q+ + T+ +    FA  W +G   +   R+ FD   ++L +              +  PP PL   +   P +G + DY F+ +++    G W +W +L K  D    +     +IVPT DT +Y +L+ + + H K  L VGPTGTGK+ Y+ ++L+N+++K++++   I F+   SANQ Q++++SKL + ++G++GPP G + ++FVDD+NMP++E YGAQPP+ELLRQ+ D+ + YDLKD++ + + ++  + A G PGG R  +  RFL H N  +IN F D++M  IF ++            D     NQ++ AT  +YKS  + +  TP+KSHY+FNLRD SRV+ G  L    ++ +     R+W HE  RV+YDRLV D DR+W F+ + E    +  +  + +F+   +   ++   T +   ++++  + D  S    + Y EV  +E+        LD+YN   +  M++ LF FA++H++RI RI+    + AL++G+GGSGRQSLT+LA +M     FQ EI+K+Y + +W +D+K IL+++   + H  FL ++NQIK E FL+DI+ LLN GEVPN++P DEKQEV E +      +   R  D S + +++FFV R + +LH++L+ SPIGDA R R+R +PSLVNCCTIDW+ +WPE+AL  +A   L DV +  + +K   +D C+ FHT+    +  +     R+ Y T  S++ELI +F+ L+++K++E    K RY  GL+ L  AA+ IS+MQ++L   QPKLV  ++   K M+ + +++  AS   + VK +E +A+ QA+AA+ +K +C+ DLA+AIP+LE AL AL TL PADIT+V++M +PP  ++LVM AVCV+KGI P+R+ DP+ SGK ++D+WGPSKRLLGEM FL GLK FDKDNIP  I+K I ++++ N DF P+ +A AS+A +GLC+W+ A+  YD+VAKVVAPKK  L  A  EY   M  L +KRA    +++K+ +L  EL+         E   + C  KL+RAE LIGGLGGEK RW +AA DL   + +L GD+L+S G++AYL A    +R+E  K W   V +  IPCS  +S+   LG  V I++W + GLP DEFS EN II +NS R+ L IDPQ QAN W+KNME+KN L  +K   +++++++   +++GTPV++EN+ EEL+  L+P+L++QTF QGG   I LG+S++  + +FR Y+T  LRNPH+LPET  KVT++NF +T   L DQLL IVV++ERP+L+E +  L  ++A NK  L++ E+ IL  LS   G+ILE+E+AI++L  SK LS +I EKQ   +ET  KI+  RL Y P+A+HS+IL++SI DL NIDPMYQ+SL W+INL+  SI+ + KS++L +R++ L   FT +LY NVCRS+FEKDKLL+SFIL + IL     ++   +  L+T      N   NP   W+    W  + RL++L    GI   F     +W+ IYD   P  Q LP  W ++   +F K+ VL+ LRPD +  A++ F+ E IG +Y+ PP FD+  S+ DS   +PL+FILSPGADP+ +LL FA+  G     F+S+SLGQGQGPIA  +I+   + G WV LQNCHLA SWM  LE   E ++   T P+FR+WLT+YP+  FPV ILQNGVKMTNEPP GL+ N+ RSY S+PI+D EF+ G +K   A+ +LL+G+CFFHA+VQERRK+GP+GWNI Y FNE+DL+ISV QL M ++QYD V YDA+ YLT ECNYGGRVTD+WDRR ++TIL  F   Q   D  Y+F     Y  P   ++   + Y+ + LP    P V+G+H N+ IT+D Q T+ L DS++L   ++A GS+G G S + ++ +    +   +P + D E    KYP  Y +SMNTV+VQEM RF  L   IR++ +++   IKG++VM+ DLE V+ +M  ++IP  WM KSYP LKPLGSYV D   RL +L DW  +G PP FW+SGF+FTQAFLTG  QN+ARKY IPID L FDY++L        P+DG Y  GL+L+GARW+ +   + E  PKVL   MPVI+ +P+   ++     Y  P+YKT+ER+GTLSTTGHSTN+V+ + L T     HW+ R VAL+CQ  D
Sbjct:  375 VNDYLKIEMNDNFLKDVIDK----VQNIILRTYQEVIQYVEGFRDKYYALYSWQERDALNQFLSEP---HEFEEYFARIDMYYGFIQMLRSEPATEYFV-MAVIHNEPAIFGLRTLAENLIHEITTIIIREHIKAEVDICDEFEKIKYRALEIPKSTEELLESAEYMIHVKKDKIAELTDRIQYCLQVGTNIVELTEMSKYHFDLTIKTINWIKDINDICDYNASQQEQFKFTFEEHLQEVIKKLNSDIDEL---LPKLTVIDDMSRPDKF-RDSYIILQNFIDQLKTFDDYVAWINKEEKLFKVALTEYPKLDIIKTFVYPFAELMKCCIEWQRYLSVWNDGPFEYLEPQFVERTTDDYLKEFQKNQKYYRVKIKQDLIDNPVCKFKGQTEDPDPAKHPVPLRLCTSMIQSIKDFTTGVFIVNTMCNPALRKRHWKEMSEIAGFDVTPDAGTTLRKILNSGLDPILDQFEIISIGANKELQLWNALQAMIKEWETRVFPYGPYKETGVQILSSLDDIQALLDDHILKTLVMRGSAFMKPCEEEVRAWYEKIMRVNETLDQWGKVQANYLYLLPIFSSKDIVAQMPEEGRLFVIVEQTYTRNMGLVLRQPLVMETAPVSGLLESLQKANELLEDIATGVSNYLEKKRLYFPRFFFLANDEMLEILSETKDPLRVLPHLSKCFEGINSLEFDAAKNVLAMISSDKETIEFIEQVSTAAAGGSVEKWLIGVEDEMLKAVRYQNELSFAHYPKVKRHEWVLEWPQMTVLAISQVYWASRVHGCLRRTFGGNMTIMMNFFQELSKELNDIVTLVRSPKISNLNRITIKSLIVIDVHAKDVSEDLIKNKVSSEFDFQWLAQMRYYWEDDKTWVRIINATVPFANEYLGNSDRLVITPLTDRCYRTLVGAYQLHLNGAPEGPAGTGKTETTKDLAKALAVQCKVFNCSDGLDYKAMGKFFKGLASCGAWACFDEFNRIELEVLSVVAQQILLIIQAVRSNATKFMFEGTELTLNPACYVCITMNPGYAGRSELPDNLKVLFRSVAMMVPDYAMIGEISLYSYGFVDARKLAVKIVTTYRLCSEQLSSQNHYDYGMRAVKTVLSACGNIKKQYPDEVEDILLLRSLIDVNLPKFLSFDVPLFEGIISDIFPGIKLPHIDYSLVESEFKRVCLEEVLEPAPSFLLKVIQTYEMIIVRHGFMLVGEPLAGKSKTLQVLAKVLSALKIKAPQKSNYFQHVQMGIMNPKSITMNQLYGSFDPISYEWTDGLVAKIFRDFAMTPTPDRKWVIFDGPVDAVWIENMNTVLDDNKKLCLTSGEVITMSNEMSMVFEVMDLAQASPATVSRCGMIYMEPSTLGWRAFAKSWLKKADPRWADEEGVPYVMALMQWLLPPCQTFVRRFCSQFIKPGEFNCMLTTFDLFDMQIAEAIEEN--PEDYQKYLQTYFQAAILFALIWGVGGVLDTASREKFDVFLKKLWD-------------TDPPPPEPLGKMEITPPTEGLLVDYVFLYKQR----GAWRYWPDLAKRMDV---EETKTGVIVPTVDTARYIHLLKMHVEHKKRMLLVGPTGTGKTVYVQNYLMNKLDKEVFETGFITFTVMISANQCQDLLISKLQKWKRGIYGPPKGMQSVLFVDDMNMPVKEVYGAQPPLELLRQFFDYGHVYDLKDSSKVYIHNVLIMAACGLPGGSRQDVYARFLNHFNVYSINTFSDDSMFRIFLNVALNGFRRAGHGQDVFVVTNQIVSATQSIYKSVQSEIRATPSKSHYIFNLRDISRVVTGCTLVRKESVSDKKIFVRVWYHEAMRVFYDRLVDDVDRKWMFDKLNECLKANFKDKVETVFERYCVQGPDEAVFTMEAASNILFGVYFDEDSVPDERRYEEVPSVEVFLNLALTSLDDYNSTRRNKMDITLFTFALQHLNRICRIISIQGASALIIGLGGSGRQSLTKLATNMVQTSFFQPEITKNYGANDWHDDIKAILKEAGGMNKHTTFLITENQIKMELFLQDIDCLLNQGEVPNIFPIDEKQEVLEMV--RLAAQGGNRNIDVSALQVFSFFVDRCKQKLHMILSFSPIGDALRTRVRLYPSLVNCCTIDWYDSWPEEALQMIAKMSLVDVNVPSEDIKLAIMDTCQYFHTTAARSTRAFCQMTGRHIYQTNASFIELIRSFQTLIERKQSETMLAKMRYIGGLDTLAQAAAAISIMQRDLNALQPKLVALAESSRKMMLEINKETLAASAAAEQVKRDEEVASVQAEAAQVLKQDCERDLAKAIPVLEDALAALNTLKPADITLVKSMKNPPPVIKLVMAAVCVIKGIPPERIPDPA-SGKMVQDYWGPSKRLLGEMNFLPGLKEFDKDNIPTEIVKRIHKEFIPNKDFDPKVVAKASSAAKGLCQWIIAMMMYDEVAKVVAPKKAKLAGAEKEYADTMEFLAQKRALALALEEKVALLNIELDKANAEMQKTEEHAESCRNKLLRAEALIGGLGGEKSRWNKAAEDLQELYDHLPGDVLISCGIIAYLSAVNLQYRSECVKDWFKKVTDLKIPCSSHYSITDVLGLEVTIQNWQLDGLPNDEFSSENAIISANSSRYSLFIDPQAQANNWLKNMERKNRLNCVKFNQSNYMKVIAEALEYGTPVIIENVQEELEVPLDPILMRQTFVQGGIKHISLGESVVPVNPNFRLYMTCNLRNPHFLPETFNKVTVINFALTQNALMDQLLSIVVAKERPDLQELRITLTTEAAANKGALRDAENMILKTLSAG-GDILENEAAIQILADSKGLSKDIVEKQEAAKETVAKIEAFRLNYKPVAVHSSILYYSITDLPNIDPMYQFSLNWYINLYMYSIETANKSKDLPRRIKFLVDGFTRNLYNNVCRSIFEKDKLLYSFILTARILLGTGQVEMRHFAHLVTNAKESTNIPPNPDPTWITETVWLNVLRLEELKELRGIVDHFKSHLHAWQAIYDHSSPEKQPLPPPWQDK-TTAFEKIIVLKALRPDSVFLAVRLFIAESIGDQYVTPPEFDISKSYADSTALTPLVFILSPGADPLGSLLAFAEKMG-QEETFQSISLGQGQGPIATALIKNAQEMGYWVCLQNCHLAASWMPYLEYLWENMDTFNTTPNFRIWLTAYPTPQFPVTILQNGVKMTNEPPTGLKENLMRSYNSEPINDYEFYTGCAKQDRAFTRLLYGICFFHAVVQERRKYGPLGWNIAYGFNESDLQISVLQLSMLLNQYDHVPYDAISYLTSECNYGGRVTDNWDRRLIVTILADFCNAQAVTDNRYRFASDDRYILPRKTEHREILRYLDENLPSLAPPEVYGLHANSGITRDLQTTKTLLDSMILLLGSEAAGSAGAGVSVEQVILDTIKQIEREMPADMDIEAAAEKYPVDYNESMNTVVVQEMERFLKLQKEIRTTCRDLAMGIKGIIVMTPDLENVMTAMKFNRIPTKWMSKSYPCLKPLGSYVQDLYKRLNWLHDWHHHGKPPTFWLSGFFFTQAFLTGAMQNFARKYKIPIDTLTFDYDVLKVETKTSPPDDGVYCNGLYLEGARWEWRENTLVEQFPKVLIYAMPVIFFRPVGLVDVVEGSRYRCPLYKTAERKGTLSTTGHSTNYVVPLLLNTHVKASHWVKRSVALICQTSD 3964          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Fly
Match: Dhc16F (gene:FBgn0283476 transcript:FBtr0074509)

HSP 1 Score: 2177.52 bits (5641), Expect = 0.000e+0
Identity = 1274/3268 (38.98%), Postives = 1889/3268 (57.80%), Query Frame = 3
Query: 2541 MPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFES---ISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRET-GTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVF----------TETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPE--ALDAYLKVNNSQID------EIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENN--MITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEEN--KVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKV-----LPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEA-KISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKE--YIEVTDLELLRKTVEGYLDEYNQMS-KKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAV-FLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVA--LYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSAW-LPPKSWDELCRLDD--LSVFHGIRQR----FIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPP-PFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETT--HPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQ--YDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPP-DLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTK----------YEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEIL------------------DDRNYDEAPE--DGAY-VKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALL 12098
            +P+I  L  P LR RHW +I D++      E+ + +    D++    +   E+   IS  A  E  LE  ++ ++  W   E  ++ + +    FIL+  +++Q +LDD  V   T+  S F+ P ++++ +W + +       + W+  Q  W+YLE IF+S DI  Q+P E + F +VDK++KE ++Q       L  +    +   L ++N LL+ I +GL  YLE KR+ FPRF+FLSNDELLEIL++T+ P  VQPHL+KCF+ I  L F            T DI    S E E +     +   KARG VE+WL ++E  M  S +  +  G   Y A  R++W +    Q VL +S   W   +   I EG E   L+   K+   +I        + AL R  +S   R  L ALI +DVHA+D +  LI+++V   +DF WL  LR+YW +    + ++M  + + Y YEYLG    LV+TPLTDRCY  L GA  + LGGAP GPAGTGKTETTKDLAKA+AKQCVVFNCSDGLDY  +G+FF GLA CGAW CFDEFNRID+EVLSV+AQQ++TI+ A   +    +FEG E+K++ +C VFITMNPGYAGR+ELPDNLKALFR ++MMVPDYALI+E+ LYS GF + + LA K+V  Y+LCS+QLS Q HYD+GMRAVKSVL  AG LK   P++ EDI ++ ++ D N+PKFL  D  LF GI SDLFPGV  P   +  L   ++    + NL++    + K  Q+YE M VR G M+VG   GGK+     L  AL  + E  + + N   V    +NPKA+TM +LYG  D  + EW DG+L ++ R   T      +W++ DGPVDA+WIEN+NTVLDDNK LCL + E I+L+   +++FE  DL  ASPATVSRCGMVY++P  LGW P+ ++W +V     LP  + +   +++   F++ +            ++ +  +   V+ S + L  C++++   EA K S M +      +  +F +A  W+I +   +  + +F+                      E     +  +  +     T+++YR   EK +     W  W +++  K     +  + ++ VPT DT KY Y+ +LL     P +  G TG GK+   I   + ++++    P ++NFSAQTS+N+TQ +I   L++R+K   G PVGK +IVF+DD+NMP  +TYGA P IELLRQ+LD   +YD +     +++D+    A  PPGGGRNP+TPRF+RH    ++ + ++ET+  IF+ IL   +  Q FS   +     ++ A +DVY    T +LPTP KSHY+FNLRD S+ IQG+L +      +   + RL+ HE  RV++DRL+  +D+  F   ++EV   H N                 V  D+   +++ DF        E  Y E+ D   L   +  Y+ +YN ++  K M L+LF+ A+EH  R++R+L+  R + LLVGV G G+QSLTRLA+ + +Y+ +Q+E+ ++Y    + EDL R+L +    DN  V FL  D+QI +E FLEDINN+LN+GEVPNL+  DE     EK+    R      + D       +Y FF+ RVR+ LH+V++MSP+GDAFR R R FPSLVNC TIDWF +WP +AL +VA   L  +      +          H +    S K+  E+ R+ Y TP+SYLEL+  ++NLL  K  E+  +++R   GL KL      I+VM KEL    P+L E S  +   +  + +++ +A   ++ V  +E  A ++A  A+AI  +   DL  A+P L  A +AL+ LT ADI  +++  +PP  V+  MEAVC+L G+KP                W  +K ++ ++ F++ L  +DK+++    +K ++ KY+ + DF P +    S   + +  WV +++K+ KV KVV PK    E A  E    M+ L +K+  L  V+ K++ L + LE  +R    +++ VDL   ++ RA +L   L  E+ RW +    L      + GD+L+++  VAYLGAF+  +R + +  W+    E  IP S +F+L+  LGDP E+R WN+ GLP D  SIENGI  + + RW LMIDPQ QAN+WI+NME+ NNLQVIK+TD+  +R+LEN ++ G PVLLE I E +DP L P+L ++T++  G   +KLGD +I+Y  +F+ Y+TTKL NPHYLPE  + VTL+NF++T  GL+DQLL  +V+ E P +E ++N L+ +  ++K++L  LED++L +L  SEGNIL+DE  ++ LN +KE S  IA +    EETE+ I  +R  Y  +A    IL+F +A LA IDPMYQYSL +F  +F   +      ++++ R+  L +    +++ N+ R LFE  K++FSF+L  ++ + +  + E+E+ FL  G VG       P+   +    WD    L+D   S F G+       F  Q    K+++D  +  NQ   D+W +RL+  F+K+  +   R  + +  +  +++  +GK + E      L   + D++  +PL+F+LS G+DPM+  LKF     F   K+ S+SLGQGQGP+A  +I++ ++ G WV LQNCHLA S+M  LE  V  L    T  H DFRL+L+S P  TFP+++LQN VK+TNEPPKG++ N++ + L+D   D  FF        W+ ++FGLC FHA++ ERRKFGP+GWNI YEF+E+D    ++ L  FID+   D + ++A+ Y+ G+  +GGRVTD WD R L TIL  F   ++ + PDYK+     YY  P       Y  Y++  P+  +P +FGM+QNA+I    +ET    +++LL Q R ++  G++ +   +E++   + R+     T+I  ++ P               S+  VLVQE+ RFN  L  I  SL N+ KAIKGLVVMS +LE V  ++L +++P  W K+S+ S+KPL SY++DF  R+ F+  W +NG P  +WISGF+F Q+FLTGV Q YAR+  +PID L  D+++                   D + Y   PE  D    V G+F++ ARWD     + +++   L   MPV+  KP    EI     Y +P+YKT +R G LSTTGHSTNF++A+ L +    E WIMRG AL+
Sbjct:  901 LPVIGYLRNPNLRARHWAEIEDLLNRKFFQEKDILIQTYEDVHAFDDVAIGEALMQISSQATGEVQLENMLKGIETTWKETELSIVPHHDAKDVFILAGTEELQAVLDDSNVNINTIAASKFVGPIKSKVDEWINAMDQFAKTFESWMDCQGAWIYLEAIFASADIQRQLPHEAKMFFTVDKSFKETVRQAKKVALALPTMSSVDVHKVLVENNRLLDLISRGLEAYLEVKRVVFPRFYFLSNDELLEILAQTRIPQAVQPHLRKCFDAIYRLEFGSKEGGDGKMVATNDIVAFLSPEGEKLQFGKGL---KARGAVEEWLSKVEEAMFVSCKRYMRFGYQCYPAKEREDWFQDHPNQVVLTVSQVQWAADIH-RIYEGKERNPLNILEKMAKFEIKCLKDLGALAALTRKNISSLLRKILCALITIDVHAKDSVRMLIEKEVCKASDFNWLKMLRFYWADETETVYSRMAAANIPYYYEYLGAGGVLVLTPLTDRCYLCLMGAFQMDLGGAPAGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKMMGRFFSGLAQCGAWCCFDEFNRIDIEVLSVIAQQLITIRTAKAMRVKRFIFEGREIKINRSCCVFITMNPGYAGRTELPDNLKALFRPISMMVPDYALISEVILYSEGFEDPKILARKMVQMYQLCSQQLSQQNHYDFGMRAVKSVLVMAGALKRASPNQREDITLIAALRDSNIPKFLADDAVLFRGILSDLFPGVELPDSQHPHLEASLRLGLRQKNLQAVPTTIRKCLQLYETMCVRWGVMLVGPTGGGKSVVLHALEFALSHLFENEVQDPNFRPVVIQTMNPKAVTMNELYGYVDLKTLEWQDGLLGLAVRTATTVEDEIHQWIMCDGPVDAVWIENLNTVLDDNKMLCLANSERIKLTAWIHMLFEVQDLLQASPATVSRCGMVYVDPGDLGWIPLIDTWREVDMKHKLPAPLAEFCYQLFVGYFDKAL---------KIERKRAVYTIHQVLGSKVRLC-CELNSAQFEAVKWSAMSEEQGKELVTKIFAWAVLWAIASNLKDAEKVSFE----------------------EQWSKAIAQHPNMTLPNFTLWNYRIDLEKMD-----WGSWIDIM-AKFVFDPETSYYDMQVPTVDTTKYGYVSDLLFKRGMPVMVTGDTGVGKTVLAIS-CMKRLSQGNVIPVILNFSAQTSSNRTQEMIEGPLEKRKKTQLGAPVGKTVIVFIDDVNMPKLDTYGASPAIELLRQFLDFKGFYDREKLYWKEILDVVLGCACAPPGGGRNPLTPRFVRHFALFSLPKPNEETLTQIFNGILRGFL--QTFSSAVRALSEPMVNACVDVYMRVATVMLPTPDKSHYIFNLRDLSKCIQGILQASNLHYNQENQILRLFYHETTRVFHDRLINIEDKNIFKALMKEVCMDHFNR---------------PVINDNEPPILFGDFMVFGKPKNERIYDEIRDHTKLESVLNDYIADYNSVAVGKQMKLILFQDAMEHTVRLARLLRSDRGNGLLVGVAGMGKQSLTRLASHVNEYNCWQIEMRRNYDLNAFHEDL-RVLYRIAGIDNQPVTFLLIDSQIVEEEFLEDINNILNSGEVPNLFEGDE----FEKIILDARDGCNENRKDDPCTRDDIYKFFINRVRNNLHVVMSMSPVGDAFRRRCRMFPSLVNCTTIDWFTSWPTEALYSVALGLLTKIAPKMEDRISLASTTVFMHKTVEDASVKFYKEMKRHYYTTPSSYLELLKLYQNLLKIKNMEIIAKRKRIANGLNKLLETNEVIAVMGKELEVMVPQLDEKSAMMKSLVDNLTKETKQADAVKQSVLEDEMNAKEKAAVAQAISEDAGKDLEIAMPALREAEEALKGLTKADINELKSFTTPPALVQFCMEAVCILLGVKPT---------------WASAKAIMADINFIKRLFEYDKEHMKEDTLKKVK-KYIDHKDFVPAKFEKVSKVAKSMSMWVISMDKFSKVYKVVEPKIKRKEAAEAELKEVMTVLRQKQKELAAVEAKIQGLRDSLEEKQREFQVIQDNVDLTYGRINRAGRLTSALSDEQVRWRETVKSLTGDLACVPGDVLVAAACVAYLGAFSHEYRRDMSALWVSKCREHKIPSSPEFNLLKVLGDPYEMRQWNVDGLPKDNISIENGIYATRALRWALMIDPQEQANRWIRNMERANNLQVIKMTDSTMMRVLENAVRQGYPVLLEEINETIDPSLRPILQRETYRFEGRTYLKLGDMVIDYDDNFKLYMTTKLPNPHYLPEVCINVTLVNFLVTESGLEDQLLADIVAIELPAMEIQRNDLVVKINSDKQQLLALEDKVLKLLFNSEGNILDDEELVETLNDAKETSLIIAARLIDTEETEKVITASRERYRILASRGAILYFVVAGLAEIDPMYQYSLKYFTQVFCNVLRLDHPPQSVEVRISTLMTDELRAIFDNISRGLFENHKIIFSFLLALSVERQEGRVTEEEFLFLSRGPVGNIRTKIQPAKIKMSQIEWDSCIFLEDNFSSFFSGLTDELDKPFFIQMQENKEVFDFAQT-NQPPTDKWNKRLR-VFHKLMFISAFRKPRFLLNVVCYLQSTVGKYFTEASGGTQLSSVYLDTSAVTPLIFVLSTGSDPMSGFLKFTTQMQF-TDKYYSISLGQGQGPLAENLIEKSLRLGHWVFLQNCHLATSFMQTLETIVRNLTLGITKAHVDFRLYLSSMPIQTFPISVLQNSVKITNEPPKGIKANVFGA-LTDLKQD--FFEQHIQNGNWRAIVFGLCMFHAVLLERRKFGPLGWNITYEFSESDRECGLKTLDFFIDREVLDEIPWEAILYINGDITWGGRVTDYWDLRCLRTILTIFSSKRIIQ-PDYKYCRGDSYYRDPRKKTLTEYSAYVQGFPVLEDPEIFGMNQNANIVFQTKETAFFINTLLLGQPRSAADEGQAME---NEIAQQTIARIQKALATKI--KREPIHDTLSVLDAKGQVPSLTIVLVQEIDRFNIALGIIHDSLVNLSKAIKGLVVMSEELENVFKALLSNQVPASWAKRSFLSIKPLPSYISDFQRRIDFIQQWAENGAPRSYWISGFFFPQSFLTGVLQTYARRRVLPIDSLKIDFDVFERELVQQDFFEMHTNNMSDQKLYGNLPECTDAIINVHGIFIEAARWDLSKGGLCDANFGELFSRMPVVRFKPC--LEISPTVRYEAPLYKTQQRSGVLSTTGHSTNFILAVLLRSHNDPEFWIMRGTALV 4073          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Fly
Match: kl-2 (gene:FBgn0001313 transcript:FBtr0346722)

HSP 1 Score: 2087.38 bits (5407), Expect = 0.000e+0
Identity = 1224/3358 (36.45%), Postives = 1902/3358 (56.64%), Query Frame = 3
Query: 2232 RIEDFNKEEEAFGWDVTTYPVRQ-------EVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTL-RNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEK---MLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFT---ETLD---ITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVR--LNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTI-----YVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENN--MITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACI---XXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKIS-QMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQM-SKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVEL--------DQSLKDGCI---------DLCKMF---HTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSA---WLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQAR-GSSGGGKSTDDIVDEVSADVLNRLPPNFDTE-----IVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPI-FWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEA----PEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPT-DKPEEHWIMRGVALLCQL 12107
            +IED    EE+   D+  + V Q       ++   +R    ++E   E+   ++ W +G   K+  ++++    N Y+    L K+F ++    ++       V+ F+  +PLI  L  P +R+RHW ++ D++      N +   L  +I+++ + F    + IS  A  E  +E +++ +   W    F  +A+   G + + +V+D   +L++H+V+   M+ + F++PF   +  WE  L  + + L++ L VQ  WLYLE IF   DI  Q+PEE ++F ++ + ++ I  ++   K  +    +     +L++  + +E LE I + L  YLE KR  FPRF+F+SND+LLEIL  +K P  VQ HLKK F+ +  L      +TL     + M S + E V    VI      G  E+WL ++E  M+  ++  L ++ G +      R++W+  W GQ VL  +   WT       +  ++ +  + L    K     + ++  + R  L+K  R  +  LI L++H RDV+  + +    +   F W  QLR+YW   +   + +  N+   YGYEY GN+ RLVITPLTDRCY TL  ALHLH GG+P+GPAGTGKTET KDL KA+    +V NCS+GLDY ++GK F GLA  G W CFDEFNRI++EVLSVVAQQI++I  A+  +   LMFEG  +KL  T  +FITMNPGYAGR+ELPDNLK++FR ++MMVPD  +IAE  L+S GF N R LA K+   Y L  +QLS Q HYD+G+R++ ++L  AG  + + P+  E+ ++  ++ D+N+ +   +DLPLFNGI SD+FPGV+ P  DY   N  I E   +  L+  +  ++K+ +++E    RH  MI+G+    K+  ++ L      +  Q       V    +NPKA+ + +LYG+++  + EW DGVL+   R       P +KWL+FDGPVDA+WIENMN+V+DDNK L L++ E I +    +L+FE  DL VASPATVSRCGMVY +    GW+P  NSWL+ L         K +AD      D  +  I   K+   KE   T+++N V SL  L++      N    I+ ++ +     W    F F   WSI ++ +E+ R+  D   REL                          +  +P K T++DY    +  E  F  W+  S+L+        ++ F +IIVPT DTV+Y Y+++ LL  + P + VG  GTGK+   I  ++   +K+ +    +N SAQT+A   Q  I ++ ++R K  F P  GK++I F+DD NMP ++ YG+QPP+EL+RQW+D+  W++ K    I + +   + AMGPPGGGR  I+ R       + +     ET+I IF ++L   +  +++  + +     +   T+++Y S ++ +LPTP KSHYLFNLRD S+V QG+L S      +     RLW HE FRV+ DRLV D D+ WF N I ++  KH    F++ F  L      KV         + DF+  +     + E   ++ LR  ++  L+EYN       MNLV FR AIEH+ RI R++ QPR H L +G+GGSGRQ LT+LAA + +  +FQ+E++K Y + ++REDLK + + +       +F+FS +QI + SFLE  NN+L+ GE+ NL+ +DE  E+  ++ +  ++   +  T+    ALY++F+  VRD LH+ L  SPIG+ FR+ +R++P+L++  T +WF+ WP++AL  VA+ FL    L        D+  ++  +         D+  +F   H+S   +SE    E+ RYNYVT  +YL+L+S FK LL+KKR EV     R   GL K+      +S+M +EL+    ++   ++E +  + ++E Q +EA++Q++ V  E  +          +      DL   +P++++A+KAL+ L   DI+ V++   PP  +  VMEAV +L G +P                W  +K++L E  FL  LK FD+D+I    +K I   Y  N + +P+++AV S AC+ L +W+ A+E Y KV ++VAPK+  L+ AM       ++L   +  L+E+Q  ++ L  +LE       +L  K +   K+L RA  L+  L GE++RWI+  + L + F  L GD LLS   ++YLGAF + +R E   +W   + +  IP + +  +   L D V IR WNI GLP D+ S ENG+I++   RWPL+IDPQ QAN WIKNME++N L  +    AD++R LE  ++ G PVLL+N+GE LD  + P+L +    Q G   +K  D  I Y+  FRFYITTK+ NPHY PE S K T++NF +  +GL+ QLLGI+V +E+P LEE+K++L+   A NK+ L +L++EIL +L+ S G++L+D+     L  S++ S  + E  +  E TE +ID AR  Y P +  ++ILFF + D++ IDPMY +SL  +I LF  SI+ S +++ + +R+QN+  Y +Y++Y N CR LFE+ KLLFS  + + IL +   + E+E+ F+L GG+ LD   + P+    W+  ++WD +  LD +S FHGI   F +   +W   Y +  P  + L  EW ++L D F K+CVLR LRPD+I   +  F+  ++G +Y++PP  DL  +F++S   +PL+F+LSPG DP  +L+  ++       +  SLSLGQGQ PIA K+I  GIK+G WV L NCHL+ SWM  L+K +  +     H  FRLWL+S P   FP++ILQ  +KMT EPP+G++ N+ R Y +   ++ME      + S +KKLLF LCFFH ++ ER+KF  +GWN+ Y FN++D  +S   L +++++Y+   + AL+YL    NYGG +TDDWDRR LIT + +F+C Q  +   ++      Y+ P D D + Y++ I+  P   +P  FG H NADI     ET++LF+++L  Q +  S+   ++ +  V +++ ++L   P   + E     I + + P      +  VL+QE+ R+N LL  + + L+++R+ I+GLVVMSSDLE++ +++ + ++P  W+ K+Y SLKPL ++  D + R+   + W     PPI FW++ + F   F+T V Q  AR    PID L +D+ +  + +   A       G Y++ LFL+G  W RK + + +  P  L  P+PVI  KP++  +   +  Y  P Y    R G+         FVIA+ L + ++  ++WI RG ALL  L
Sbjct: 1210 KIEDCFTFEESLMRDLAVFNVNQPESIDLRKLDFEVRIVKNIWELIFEWQTNWEGWKKGYFWKMNINEMEDTALNLYKEFTTLNKKFYDRHW--EMLEATTKNVDSFRRTLPLITALKNPCMRERHWNRVRDVIHVNFDENSKNFTLELIINLDFQAFSEDIQDISNPATMELQIENSIKNIATIWKKQSFE-MAFYHDGIYRIKNVEDCFQLLEEHMVQISAMKATRFVEPFITIVDYWEKTLSYISETLEKGLTVQRQWLYLENIFQGDDIRKQLPEEAKRFATITEEFRTISSKMFQAKTAVKATNLRPPPFLLNRFSRMDERLELIQRALEIYLEAKRQLFPRFYFISNDDLLEILGNSKRPDLVQTHLKKLFDNLYKLELKRVGKTLSRWQASGMHSDDGEYVEFMMVIYID---GPSERWLKQVEEYMLVVMKEMLKLTRGSLKKLVGNREKWISLWPGQMVLTTAQIQWTTECTRSLIHCSMVDQKKPLRKLKKKQIKVLSKLSEMSRKDLTKTMRLKVNTLITLEIHGRDVIERMYKSNCKDTGHFEWFSQLRFYWHRESELCVIRQTNTEHWYGYEYTGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIWVIVTNCSEGLDYKSIGKNFSGLAQSGCWGCFDEFNRINIEVLSVVAQQIMSIMAALSTKALELMFEGQMIKLKHTVGLFITMNPGYAGRTELPDNLKSMFRPISMMVPDNIIIAENLLFSDGFTNTRNLARKVYTLYELAKQQLSKQYHYDFGLRSMVALLRYAGRKRRQLPNTTEEEIVYLAMKDMNVARLTANDLPLFNGIMSDIFPGVSLPTIDYSEFNIAIYEEFREAGLQPITIAVKKVIELFETKNSRHSVMIIGDTGTAKSVTWRTLQNCFYRMNSQRFSGWEAVTVYPVNPKALNLAELYGEYNLSTGEWLDGVLSSIMRIICGDEEPTQKWLLFDGPVDAVWIENMNSVMDDNKLLTLVNSERITMPVQVSLLFEVGDLAVASPATVSRCGMVYNDYNDWGWKPFVNSWLQRL-------RIKEFADFLRIHFDYMVPKILDFKRMRCKEPVRTNELNGVVSLCKLLEIFGTKVNGINPINLELLEEMTRLW----FMFCLVWSICSSVDEDSRQRLDSFIREL--------------------------ESCFPIKDTVFDY--FVDPNERTFLPWD--SKLLSSWKC-DFESPFYKIIVPTGDTVRYEYVVSKLLAEEYPVMLVGNVGTGKTSTAIS-VMEACDKNKFCILAVNMSAQTTAAGLQESIENRTEKRTKTQFVPIGGKRMICFMDDFNMPAKDIYGSQPPLELIRQWIDYKYWFNRKTQQKIYVQNTLLMAAMGPPGGGRQTISSRTQSRFVLLNLTFPSQETIIRIFGTMLCQKL--ESYPNEVREMWLPITLCTINLYVSMISKMLPTPNKSHYLFNLRDISKVFQGLLRSEKELQNKKNFFLRLWVHECFRVFSDRLVDDSDQFWFVNTINDILGKH----FEVTFHSLC---PSKVPP------FFGDFAHPQG----FYEDLQVDFLRTFMKNQLEEYNNFPGMTRMNLVFFREAIEHIVRILRVISQPRGHILNMGIGGSGRQVLTKLAAFILEMAVFQIEVTKKYKTGDFREDLKNLYKVTGIKQRLTIFIFSSDQIAEVSFLEITNNMLSTGEI-NLFKSDEFDELKPELERPAKKNGVLLTTE----ALYSYFILNVRDFLHVALCFSPIGENFRSYIRQYPALLSSTTPNWFRFWPQEALLEVASHFLIGFPLNVVVSGKEDEKHRESLVISTEAILQRDIAYVFSVIHSSVAKMSENMYAEVKRYNYVTSPNYLQLVSGFKKLLEKKRLEVSTASNRLRNGLSKISETQEKVSLMSEELKASSEQVKILARECEDFISMIEIQKSEATEQKEKVDAEAVLIRRDEIICLELAATARADLEVVMPMIDAAVKALDALNKKDISEVKSYGRPPMKIEKVMEAVLILLGKEPT---------------WENAKKVLSESTFLNDLKNFDRDHISDKTLKRI-AIYTKNPELEPDKVAVVSLACKSLMQWIMAIENYGKVYRIVAPKQEKLDSAMKSLEEKQAALAAAKKKLEELQVVIEELYRQLEEKTNLLNELRAKEERLRKQLERAIILVESLSGERERWIETVNQLDLSFEKLPGDCLLSVAFMSYLGAFDTKYREELLVKWSLLIKDLLIPATLELKVTYFLVDAVSIREWNIQGLPADDLSTENGVIVTQGSRWPLIIDPQMQANNWIKNMEERNQLMTLDFGMADYLRQLERALKEGLPVLLQNVGEYLDQAINPILRQSFTIQSGERLLKFNDKYISYNNSFRFYITTKISNPHYPPEISSKTTIVNFALKQDGLEAQLLGIIVRKEKPALEEQKDELVMTIARNKRTLIDLDNEILRLLNESRGSLLDDDELFSTLQKSRQTSVLVKESLSIAEVTEVEIDAARQEYKPASERASILFFVLMDMSKIDPMYVFSLAAYILLFTQSIERSPRNQLVHERIQNINEYHSYAVYRNTCRGLFERHKLLFSIHMTAKILSNAGKLLEEEYDFILKGGIVLDKLGQAPNPAPWWISEQNWDNITELDKVSGFHGIIDSFEQHYKAWNGWYATTFPEQEDLVGEWNDKLTD-FQKICVLRSLRPDRISFCLTQFIITKLGPRYVDPPVLDLKATFDESISQTPLIFVLSPGVDPAQSLISLSESVKM-AQRMYSLSLGQGQAPIATKLIMDGIKDGNWVFLANCHLSLSWMPTLDKMIATMQSMKLHKKFRLWLSSSPHPDFPISILQTSIKMTTEPPRGIKSNMKRLYNNINEANME---NCSEPSKYKKLLFALCFFHTVLLERKKFLELGWNVIYSFNDSDFEVSEILLLLYLNEYEDTPWGALKYLIAGVNYGGHITDDWDRRLLITYINQFFCDQALQTRKFRLSTLPNYFIPDDGDVQSYLDQIQMFPNFDKPDAFGQHSNADIASLIGETRMLFEALLSMQVQTNSTSSNENGETKVFDLAKEILMNTPDEINYEQTAKIIGINRTP------LEVVLLQEIERYNKLLVDMSTQLRDLRRGIQGLVVMSSDLEDIYLAVSEGRVPLQWL-KAYNSLKPLAAWARDLIHRVGHFNSWAKTLRPPILFWLAAYTFPTGFVTAVLQTSARATKTPIDELSWDFYVFVEEDTAAARIIREGGGVYIRSLFLEGGGWLRKNQCLQDPLPMELICPLPVIHFKPVENLKKRCRGVYQCPAYYYPVRSGS---------FVIAVDLKSGNEKADYWIKRGTALLLSL 4457          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Zebrafish
Match: dnah7 (dynein, axonemal, heavy chain 7 [Source:ZFIN;Acc:ZDB-GENE-070912-282])

HSP 1 Score: 5269.13 bits (13667), Expect = 0.000e+0
Identity = 2595/4041 (64.22%), Postives = 3175/4041 (78.57%), Query Frame = 3
Query:   54 SQKRGRKGPDLTK-LLPTIPMKRVKPEWAQNPPSFTLDGKQKIN---------EDAGIE---LIYELTAKPPTKPRKLKGEDLAFERS-QLRKDREKFRKALVDMILQGEDRPIKESIETVRLPPLTQEKTPVGMSATEKDILRYYYYIHNGIDTEHVAKMEXXXXXXXXXXXXXXXXAEHPXXXXXXXXXXXXXXXX----SVKKAIVDFVLKEPRE-KETDDTPIPEHRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLL-RNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLR-NEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHI-ITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLD 12110
            S++   K PD +  LLP I   R KP W +  PSF L G  + +         ++AG++      +   +  TK  ++ G         Q ++DRE+FR ALV +I+  ED P K S+  +  P  +   T     A EKDILRY YYI NGI TE VA MED W+ N+  L+      EH + L    + + ++       S+KK IVDFVL++PRE KE     +P HR+E+ ++PKPW +SF+ A K  + +L+  N  M +VL LW +SFK LRL+DVE F  ++ ++EL  FQ    +HIE A   L+  W+ +VQ IY++GNK+ L+PS    A L+ F+NC +TLMTS LQ+L L+SM DYT+L+ +NP  +                         + EHPGFVLRL+L+   IKFEP  +DFE  +LNVY+ M+K +S + R+E++LYS+W G +T   L PIILPEI+E  +  VR V+  ES  P +H+  +DKY  L++++ ++++   L E   +HSF+E    +  Y  L  +I+  + + +RLGMFEL   +L+RAL KRA+ + +KL++ +++ H++ N +L +EY+ I  KAL  P+NTE++MEL  +V+  E   +L+LE KL +SN RL FL+DY  F+ +D+ LN   F  H RM SIFD++++ +++K  +FQ  LK + ER +E++ SY +QVEEF N GD++E+NKYLKK+Q L++KLE  + +I   N+EEEAF W V+ YP R+ VQ+ L PYL+LYETA EF  ++  W+ G +  V PD+V+ DVGNY R L+KLEK F++ P P +IAT VK +VE FKEH+P++Q L  PGLR+RHW+ +S +VG+ L+ +EE  C++  + ++LE  +  FESISE A KE  LEKAME+M +EW+ MEF ++ YRETGT ILSS+D++Q++LDDHIVKTQTMRGSPFIKPFEAEI+DWE KL+L+Q+I+DEWLKVQ TWLYLEPIFSSPDIMAQMPEEGR+FT+VDKTW++ MKQV  DK VL V+ IEKMLDK+K SNELLE ILKGLN+YLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIAS+VFT+ LDITHM+SSE E+V L D+ISTSKARGQVEKWLLELE  M+ S+   I +    Y    R  WV+ W GQ VL +S  YWT  + +AI +GP+AL AYL+ NN+QID+IV LVRG+LSKQNR TL AL+VLDVHARDVL +L+Q+ V +E +F WL QLRYYW+EN + TKMIN+ L YGYEYLGNT RLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKA+AKQCVVFNCSDGLDYIALGKFFKGL S GAW+CFDEFNRIDLEVLSVVAQQILTIQR I A  + L+FEGTELKL+PTCAVFITMNPGYAGRSELPDNLKALFR+VAMMVPDYALIAEI LYSCGFV ARPL+VKIVATYRLCSEQLSSQ HYDYGMRAVKSVLTAAGNLKLK+P+E+ED+L+LRSIIDVNLPKFL HDLPLF GI SDLFPG+  P PDY +L + I+EN  KMNL+ + FF EKI QIYEMMIVRHGFM+VGEPFGGKTSAY+VLAAAL DICE+ LMEEN+VQ T++NPK+ITMGQLYGQFDPVSHEWSDG+LAVSYRAFA S +PDRKWLIFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQ+SP  +LIFEPMDLEVASPATVSRCGM+YMEP  LGWRP+  SWL  +P  ++ +HK +   +F+R + A +  I+KG   ELSPTS+ ++VKSL+NL+DC +D F DE+++ +MDQRD+ +WLEG+F F   WS+GA+  EEGR  FD L RE++ GG+ EETR +  ++E V PP +      P +GT+Y+YRF+ E    G G+WE W+E +K    I KD +FNEIIVPT +TV+Y  LM LL+TH KP +FVGPTGTGKS YI+DFLLN++ KD+Y P LINFSAQT+A QTQNIIMSKLD+RRKGVFGPP+GKK++VFVDD+NMP RETYGAQPP+ELLRQWLDHWNWYD+KD + I L+D+Q + AMGPPGGGRNP+TPRFLRH NT+TINEF ++TM TIFS IL+WH+ I   F   F    +Q+I AT+ VY+ A  NLLPTPAKSHYLFNLRDFSRVIQG+ LS P T ++   +KRLW HE+ RVYYDRLV   D  W   +++EVS  HLNEDF  LFKHLD + DG VTEDD+RSL++CDF D K  ++ Y EV D E LR+ VE +L+EYN +SK PMNLVLFRFAIEHV RISRILKQPR HALLVGVGGSGRQSLTRLAA MA+ +LFQVEISKSY  +EWR+DLK I++KST  D H VFLF+D QIK ESFLED++NLLN GEVPNL+  DEKQE+CE+MR +DRQRD+ +QTDGS +AL+N F++R R QLH+VLAMSPIGD FR+RLR+FP+L+NCCTIDWFQ+WPEDAL AVA+RFLEDVE+  + ++GCI +CK FHTST  LS  +L EL RYNYVTPTSYLELIS FK+LL +KRTEV K K RYEVGL+KL+SAA+ +S MQ EL   QP+L  A+KEV++ M++++ +S E SK EK+V+ +EA AN+QA AA+AIK+ECD DLA A+PILE+AL AL+TLT  DIT+V+ M +PP GV+LVMEA+C+LKGIKPDR+ DPSGSGKK+ED+WGP+K+LLG+MKFL+ L  ++KDNIP+  M +IR KY+TN DF PE+I  AS A EGLCKWV A++ YDKVAKVVAPKK  L  A  +   AM SL KK+AALKEVQDKL  L E LE+NK +K DLEN+V++CSKKL RAEQLIGGLGGEK RW + A +LG  + NLTGDIL+S+ +VAYLGAFTSSFR   T++W+     + IPCS   SL+ +LG+PV+IRSW I GLP+D FSI+N IIISN+RRWPLMIDPQGQANKW+KNMEK N+L VIKL+DADFVR LENCIQFGTPVLLEN+GEELDP+LEPLLLKQTFKQGGS+CI+LGDS IEY+ DFRFYITTKLRNPHYLPE SVKVTLLNFMITPEG+QDQLLGIVV+RERP+LEEEK  LI Q A NK++L+E+ED+IL VLS SEGNILEDE+A+++L+SSK L+NEI+EKQA  E TE KID+ RLGY PIAIHS ILFFSIADLANI+PMYQYSLTWFINLF +SIDNS+KS+ L++RLQ LK +FTYSLYCNVCRSLFEKDKLLFSF L  N+LKH+ L+ E EWRFLLTGGVGLDNPH NP  WLP  SWDE+CRLD++  F G+R+     ++ WK++YDS +PH+   P EW E+L   F +M ++RCLRPDK+V  +Q FV   +G+++IE PPF+L  +F DS+C +PL+FILSPG+DPMAALLKF ++QGF G +  SLSLGQGQGPIAM MI+ G+KEGTWV+LQNCHLA SWM  LE+  EELN +TTHPDFRLWLTSYPS  FPVA+LQNGVKMTNE PKGLR NI RS+  DPISD EFF +S   + +KKLLF LCFFHA+ QERRKFGP+GWNI YEFNETDLRISVQQLHMF+DQY+ + +DAL+Y+TGECNYGGRVTDDWDRRTL TIL  FY  ++  D DYKFD SG YY+PP+ DY  YIEY KTLPLNP P +FGM+ NADITKD  ETQLLFDSILLTQ+R S G   S+DD+V EV+AD+LN+LP +FDT+  MRKYPT Y QSMNTVLVQEM RFN LL TIR S  NI+KAIKGLVVMS++LEEVV S+LK +IP MWMKKSYPSLKPLG Y++DFL RLKFL DW+ +G P +FW+SGF+FTQAFLTG QQNYAR+YTIPIDLL FD+E+++D+ Y   PEDG Y++GLFLDGARWDR+ K + ES PK+L D MPVIWLKPMKK +IP +  Y+SP+YKTSERRGTLSTTGHSTN+VI+M L +D P EHWI RGVALLCQL+
Sbjct:    4 SKRNAPKKPDKSVCLLPQIQRARSKPRWHEASPSFRLQGTAQQDTQGFLLSSIQEAGVQWHQTRRQGLLQAGTKDGRISGASFKQHGGVQPKRDREQFRSALVSIIMHREDDPAK-SVTEISTPSTSGPPT-----AAEKDILRYCYYIRNGIGTEDVAAMEDSWLKNVLALV-----PEHLKSLTRTIEALSDEMREDYLLSIKKNIVDFVLQDPRENKELKARDLPPHRQEMEIIPKPWKKSFLQAQKRMRNNLFTVNHTMLEVLGLWQVSFKKLRLIDVEAFHSEEESMELSVFQQLVNKHIERATGILLNTWIPEVQKIYHRGNKRNLIPSNSSVARLQSFYNCVATLMTSQLQSLALESMQDYTHLIAQNPHSV------------------------RVYEHPGFVLRLVLDQNTIKFEPDFKDFEVTVLNVYNAMLKSLSVIPRVETKLYSEWPGPETHHTLKPIILPEILEAQQEKVRRVIRAESAEPLKHVHLYDKYAPLVSQQAEEDVTQFLLE---QHSFQELMMEVIRYQQLADEIQCSTVKVVRLGMFELHSHDLVRALVKRAEGLLQKLVNHMLQGHQEFNNKLCEEYDTIANKALRSPSNTEELMELRAYVAKVEEEEILQLEMKLQESNNRLCFLVDYVTFSPTDIQLNSKTFQRHARMPSIFDQHRQIIKEKTGQFQDGLKLRCERILEDIKSYEQQVEEFVNFGDLSELNKYLKKAQSLNSKLELVMEKIRGINQEEEAFDWPVSQYPQRKTVQDQLLPYLRLYETAAEFQSQHHQWVTGPLTAVNPDKVEVDVGNYSRGLYKLEKTFQDLPKPLQIATSVKAEVEAFKEHIPIVQVLCNPGLRERHWEAMSAVVGFPLKPSEEDACVAHFLPLHLEAHLSAFESISEGASKEHGLEKAMERMVSEWAGMEFTLLPYRETGTSILSSLDEVQMLLDDHIVKTQTMRGSPFIKPFEAEIRDWEDKLLLLQEIMDEWLKVQGTWLYLEPIFSSPDIMAQMPEEGRRFTAVDKTWRDTMKQVSLDKHVLAVVAIEKMLDKMKHSNELLELILKGLNEYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASVVFTDVLDITHMRSSEGEVVELLDIISTSKARGQVEKWLLELENGMLRSIHKVIGKACEAYLNDLRINWVRAWPGQTVLCVSQVYWTKDIHEAIAKGPKALQAYLEQNNTQIDDIVTLVRGKLSKQNRVTLGALVVLDVHARDVLASLVQKGVDDETNFEWLSQLRYYWIENQLHTKMINAGLAYGYEYLGNTPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAIAKQCVVFNCSDGLDYIALGKFFKGLLSAGAWACFDEFNRIDLEVLSVVAQQILTIQRGISAHAEMLLFEGTELKLNPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYALIAEIVLYSCGFVRARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKFPEENEDVLLLRSIIDVNLPKFLAHDLPLFEGITSDLFPGIKLPKPDYSVLLEAIRENSAKMNLQVTDFFAEKILQIYEMMIVRHGFMLVGEPFGGKTSAYRVLAAALNDICEKNLMEENRVQITVINPKSITMGQLYGQFDPVSHEWSDGILAVSYRAFAISQSPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMSLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPVMLSWLNTVPSTLSSMHKDLITGLFDRMLPACLQLIRKGTK-ELSPTSNTSLVKSLMNLMDCMMDEFGDESQMKRMDQRDVCSWLEGIFVFCLLWSVGASCTEEGRVKFDGLVREMLVGGLSEETRTRHGILEHVEPPAKQLTVPLPTEGTLYEYRFLKE----GPGRWELWTEELKAFPPIPKDVQFNEIIVPTENTVRYNALMKLLITHQKPTVFVGPTGTGKSVYILDFLLNRLEKDVYSPLLINFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKKMVVFVDDVNMPARETYGAQPPVELLRQWLDHWNWYDMKDCSMINLVDIQIMCAMGPPGGGRNPVTPRFLRHFNTVTINEFDNKTMFTIFSRILDWHLTIRFPFPKPFASVTSQIISATMSVYQEATKNLLPTPAKSHYLFNLRDFSRVIQGICLSRPETADDLTAIKRLWVHEVLRVYYDRLVHPDDCAWMVGFLQEVSKSHLNEDFHQLFKHLDSNSDGLVTEDDLRSLMFCDFHDPKGEDRNYREVGDAEKLRQVVETHLEEYNNISKAPMNLVLFRFAIEHVCRISRILKQPRGHALLVGVGGSGRQSLTRLAAHMAEAELFQVEISKSYGVSEWRDDLKLIMQKSTSGDTHGVFLFTDTQIKMESFLEDVSNLLNTGEVPNLFAVDEKQEICERMRVLDRQRDRDKQTDGSTLALFNMFLERCRSQLHVVLAMSPIGDTFRSRLRRFPALINCCTIDWFQSWPEDALQAVASRFLEDVEMTNTAREGCISMCKSFHTSTIDLSAHFLSELQRYNYVTPTSYLELISMFKHLLQRKRTEVMKLKSRYEVGLQKLESAATQVSTMQGELEALQPQLRVATKEVEEMMVVIQHESEEVSKTEKVVRVDEAEANEQAMAAKAIKDECDADLAVAVPILEAALAALDTLTQQDITLVKAMKNPPAGVKLVMEAICILKGIKPDRIPDPSGSGKKVEDYWGPAKKLLGDMKFLQSLHEYNKDNIPVSYMSIIRNKYITNPDFVPEKIRTASAAAEGLCKWVCAMDSYDKVAKVVAPKKEKLAHAEEKLKVAMESLRKKQAALKEVQDKLAKLQETLETNKNKKADLENQVEMCSKKLERAEQLIGGLGGEKSRWSETAFNLGQLYNNLTGDILISAAIVAYLGAFTSSFRQRATEEWIDMCKSRGIPCSKNMSLMNSLGEPVKIRSWTIAGLPSDSFSIDNAIIISNARRWPLMIDPQGQANKWLKNMEKSNSLHVIKLSDADFVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSVCIRLGDSTIEYAPDFRFYITTKLRNPHYLPEVSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQALIVQGAENKRQLQEIEDKILEVLSASEGNILEDETAVQILSSSKVLANEISEKQAIAEVTELKIDQTRLGYTPIAIHSAILFFSIADLANIEPMYQYSLTWFINLFIMSIDNSQKSDLLEERLQILKDHFTYSLYCNVCRSLFEKDKLLFSFCLTVNLLKHNKLVDEKEWRFLLTGGVGLDNPHSNPCTWLPKTSWDEICRLDEMERFKGLRKDLARLREGWKEVYDSKDPHHTDFPSEWQEKL-GQFQRMLIIRCLRPDKVVPMVQEFVSGNLGQQFIEVPPFNLATAFADSHCCAPLIFILSPGSDPMAALLKFGEEQGFTGNRLTSLSLGQGQGPIAMSMIETGVKEGTWVVLQNCHLATSWMSTLERVCEELNADTTHPDFRLWLTSYPSPNFPVAVLQNGVKMTNEAPKGLRSNIIRSFCMDPISDPEFFDSSSKPAVFKKLLFSLCFFHALTQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLDQYEEIPFDALRYMTGECNYGGRVTDDWDRRTLRTILSIFYTSEIINDADYKFDPSGLYYSPPEGDYNSYIEYTKTLPLNPSPEIFGMNANADITKDQVETQLLFDSILLTQSRSSGGSAASSDDMVFEVAADILNKLPQDFDTDAAMRKYPTSYNQSMNTVLVQEMGRFNKLLQTIRDSCVNIQKAIKGLVVMSAELEEVVSSILKGRIPAMWMKKSYPSLKPLGGYISDFLERLKFLQDWYMDGMPAVFWMSGFFFTQAFLTGGQQNYARRYTIPIDLLSFDFEVMEDKEYKNPPEDGVYIRGLFLDGARWDRRTKRLAESFPKILHDTMPVIWLKPMKKQDIPERQCYISPVYKTSERRGTLSTTGHSTNYVISMALNSDVPPEHWIRRGVALLCQLN 4000          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Zebrafish
Match: dnah12 (dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:ZDB-GENE-090311-9])

HSP 1 Score: 4051.13 bits (10505), Expect = 0.000e+0
Identity = 2079/3832 (54.25%), Postives = 2719/3832 (70.96%), Query Frame = 3
Query:  729 FINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNK-KKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEF-DKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKP------------IPKK----------------IAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLP-PAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDF--SDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSA-WLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFF-GTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQ-ARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPS-YLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD 12113
            F+ + +  QK+L++ +P M  VL++   +F +L L+D+ + R     ++ +  ++      E  +E+LMK W   + ++    +  +K+ P       L+ F+NCASTL+++ L+ L   S+  + +L                            D  N+ + P F + LI +D  + F P+  D E  +L + + +   +  V  I+S     W  + +   ++  +   +    ++T+RN +     GP +H + + D+Y  L+N     ++D L+   E+ HSF+E  K ++ +  L K+I       I   M  L C+EL + L+K+A  + + ++ +++  H Q + ++ +E+E I  +AL +P  TE+MME+I +++  +   + EL  ++ ++ +R+ +LMD   FN   ++LN +V      +  IFD++ + M++ K + Q +L  +RE+ + ELD   +++EEF    +++ I +Y    + +  +L+     I+  NKEE  + W+ T+YP  + ++  + PY KL+   +++    K WM+GS   +  + ++ +V  Y R ++K+ K F+ K             + KK                I + V  +V+EFKE++PL+  L  PG+R RHW+Q+S+I G  L  + G  L K++  NL P++  FE IS  A KEF LE+AM+ M   W  + F    YR+TG  ILSSVD+IQ MLDD IVKTQTMRGSPFIKPFE EIK WE +LI +QD +DEWLKVQ  WLYLEPIFSS DIM QMPEEGR F  V+K W+E+M   + D ++L    +  + +KL++S  LLE+I+KGLN YLEKKRL+FPRFFFLSNDE+LEILSETKDPTRVQPHLKKCFEGIA L F   LDI  M SSE E V    +ISTS+ARG VEKWL+++E  M+ S+R  I+   + Y  T R +WV++W GQ VL  S  YWT+ V +AI+     L  Y +   +Q+++IV LVRG+L KQ RTTL AL+ +DVHARDV++ LI++ V++E DF WL QLRYYW  +N+  ++IN  +KY YEYLGN+ RLVITPLTDRCYRTL GA +L+LGGAPEGPAGTGKTETTKDLAKA+A QCVVFNCSDGLDY+A+GKFFKGLAS GAW+CFDEFNRI+LEVLSVVAQQIL IQRAI  + +   FEGTEL+L+P C V ITMNPGYAGRSELPDNLK LFR+VAMMVP+YALIAEISLYS GF+NA+PL+VKIV TYRLCSEQLSSQ HYDYGMRAVK+VL AAGNLKLK+PDE+EDIL+LRSI DVN PKFL+HD+PLFNGI SDLFPG++ PV DY +  +     C   N++    F++KI Q YEMMIVRHGFM+VGEPF GKT    VLA  L  + E G  EE KV Y  +NPK+ITMGQL+GQFDPVSHEW+DG++A ++R FA+S TP+RKW++FDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQ+S   +LIFE MDL  ASPATVSRCGM+YMEP+ LGW P+  SW+K LP P     +  +   +FE  +   +  + +   +E+ P+S+ N V SL  L +  +    +E        +++ TW+   F FA  WS+G   + + R  FDK  RE+++G          A    +P  +  ++  +  KG +YDY +    +  G G+W HW+E +       K+ K  +IIVPT DTV+YTYLM+L + + +P L VGPTGTGKS Y+ + L+N ++KD++ P  INFSA+TSANQTQNIIMS+LD+RRKGV+GPP+GKK I+FVDD+NMP +E +GAQPP+ELLRQ+ DH NWYDLKDT+ I L D+Q I AMGPPGGGRN +TPRFLRH N  +IN F DE+M+ IFS+I+ +++ T  F PD     NQ++ ATL+VY+ A+ NLLPTPAKSHY FNLRDFSRV+QG LL    ++     M RL+ HE++RV+YDRLV DQDR W F     +  +H  ++FD +F+HL  D +  + E+++R+L++ D+   D   S + Y EV  +E   + VE  LDEYNQ  K  MNLV+FR+ +EH+SRISR+LKQP  +ALLVGVGGSGRQS+TRLA  M++  LFQ EISKSY   EWREDLKR+++ +       VFL +D QIK E+FLED++++LN GEVPN++  DEKQE+ E +R   +  +K    + SP+AL+ +FV R ++ LHIV+A SPIGDAFRNRLR+FPSL+NCCTIDWFQ WPE+AL  VA +FLE ++L    +   + +CK FHTS   LS ++L+EL R+NYVTPTSYLELI+ F+ LL ++R  V   K RY  GL+KL  A S +S M+KEL D QPKL +A  +  K M ++E +S E   + K+V+ +E  A  +A  A+A+KNEC++DLAEAIP LE+AL AL+TL PAD+TIV+ M +PP GV+LVM AVCV+K IKP+R+NDPSG+G+KI D+WGPSK+LLG+M FL  LK +DKDNIP  +M  IR +Y+TN DF P ++  AS+A EGLC+W+ A+E YD+VAKVVAPKK  L  A     T M+ LN+KRA LKEV+D+L  L + LE     K  LE +VDLC++KL RAE+LIGGLGGEK+RW++AA+DL   + NLTGD+L+S+GV+AYLGAFT+ FR + TK W      K IP SD FSL  TLGDP++IR+WNI GLPTD FSI+NG+I+SNSRRWPLMIDPQGQANKW+KN E+ +NL VIKLTDAD++R LENCIQFGTP+LLEN+GEELDP LEPLLLKQ FKQGG  CI+LG+S+IEYS DFRFYITTKLRNPHYLPE + KV LLNFMITPEGL+DQLLGIVV++ERPELEEE+N LI QSA NKK+LKE+ED+IL  L +SEGNILEDESAI++L+++K +SNEI +KQ   E+TE +I E+R GY  IA HS+ILFF+IADLANIDPMYQYSL WF+NL+  SI +S KS+NL++RL+ L  YFTY+LYCNVCRSLFEKDKLLFSF+LCSN+L     I+  E+ FLLTGGVGL N   NP   WLP KSWDE+CR  DL   +GI++ FI+  +S+  IYDS EP N  LP  W ++L +   KM + RCLRPDKI  AI  FV +++GK ++EPPPFDL  S+NDSNCT PL+F+LSPGADPMA+LLKFA+D+  GG +F+S+SLGQGQGPIA+K+I+  +K+GTWV LQNCHLA SWM  LEK  E+L+P+T HP+FRLWLTSYPS  FPV ILQNGVKMTNEPP GLR N+ +SYLSDPISD +FF G  K    W+KLL+G+CFFHA+VQER+KFGP+GWNI Y FNE+DLRIS++QL +F+++Y  V ++A+ YLTGECNYGGRVTDDWDRR L+TIL  FY   V + P Y F  SG Y+APP   YE Y+E+IK LP    P VFGMH+N DI+KD Q+T+LLFDS+LLTQ      GGG   D  + +++ D+L++LP NFD E  + K+P  YE+SMNTVLVQEM R+N L STIR SLQN+ KAIKGLVVM ++LE V  S+L  K+P  W K SYPSLKPLGSYVNDFLARLKFL DW+D   P +FW+SGF+FTQAF+TG  QNYARKY+IPIDLL F+YE+L     D +PEDG Y+ GLFLDGARWD+K  ++ E +PKVL D +P+IW+KP  K  +    S Y+ P+YKTSER+GTLSTTGHSTNFVI M LPT K  +HWI RGVALLCQLDD
Sbjct:  191 FVQSRREIQKNLHILHPAMKSVLDICYSTFSHLLLIDLSDCRST-GPVDCESLKNKVAVECERVEERLMKAWFPKIIHLLTSKDTLQKVKPK-----KLDSFYNCASTLISNQLKALVEKSVTAFVSLF---------------------------DPLNINKLPLFKMDLIFDDEKMDFYPNFHDLELAVLEIANLISNTMQKVQTIQS-----WLAEGSISVIDAKLSDHVQVWAQTTLRNAVRMNLEGPAKHFQSYVDRYDWLVNGTAQAQVDKLM---EEEHSFDEHTKQVEWFRALSKEIS-SLPSLIHFDMVRLDCEELKQGLAKKANALSKIIVGKLVSSHHQCSLQICEEFEAIRDRALKVPETTEEMMEMITYINQVKTKGIEELNNRIMEAQQRMNYLMDVHIFNEEHLDLNTTVLLWPQNINPIFDQSDEVMDEAKLKGQNDLSGRREKLLLELDKVGRRMEEFAECSELDMIQQYAADVRTVLKRLQDIEESIDFINKEEALYQWEKTSYPEVEVIKESIEPYQKLFTLVLKWQRTRKKWMDGSFLDLNGESIELEVEEYVREMYKMLKFFQQKQKKAELKKEKTAGLKKKTKEDQEDDKKESATILICSSVVKQVKEFKEYIPLVSILCNPGIRPRHWEQMSEIAGQDLTPDSGSTLRKILKQNLTPYLELFEGISAGASKEFGLERAMQTMVEAWDTVSFHYHPYRDTGVSILSSVDEIQTMLDDQIVKTQTMRGSPFIKPFETEIKVWEERLIGIQDTIDEWLKVQHQWLYLEPIFSSEDIMKQMPEEGRLFQIVNKHWREVMANCVKDPKILAATSLPGLFEKLQESYNLLENIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPTRVQPHLKKCFEGIAKLDFLPNLDIQAMYSSEGERVEFIQLISTSEARGAVEKWLVQVEDIMLRSIRDVINRSRLAYPETKRSQWVREWPGQVVLCASQMYWTVEVHEAIRSSANGLKKYYEQLQNQLNDIVELVRGKLPKQTRTTLGALVTIDVHARDVILELIEKGVSSETDFQWLAQLRYYWANDNVRVRIINCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIEMRLEYFDFEGTELRLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKFPDENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGISLPVADYKLFLECAHLCCENHNVQPVKVFLDKIIQTYEMMIVRHGFMLVGEPFAGKTKVLHVLADTLTLMNESGYNEEEKVIYQTVNPKSITMGQLFGQFDPVSHEWTDGIVANTFREFASSETPERKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSSQMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWTPLVLSWMKTLPDPLQAQDNSTLLQQLFEWLLPPTLV-LLRKQCREVIPSSNSNTVVSLTRLFEMLLTRPVNEDP----GNKNMRTWIMAAFAFALVWSVGGCCDTDSRSRFDKFLREMISGK---------AENCPIPAAVSKWECPFDEKGLVYDYSY----EFKGKGRWVHWNESISNAPLGDKNTKVQDIIVPTIDTVRYTYLMDLCIQYGRPLLLVGPTGTGKSVYVKEKLMNNLDKDLFLPFFINFSARTSANQTQNIIMSRLDKRRKGVYGPPMGKKCIIFVDDMNMPAKEVFGAQPPVELLRQYFDHGNWYDLKDTSKITLTDMQLISAMGPPGGGRNAVTPRFLRHFNICSINAFSDESMVRIFSNIVTFYLRTNEFPPDCFTVGNQIVSATLEVYQKAIENLLPTPAKSHYTFNLRDFSRVVQGCLLLKKESLTNKRTMIRLFVHEIYRVFYDRLVDDQDRAWLFTLTSNIVKQHFKDNFDSVFEHLK-DGNKPLCEENMRNLLFGDYMMPDVDESERLYAEVPSVERFGEVVETCLDEYNQTHKNRMNLVIFRYVLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATFMSNMTLFQPEISKSYGMNEWREDLKRLMKNAGVKGEKTVFLLTDAQIKDEAFLEDVDSILNTGEVPNIFAVDEKQEIMEAVRPFAQAGNKNL--EFSPLALFAYFVTRCKENLHIVVAFSPIGDAFRNRLRQFPSLINCCTIDWFQPWPEEALERVANKFLETLDLSDLERKEVVPICKTFHTSAIDLSNRFLIELGRHNYVTPTSYLELIAAFRLLLTQRRDTVMSAKNRYTNGLDKLAFAESQVSEMKKELVDLQPKLEQAKIDNTKIMEVIEVESVEVEAKSKLVRVDEEAATLKANEAQALKNECESDLAEAIPALEAALSALDTLKPADVTIVKAMKNPPAGVKLVMAAVCVMKDIKPERINDPSGTGQKILDYWGPSKKLLGDMNFLRDLKEYDKDNIPAQVMHKIRSEYMTNPDFDPTKVVKASSAAEGLCRWITAMEVYDRVAKVVAPKKANLIVAQESLATTMALLNQKRAELKEVEDRLAALQKTLEEKTEEKAQLEFQVDLCARKLERAEKLIGGLGGEKNRWLKAANDLQCTYDNLTGDVLISAGVIAYLGAFTARFRHDCTKMWAQLCKSKKIPSSDDFSLSKTLGDPIKIRAWNIAGLPTDSFSIDNGVIVSNSRRWPLMIDPQGQANKWVKNSERDHNLNVIKLTDADYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQVFKQGGVDCIRLGESVIEYSADFRFYITTKLRNPHYLPELATKVCLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKEIEDQILETLQSSEGNILEDESAIQILDAAKLMSNEITKKQQIAEKTEIEIAESREGYRAIAKHSSILFFTIADLANIDPMYQYSLNWFVNLYVNSILDSNKSKNLEKRLRYLIDYFTYNLYCNVCRSLFEKDKLLFSFLLCSNLLLAKKEIEYSEFMFLLTGGVGLQNSIPNPDPNWLPDKSWDEICRASDLPALNGIKESFIKSPESFLPIYDSKEPFNTALPKPWCDKLNE-LQKMIIYRCLRPDKIEPAISKFVTDKLGKIFVEPPPFDLSKSYNDSNCTIPLVFVLSPGADPMASLLKFANDKNMGGSQFKSISLGQGQGPIAVKLIRSAMKDGTWVCLQNCHLAVSWMSTLEKICEDLSPDTCHPNFRLWLTSYPSPRFPVTILQNGVKMTNEPPTGLRLNLLQSYLSDPISDADFFAGCPKKELVWEKLLYGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISIRQLQLFVNEYQEVPFEAITYLTGECNYGGRVTDDWDRRLLMTILADFYNKDVIDHPRYSFSPSGKYHAPPKSIYEDYVEFIKKLPFTQHPEVFGMHENVDISKDLQQTKLLFDSLLLTQGGGSKGGGGSGGDSTLLDIANDILSKLPGNFDIESALVKFPVCYEESMNTVLVQEMQRYNNLSSTIRVSLQNLIKAIKGLVVMDAELEAVAGSLLVGKVPEKWAKCSYPSLKPLGSYVNDFLARLKFLQDWYDTQKPHVFWLSGFFFTQAFITGALQNYARKYSIPIDLLGFNYEVLPFDTSDSSPEDGVYIHGLFLDGARWDKKSGVLAEQYPKVLFDAVPIIWIKPTDKKAMDQPHSVYVCPLYKTSERKGTLSTTGHSTNFVITMMLPTSKRPQHWIKRGVALLCQLDD 3958          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Zebrafish
Match: CR450723.1 (dynein, axonemal, heavy chain 12 [Source:NCBI gene;Acc:799461])

HSP 1 Score: 4024.94 bits (10437), Expect = 0.000e+0
Identity = 2081/3841 (54.18%), Postives = 2708/3841 (70.50%), Query Frame = 3
Query:  714 PWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNK-KKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEF-DKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLL-DRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKP------------IPKK----------------IAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLP-PAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQID-AFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDF--SDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQST---EASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSA-WLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFF-GTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQ-ARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD 12113
            PW  SF+ + +  QK+L++ +P M  VL++   +F +L L+D+ + R     ++ +  ++      E  +E+LMK W   + ++    +  +K+ P       L+ F+NCASTL+++ L+ L   S+  + +L                            D  N+ + P F + LI +D  + F P+  D E  +L + + +   +  V  I+S     W  + +   ++  +   +    ++T+RN +     GP +H + + D+Y  L+N     ++D L+   E+ HSF+E  K L+ +  L K+I       I   M  L C+EL + L+K+A  + + +L D V  + R     + +E+E I  +AL +P  TE+MME+I +++  +   + EL  ++  S  ++ +LMD   FN   ++LN +V      +  IFD++ + M++ K + Q +L  +RE+ + ELD   +++EEF    +++ I +Y    + +  +L+     I+  NKEE  + W+ T+YP  + ++  + PY KL+   +++    K WM+GS   +  + ++ +V  Y R ++K+ K F+ K             + KK                I + V  +V+EFKE++PL+  L  PG+R RHW+Q+S+I G  L  + G  L K++  NL P++  FE IS  A KEF LE+AM+ M   W  + F    YR+TG  ILSSVD+IQ MLDD IVKTQTMRGSPFIKPFE EIK WE +LI +QD +DEWLKVQ  WLYLEPIFSS DIM QMPEEGR F  V+K W+E+M   + D ++L    +  + +KL++S  LLE+I+KGLN YLEKKRL+FPRFFFLSNDE+LEILSETKDPTRVQPHLKKCFEGIA L F   LDI  M SSE E V    +ISTS+ARG VEKWL+++E  M+ SVR  I+   + Y  T R +WV++W GQ VL  S  YWT+ V +AI+     L  Y +   +Q+++IV LVRG+L KQ RTTL AL+ +DVHARDV++ LI++ V++E DF WL QLRYYW  +N+  ++IN  +KY YEYLGN+ RLVITPLTDRCYRTL GA +L+LGGAPEGPAGTGKTETTKDLAKA+A QCVVFNCSDGLDY+A+GKFFKGLAS GAW+CFDEFNRI+LEVLSVVAQQIL IQRAI  + +   FEGTEL+L+P C V ITMNPGYAGRSELPDNLK LFR+VAMMVP+YALIAEISLYS GF+NA+PL+VKIV TYRLCSEQLSSQ HYDYGMRAVK+VL AAGNLKLK+PDE+EDIL+LRSI DVN PKFL+HD+PLFNGI SDLFPG++ PV DY +  +     C   N++    F++KI Q YEMMIVRHGFM+VGEPF GKT    VLA  L  + E G  EE KV Y  +NPK+ITMGQL+GQFDPVSHEW+DG++A ++R FA+S TP+RKW++FDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQ+S   +LIFE MDL  ASPATVSRCGM+YMEP+ LGW P+  SW+K LP P     +  +   +FE  +   +  + +   +E+ P+S+ N V SL  L +  +    N++        +++ TW+   F FA  WS+G   + + R  FDK  RE+++G          A    +P  +  ++  +  KG +YDY +    +  G G+W HW+E +       K+ K  +IIVPT DTV+YTYLM+L + + +P L VGPTGTGKS Y+ + L+N ++KD++ P  INFSA+TSANQTQNIIMS+LD+RRKGV+GPP+GKK I+FVDD+NMP +E +GAQPP+ELLRQ+ DH NWYDLKDT+ I L D+Q I AMGPPGGGRN +TPRFLRH N  +IN F DE+M+ IFS+I+ +++ T  F PD     NQ++ ATL+VY+ A+ NLLPTPAKSHY FNLRDFSRV+QG LL    ++     M RL+ HE++RV+YDRLV DQDR W F     +  +H  ++FD +F+HL  D +  + E+++R+L++ D+   D   S + Y EV  +E   + VE  LDEYNQ  K  MNLV+FR+ +EH+SRISR+LKQP  +ALLVGVGGSGRQS+TRLA  M++  LFQ EISKSY   EWREDLKR+++ +       VFL +D QIK E+FLED++++LN GEVPN++  DEKQE+ E +R   +  +K    + SP+AL+ +FV R ++ LHIV+A SPIGDAFRNRLR+FPSL+NCCTIDWFQ WPE+AL  VA +FLE ++L    +   + +CK FHTS   LS ++LLEL R+NYVTPTSYLELI+ F+ LL ++R  V   K RY  GL+KL  A S +S M+KEL D QPKL +A  +  K M +   QS        + K+V+ +E  A  +A  A+A+KNEC++DLAEAIP LE+AL AL+TL PAD+TIV+ M +PP GV+LVM AVCV+K IKP+R+NDPSG+G+KI D+WGPSK+LLG+M FL  LK +DKDNIP  +M  IR +Y+TN DF P ++  AS+A EGLC+W+ A+E YD+VAKVVAPKK  L  A     T M+ LN+KRA LKEV+D+L  L + LE     K  LE +VDLC++KL RAE+LIGGLGGEK+RW++AA+DL   + NLTGD+L+S+GV+AYLGAFT+ FR + TK W      K IP SD FSL  TLGDP++IR+WNI GLPTD FSI+NG+I+SNSRRWPLMIDPQGQANKW+KN E+ +NL VIKLTDAD++R LENCIQFGTP+LLEN+GEELDP LEPLLLKQ FKQGG  CI+LG+S+IEYS DFRFYITTKLRNPHYLPE + KV LLNFMITPEGL+DQLLGIVV++ERPELEEE+N LI QSA NKK+LKE+ED+IL  L +SEGNILEDESAI++L+++K +SNEI +KQ   E+TE +I E+R GY  IA HS+ILFF+IADLANIDPMYQYSL WF+NL+  SI +S KS+NL++RL+ L  YFTY+LYCNVCRSLFEKDKLLFSF+LCSN+L     I+  E+ FLLTGGVGL N   NP   WLP KSWDE+CR  DL   +GI+  F+        IYDS EP N  LP  W ++L +   KM + RCLRPDKI  AI  FV +++GK ++EPPPFDL  S+NDSNCT PL+F+LSPGADPMA+LLKFA+D+  GG +F+S+SLGQGQGPIA+K+I+  +K+GTWV LQNCHLA SWM  LEK  E+L+P+T HP+FRLWLTSYPS  FPV ILQNGVKMTNEPP GLR N+ +SYLSDPISD +FF G  K    W+KLL+G+CFFHA+VQER+KFGP+GWNI Y FNE+DLRIS++QL +F+++Y  V ++A+ YLTGECNYGGRVTDDWDRR L+TIL  FY   V + P Y F  SG Y+APP   YE Y+E+IK LP    P VFGMH+N DI+KD Q+T+LLFDS+LLTQ      GGG   D  + +++ D+L++LP NFD E  + K+P  YE+SMNTVLVQEM R+N   +TIR SLQN+ KAIKGLVVM ++LE V  S+L  K+P  W K SYPSLKPLGSYVNDFLARLKFL DW+D   P +FW+SGF+FTQAF+TG  QNYARKY+IPIDLL F+YE+L     D +PEDG Y+ GLFLDGARWD+K  ++ E +PKVL D +P+IW+KP   + I     Y+ P+YKTSER+GTLSTTGHSTNFVI M LPT K  +HWI RGVALLCQLDD
Sbjct:  112 PWHDSFVQSRREIQKNLHILHPAMKSVLDICYSTFSHLLLIDLSDCRST-GPVDCESLKNKVAVECERVEERLMKAWFPKIIHLLTSKDTLQKVKPK-----KLDSFYNCASTLISNQLKALVEKSVTAFVSLF---------------------------DPVNINKLPLFKMDLIFDDEKMDFYPNFHDLELAVLEIANLISNTMQKVQTIQS-----WLAEGSISVIDAKLSDHVQVWAQTTLRNAVRMNLEGPAKHFQSYVDRYDWLVNGTAQAQVDKLM---EEEHSFDEHTKVLEWFRALSKEIS-SLPSLIHFDMVRLDCEELKQGLAKKANALSKIILSDGVFLFFR-----ICEEFEAIRDRALKVPETTEEMMEMITYINQVKTKGIEELNNRIMVSISQMNYLMDVHIFNEEHLDLNTTVLLWPQNINPIFDQSDEVMDEAKLKGQNDLSGRREKLLLELDKVGRRMEEFAECSELDMIQQYAADVRTVLKRLQDIEESIDFINKEEALYQWEKTSYPEVEVIKESIEPYQKLFTLVLKWQRTRKKWMDGSFLDLNGESIELEVEEYVREMYKMLKFFQQKQKKAELEKEKTAGLKKKTKEDQEDDKKESATILICSSVVKQVKEFKEYIPLVSILCNPGIRPRHWEQMSEIAGQDLTPDSGSTLRKILKQNLTPYLELFEGISAGASKEFGLERAMQTMVEAWDTVSFHYHPYRDTGVSILSSVDEIQTMLDDQIVKTQTMRGSPFIKPFETEIKVWEERLIGIQDTIDEWLKVQHQWLYLEPIFSSEDIMKQMPEEGRLFQIVNKHWREVMANCVKDPKILAATSLPGLFEKLQESYNLLENIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPTRVQPHLKKCFEGIAKLDFLPNLDIQAMYSSEGERVEFIQLISTSEARGAVEKWLVQVEDIMLRSVRDVINRSRLAYPETKRSQWVREWPGQVVLCASQMYWTVEVHEAIRSSANGLKKYYEQLQNQLNDIVELVRGKLPKQTRTTLGALVTIDVHARDVILELIEKGVSSETDFQWLAQLRYYWANDNVRVRIINCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIEMRLEYFDFEGTELRLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKFPDENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGISLPVADYKLFLECAHMCCENHNVQPVKVFLDKIIQTYEMMIVRHGFMLVGEPFAGKTKVLHVLADTLTLMNELGYNEEEKVIYQTVNPKSITMGQLFGQFDPVSHEWTDGIVANTFREFASSETPERKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSSQMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWTPLVLSWMKTLPDPLQAQDNSTLLQQLFEWLLPPTLV-LLRKQCREVIPSSNSNTVVSLTRLFEMLLTRPLNEDP-----GNKNMRTWIMAAFAFALVWSVGGCCDTDSRSRFDKFLREMISGK---------AENCPIPAAVSKWECPFDEKGLVYDYSY----EFKGKGRWVHWNESISNAPLGDKNTKVQDIIVPTIDTVRYTYLMDLCIQYGRPLLLVGPTGTGKSIYVKEKLMNNLDKDLFLPFFINFSARTSANQTQNIIMSRLDKRRKGVYGPPMGKKCIIFVDDMNMPAKEVFGAQPPVELLRQYFDHGNWYDLKDTSKITLTDMQLISAMGPPGGGRNAVTPRFLRHFNICSINAFSDESMVRIFSNIVTFYLRTNEFPPDCFTVGNQIVSATLEVYQKAIENLLPTPAKSHYTFNLRDFSRVVQGCLLLKKESLTNKRTMIRLFVHEIYRVFYDRLVDDQDRAWLFTLTSNIVKQHFKDNFDSVFEHLK-DGNKPLCEENMRNLLFGDYMMPDVDESERLYAEVPSVERFGEVVETCLDEYNQTHKNRMNLVIFRYVLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATFMSNMTLFQPEISKSYGMNEWREDLKRLMKNAGVKGEKTVFLLTDAQIKDEAFLEDVDSILNTGEVPNIFAVDEKQEIMEAVRPFAQAGNKNL--EFSPLALFAYFVTRCKENLHIVVAFSPIGDAFRNRLRQFPSLINCCTIDWFQPWPEEALERVANKFLETLDLSDLERQEVVPICKTFHTSAIDLSNRFLLELGRHNYVTPTSYLELIAAFRLLLTQRRDTVMSAKNRYTNGLDKLAFAESQVSEMKKELVDLQPKLEQAKIDNTKIMEVTFIQSMIRFSVEAKSKLVRVDEEAATLKANEAQALKNECESDLAEAIPALEAALSALDTLKPADVTIVKAMKNPPAGVKLVMAAVCVMKDIKPERINDPSGTGQKILDYWGPSKKLLGDMNFLRDLKEYDKDNIPAQVMHKIRSEYMTNPDFDPTKVVKASSAAEGLCRWITAMEVYDRVAKVVAPKKANLIVAQESLATTMALLNQKRAELKEVEDRLAALQKTLEEKTEEKAQLEFQVDLCARKLERAEKLIGGLGGEKNRWLKAANDLQCTYDNLTGDVLISAGVIAYLGAFTARFRHDCTKMWAQLCKSKKIPSSDDFSLSKTLGDPIKIRAWNIAGLPTDSFSIDNGVIVSNSRRWPLMIDPQGQANKWVKNSERDHNLNVIKLTDADYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQVFKQGGVDCIRLGESVIEYSADFRFYITTKLRNPHYLPELATKVCLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKEIEDQILETLQSSEGNILEDESAIQILDAAKLMSNEITKKQQIAEKTEIEIAESREGYRAIAKHSSILFFTIADLANIDPMYQYSLNWFVNLYVNSILDSNKSKNLEKRLRYLIDYFTYNLYCNVCRSLFEKDKLLFSFLLCSNLLLAKKEIEYSEFMFLLTGGVGLQNSIPNPDPNWLPDKSWDEICRASDLPALNGIKYSFL-------PIYDSKEPFNTALPKPWCDKLNE-LQKMIIYRCLRPDKIEPAISKFVTDKLGKIFVEPPPFDLSKSYNDSNCTIPLVFVLSPGADPMASLLKFANDKNMGGSQFKSISLGQGQGPIAVKLIRSAMKDGTWVCLQNCHLAVSWMSTLEKICEDLSPDTCHPNFRLWLTSYPSPRFPVTILQNGVKMTNEPPTGLRLNLLQSYLSDPISDADFFAGCPKKELVWEKLLYGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISIRQLQLFVNEYQEVPFEAITYLTGECNYGGRVTDDWDRRLLMTILADFYNKDVIDHPRYSFSPSGKYHAPPKSIYEDYVEFIKKLPFTQHPEVFGMHENVDISKDLQQTKLLFDSLLLTQGGGSKGGGGSGGDSTLLDIANDILSKLPGNFDIESALVKFPVCYEESMNTVLVQEMQRYN---NTIRVSLQNLIKAIKGLVVMDAELEAVAGSLLVGKVPEKWAKCSYPSLKPLGSYVNDFLARLKFLQDWYDTQKPHVFWLSGFFFTQAFITGALQNYARKYSIPIDLLGFNYEVLPFDTSDSSPEDGVYIHGLFLDGARWDKKSGVLAEQYPKVLFDAVPIIWIKP--STIISPHSVYVCPLYKTSERKGTLSTTGHSTNFVITMMLPTSKRPQHWIKRGVALLCQLDD 3870          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Zebrafish
Match: dnah12 (dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:ZDB-GENE-090311-9])

HSP 1 Score: 4024.17 bits (10435), Expect = 0.000e+0
Identity = 2080/3837 (54.21%), Postives = 2710/3837 (70.63%), Query Frame = 3
Query:  714 PWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNK-KKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEF-DKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLL-DRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKP------------IPKK----------------IAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLP-PAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDF--SDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSA-WLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFF-GTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQ-ARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD 12113
            PW  SF+ + +  QK+L++ +P M  VL++   +F +L L+D+ + R     ++ +  ++      E  +E+LMK W   + ++    +  +K+ P       L+ F+NCASTL+++ L+ L   S+  + +L                            D  N+ + P F + LI +D  + F P+  D E  +L + + +   +  V  I+S     W  + +   ++  +   +    ++T+RN +     GP +H + + D+Y  L+N     ++D L+   E+ HSF+E  K L+ +  L K+I       I   M  L C+EL + L+K+A  + + +L D V  + R     + +E+E I  +AL +P  TE+MME+I +++  +   + EL  ++  S  ++ +LMD   FN   ++LN +V      +  IFD++ + M++ K + Q +L  +RE+ + ELD   +++EEF    +++ I +Y    + +  +L+     I+  NKEE  + W+ T+YP  + ++  + PY KL+   +++    K WM+GS   +  + ++ +V  Y R ++K+ K F+ K             + KK                I + V  +V+EFKE++PL+  L  PG+R RHW+Q+S+I G  L  + G  L K++  NL P++  FE IS  A KEF LE+AM+ M   W  + F    YR+TG  ILSSVD+IQ MLDD IVKTQTMRGSPFIKPFE EIK WE +LI +QD +DEWLKVQ  WLYLEPIFSS DIM QMPEEGR F  V+K W+E+M   + D ++L    +  + +KL++S  LLE+I+KGLN YLEKKRL+FPRFFFLSNDE+LEILSETKDPTRVQPHLKKCFEGIA L F   LDI  M SSE E V    +ISTS+ARG VEKWL+++E  M+ S+R  I+   + Y  T R +WV++W GQ VL  S  YWT+ V +AI+     L  Y +   +Q+++IV LVRG+L KQ RTTL AL+ +DVHARDV++ LI++ V++E DF WL QLRYYW  +N+  ++IN  +KY YEYLGN+ RLVITPLTDRCYRTL GA +L+LGGAPEGPAGTGKTETTKDLAKA+A QCVVFNCSDGLDY+A+GKFFKGLAS GAW+CFDEFNRI+LEVLSVVAQQIL IQRAI  + +   FEGTEL+L+P C V ITMNPGYAGRSELPDNLK LFR+VAMMVP+YALIAEISLYS GF+NA+PL+VKIV TYRLCSEQLSSQ HYDYGMRAVK+VL AAGNLKLK+PDE+EDIL+LRSI DVN PKFL+HD+PLFNGI SDLFPG++ PV DY +  +     C   N++    F++KI Q YEMMIVRHGFM+VGEPF GKT    VLA  L  + E G  EE KV Y  +NPK+ITMGQL+GQFDPVSHEW+DG++A ++R FA+S TP+RKW++FDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQ+S   +LIFE MDL  ASPATVSRCGM+YMEP+ LGW P+  SW+K LP P     +  +   +FE  +   +  + +   +E+ P+S+ N V SL  L +  +    +E        +++ TW+   F FA  WS+G   + + R  FDK  RE+++G          A    +P  +  ++  +  KG +YDY +    +  G G+W HW+E +       K+ K  +IIVPT DTV+YTYLM+L + + +P L VGPTGTGKS Y+ + L+N ++KD++ P  INFSA+TSANQTQNIIMS+LD+RRKGV+GPP+GKK I+FVDD+NMP +E +GAQPP+ELLRQ+ DH NWYDLKDT+ I L D+Q I AMGPPGGGRN +TPRFLRH N  +IN F DE+M+ IFS+I+ +++ T  F PD     NQ++ ATL+VY+ A+ NLLPTPAKSHY FNLRDFSRV+QG LL    ++     M RL+ HE++RV+YDRLV DQDR W F     +  +H  ++FD +F+HL  D +  + E+++R+L++ D+   D   S + Y EV  +E   + VE  LDEYNQ  K  MNLV+FR+ +EH+SRISR+LKQP  +ALLVGVGGSGRQS+TRLA  M++  LFQ EISKSY   EWREDLKR+++ +       VFL +D QIK E+FLED++++LN GEVPN++  DEKQE+ E +R   +  +K    + SP+AL+ +FV R ++ LHIV+A SPIGDAFRNRLR+FPSL+NCCTIDWFQ WPE+AL  VA +FLE ++L    +   + +CK FHTS   LS ++L+EL R+NYVTPTSYLELI+ F+ LL ++R  V   K RY  GL+KL  A S +S M+KEL D QPKL +A  +  K M ++E +S E   + K+V+ +E  A  +A  A+A+KNEC++DLAEAIP LE+AL AL+TL PAD+TIV+ M +PP GV+LVM AVCV+K IKP+R+NDPSG+G+KI D+WGPSK+LLG+M FL  LK +DKDNIP  +M  IR +Y+TN DF P ++  AS+A EGLC+W+ A+E YD+VAKVVAPKK  L  A     T M+ LN+KRA LKEV+D+L  L + LE     K  LE +VDLC++KL RAE+LIGGLGGEK+RW++AA+DL   + NLTGD+L+S+GV+AYLGAFT+ FR + TK W      K IP SD FSL  TLGDP++IR+WNI GLPTD FSI+NG+I+SNSRRWPLMIDPQGQANKW+KN E+ +NL VIKLTDAD++R LENCIQFGTP+LLEN+GEELDP LEPLLLKQ FKQGG  CI+LG+S+IEYS DFRFYITTKLRNPHYLPE + KV LLNFMITPEGL+DQLLGIVV++ERPELEEE+N LI QSA NKK+LKE+ED+IL  L +SEGNILEDESAI++L+++K +SNEI +KQ   E+TE +I E+R GY  IA HS+ILFF+IADLANIDPMYQYSL WF+NL+  SI +S KS+NL++RL+ L  YFTY+LYCNVCRSLFEKDKLLFSF+LCSN+L     I+  E+ FLLTGGVGL N   NP   WLP KSWDE+CR  DL   +GI+  F+        IYDS EP N  LP  W ++L +   KM + RCLRPDKI  AI  FV +++GK ++EPPPFDL  S+NDSNCT PL+F+LSPGADPMA+LLKFA+D+  GG +F+S+SLGQGQGPIA+K+I+  +K+GTWV LQNCHLA SWM  LEK  E+L+P+T HP+FRLWLTSYPS  FPV ILQNGVKMTNEPP GLR N+ +SYLSDPISD +FF G  K    W+KLL+G+CFFHA+VQER+KFGP+GWNI Y FNE+DLRIS++QL +F+++Y  V ++A+ YLTGECNYGGRVTDDWDRR L+TIL  FY   V + P Y F  SG Y+APP   YE Y+E+IK LP    P VFGMH+N DI+KD Q+T+LLFDS+LLTQ      GGG   D  + +++ D+L++LP NFD E  + K+P  YE+SMNTVLVQEM R+N   +TIR SLQN+ KAIKGLVVM ++LE V  S+L  K+P  W K SYPSLKPLGSYVNDFLARLKFL DW+D   P +FW+SGF+FTQAF+TG  QNYARKY+IPIDLL F+YE+L     D +PEDG Y+ GLFLDGARWD+K  ++ E +PKVL D +P+IW+KP   + I     Y+ P+YKTSER+GTLSTTGHSTNFVI M LPT K  +HWI RGVALLCQLDD
Sbjct:  123 PWHDSFVQSRREIQKNLHILHPAMKSVLDICYSTFSHLLLIDLSDCRST-GPVDCESLKNKVAVECERVEERLMKAWFPKIIHLLTSKDTLQKVKPK-----KLDSFYNCASTLISNQLKALVEKSVTAFVSLF---------------------------DPLNINKLPLFKMDLIFDDEKMDFYPNFHDLELAVLEIANLISNTMQKVQTIQS-----WLAEGSISVIDAKLSDHVQVWAQTTLRNAVRMNLEGPAKHFQSYVDRYDWLVNGTAQAQVDKLM---EEEHSFDEHTKVLEWFRALSKEIS-SLPSLIHFDMVRLDCEELKQGLAKKANALSKIILSDGVFLFFR-----ICEEFEAIRDRALKVPETTEEMMEMITYINQVKTKGIEELNNRIMVSISQMNYLMDVHIFNEEHLDLNTTVLLWPQNINPIFDQSDEVMDEAKLKGQNDLSGRREKLLLELDKVGRRMEEFAECSELDMIQQYAADVRTVLKRLQDIEESIDFINKEEALYQWEKTSYPEVEVIKESIEPYQKLFTLVLKWQRTRKKWMDGSFLDLNGESIELEVEEYVREMYKMLKFFQQKQKKAELKKEKTAGLKKKTKEDQEDDKKESATILICSSVVKQVKEFKEYIPLVSILCNPGIRPRHWEQMSEIAGQDLTPDSGSTLRKILKQNLTPYLELFEGISAGASKEFGLERAMQTMVEAWDTVSFHYHPYRDTGVSILSSVDEIQTMLDDQIVKTQTMRGSPFIKPFETEIKVWEERLIGIQDTIDEWLKVQHQWLYLEPIFSSEDIMKQMPEEGRLFQIVNKHWREVMANCVKDPKILAATSLPGLFEKLQESYNLLENIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPTRVQPHLKKCFEGIAKLDFLPNLDIQAMYSSEGERVEFIQLISTSEARGAVEKWLVQVEDIMLRSIRDVINRSRLAYPETKRSQWVREWPGQVVLCASQMYWTVEVHEAIRSSANGLKKYYEQLQNQLNDIVELVRGKLPKQTRTTLGALVTIDVHARDVILELIEKGVSSETDFQWLAQLRYYWANDNVRVRIINCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIEMRLEYFDFEGTELRLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKFPDENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGISLPVADYKLFLECAHLCCENHNVQPVKVFLDKIIQTYEMMIVRHGFMLVGEPFAGKTKVLHVLADTLTLMNESGYNEEEKVIYQTVNPKSITMGQLFGQFDPVSHEWTDGIVANTFREFASSETPERKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSSQMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWTPLVLSWMKTLPDPLQAQDNSTLLQQLFEWLLPPTLV-LLRKQCREVIPSSNSNTVVSLTRLFEMLLTRPVNEDP----GNKNMRTWIMAAFAFALVWSVGGCCDTDSRSRFDKFLREMISGK---------AENCPIPAAVSKWECPFDEKGLVYDYSY----EFKGKGRWVHWNESISNAPLGDKNTKVQDIIVPTIDTVRYTYLMDLCIQYGRPLLLVGPTGTGKSVYVKEKLMNNLDKDLFLPFFINFSARTSANQTQNIIMSRLDKRRKGVYGPPMGKKCIIFVDDMNMPAKEVFGAQPPVELLRQYFDHGNWYDLKDTSKITLTDMQLISAMGPPGGGRNAVTPRFLRHFNICSINAFSDESMVRIFSNIVTFYLRTNEFPPDCFTVGNQIVSATLEVYQKAIENLLPTPAKSHYTFNLRDFSRVVQGCLLLKKESLTNKRTMIRLFVHEIYRVFYDRLVDDQDRAWLFTLTSNIVKQHFKDNFDSVFEHLK-DGNKPLCEENMRNLLFGDYMMPDVDESERLYAEVPSVERFGEVVETCLDEYNQTHKNRMNLVIFRYVLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATFMSNMTLFQPEISKSYGMNEWREDLKRLMKNAGVKGEKTVFLLTDAQIKDEAFLEDVDSILNTGEVPNIFAVDEKQEIMEAVRPFAQAGNKNL--EFSPLALFAYFVTRCKENLHIVVAFSPIGDAFRNRLRQFPSLINCCTIDWFQPWPEEALERVANKFLETLDLSDLERKEVVPICKTFHTSAIDLSNRFLIELGRHNYVTPTSYLELIAAFRLLLTQRRDTVMSAKNRYTNGLDKLAFAESQVSEMKKELVDLQPKLEQAKIDNTKIMEVIEVESVEVEAKSKLVRVDEEAATLKANEAQALKNECESDLAEAIPALEAALSALDTLKPADVTIVKAMKNPPAGVKLVMAAVCVMKDIKPERINDPSGTGQKILDYWGPSKKLLGDMNFLRDLKEYDKDNIPAQVMHKIRSEYMTNPDFDPTKVVKASSAAEGLCRWITAMEVYDRVAKVVAPKKANLIVAQESLATTMALLNQKRAELKEVEDRLAALQKTLEEKTEEKAQLEFQVDLCARKLERAEKLIGGLGGEKNRWLKAANDLQCTYDNLTGDVLISAGVIAYLGAFTARFRHDCTKMWAQLCKSKKIPSSDDFSLSKTLGDPIKIRAWNIAGLPTDSFSIDNGVIVSNSRRWPLMIDPQGQANKWVKNSERDHNLNVIKLTDADYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQVFKQGGVDCIRLGESVIEYSADFRFYITTKLRNPHYLPELATKVCLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKEIEDQILETLQSSEGNILEDESAIQILDAAKLMSNEITKKQQIAEKTEIEIAESREGYRAIAKHSSILFFTIADLANIDPMYQYSLNWFVNLYVNSILDSNKSKNLEKRLRYLIDYFTYNLYCNVCRSLFEKDKLLFSFLLCSNLLLAKKEIEYSEFMFLLTGGVGLQNSIPNPDPNWLPDKSWDEICRASDLPALNGIKYSFL-------PIYDSKEPFNTALPKPWCDKLNE-LQKMIIYRCLRPDKIEPAISKFVTDKLGKIFVEPPPFDLSKSYNDSNCTIPLVFVLSPGADPMASLLKFANDKNMGGSQFKSISLGQGQGPIAVKLIRSAMKDGTWVCLQNCHLAVSWMSTLEKICEDLSPDTCHPNFRLWLTSYPSPRFPVTILQNGVKMTNEPPTGLRLNLLQSYLSDPISDADFFAGCPKKELVWEKLLYGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISIRQLQLFVNEYQEVPFEAITYLTGECNYGGRVTDDWDRRLLMTILADFYNKDVIDHPRYSFSPSGKYHAPPKSIYEDYVEFIKKLPFTQHPEVFGMHENVDISKDLQQTKLLFDSLLLTQGGGSKGGGGSGGDSTLLDIANDILSKLPGNFDIESALVKFPVCYEESMNTVLVQEMQRYN---NTIRVSLQNLIKAIKGLVVMDAELEAVAGSLLVGKVPEKWAKCSYPSLKPLGSYVNDFLARLKFLQDWYDTQKPHVFWLSGFFFTQAFITGALQNYARKYSIPIDLLGFNYEVLPFDTSDSSPEDGVYIHGLFLDGARWDKKSGVLAEQYPKVLFDAVPIIWIKP--STIISPHSVYVCPLYKTSERKGTLSTTGHSTNFVITMMLPTSKRPQHWIKRGVALLCQLDD 3878          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Zebrafish
Match: dnah3 (dynein axonemal heavy chain 3 [Source:ZFIN;Acc:ZDB-GENE-091112-7])

HSP 1 Score: 3950.98 bits (10245), Expect = 0.000e+0
Identity = 2047/3851 (53.16%), Postives = 2731/3851 (70.92%), Query Frame = 3
Query:  606 SVKKAIVDFVLKEPREKET-DDTPIPEHRKELSV-VPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIY--YQGNKKKLVPSVQDQA--NLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDK---TKIYLNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQ--NLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDS-ISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSA-WLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEE-LNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNY-DEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD 12113
            S++K+IVD++L +P E+E    + +P+      +  P PW  S+  A  +  ++L+  NP +  + +LW  SF +LR V+ +        +   +F+    R  +  K++L+  WL    +++  ++     L+P     A   +E+ F C + LM+  L++L + S+ D     +           +  D    G    + D     + P  +++L LED  I FEPS++    L+   + Q++    ++ R+E +L+ +  G+      +  + +++ +II    +T R      ++GP  +++ + KY  L++    Q+I   L   + +HS + F K +    ++ K I      ++ L +F L    L + L  +A+++ E L   V+E +R+ N+ +   Y+EI  +    P++TE+++EL K++  T  +T+ +L  +++++ +RL FL+DY      DM L  +V H    + S  + ++  +  +K+E + +L  +  +  E L    K+V+ F+      + EI   ++K   +   LEAA+  IE  NKEE     + + +PV Q +    +PY +L+ TA++F  K + WM G  +++  + V  D+GN +RT++KL K F  +  P ++    K K+++FK+H+P++ T+  PGL+DRHW+ IS+ VG+ ++ +E   L K++++ L  +  + E I  +A KE++LEK++EKM  EW+ + F+   Y++TGT +LS+VDDIQL+LDDHI+KTQTMRGSPFIKP EAE K WE KL  +QDILD  L+ Q+ W+YLEPIFSS DI+AQMPE GRKF  VD  WK I+ + + D  VL   +   ML +L++SN  LE I +GLN YLE KRL+FPRFFFLSNDE+LEILSETKDP RVQPHLKKCFEGIA L FT  L+IT M SSE EIV L + I   KA+G VEKWLL++E  M+ S+R  I +G+  Y   PRK+WV  W GQ V+  S  +WT  V DAI+     L +Y++ +N+QI +IV LVRG+LS   R TL ALIV+DVHARDV+  L Q+ V++ NDF W+ QLRY+W +  ++ +MI + ++YGYEYLGN+ RLVITPLTDRCYRTL GAL L+LGGAPEGPAGTGKTETTKDLAKA+AKQCVVFNCSDGLDY A+ KFFKGLA  GAW+CFDEFNRI++EVLSVVAQQIL+IQ+A+     T MFEGTEL L+PTC VFITMNPGYAGR+ELPDNLKALFR+VAMMVPDY LI EISLYS GF  +R LA KIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYP+EDE +L+LR+++DVN+ KF+  DLPLF GI +DLFPGV    PDY++L K + +N  KM L+   +F+ KI Q+YEMM+VRHGFMIVGEP GGKTSAYKVLA ALGD+ ++GL+EE  V + I+NPKA+TMGQLYG FDPVSHEWSDGVLA S+R  A  T  DR+W+IFDGP+DA+WIENMNTVLDDNKKLCLMSGEIIQ+SP  +LIFEP DLE ASPATVSRCGM+YMEP  LGW P+ +S++  LP ++ D H+ + AD+F   +   +  I    G  L  TS I++  SL+ L  C +D    E   S   Q+  L WL+ +F FA  WS+G T N   R  FD   R L+ G + +  R        +   L    G +P +GT+YDY F     + G G+W +W+E +  +D  I   AK +++I+PT +T +  + +   L+H+ P L VGPTGTGKS    +FL++ ++K+ Y P  INFSA+TSANQTQ+IIMSKLDRRRKGVFGPPVGKK I++VDDLNMP +E YGAQPPIELLRQW+DH +WYD KDT+ + + D+ ++ AMGPPGGGRN IT RF RHLN ++I+ F DET+  IF+SI +WH  +  F   F      ++QAT+ VYK A+ + LPTP+KSHY+FNLRDF+RVI+GV+L     ++E   + RLW HE++RV+YDRLV + DR  FFN ++E ++ +     D L  HL     GKV +D IRSL + D+S   S+NK+Y E+TDL  L + ++ YL E+N +SK PMNLV+F+FAIEH+SRI R+LKQ   H LLVG+GGSGRQS T+LA  + DY+LFQ+E++K+Y+ ++WR++LK ++ KS        FLFSD+QIK E+F+EDIN LLN G+VPN++P DE+ ++ EKM+ I +   K    D +P+++YNFF+ RV+  LHIVLAMSPIG+ FRNRLR FPSL+NCCTIDWFQ WP+DAL  VA +FLED++L+  ++   +++CK F  S R LSE+Y  +L R+NYVTPTSYLELI TFK LL+ KR+EV + + RY VGL+KL  A+S ++VMQ+EL   QP+L+E +K+ D+ M+ +E+++ E   ++++V  +E +AN+ A AA+AIK+EC+ DLAEA+P LE+AL AL+TL PADIT+++TM +PP  V+LVME++CV+KGIKP+R  DP GSGK IEDFWGPSK++LG+MKFLE LK F+KDNIP   +K IREK++ + DF+P  I   S+ACEGLCKWV A+E Y++VAKVVAPKK  L++A  E    M  LN KRA LKEV+D+L+ L +  E   ++K DLE  ++LCS+KLVRAE+LIGGLGGEKDRW +AA  LG+++ NLTGD+LLSS  V+YLGAFT  +R E  +QWL     K IP S+ F+L  TLG+ V IRSW I GLP D FS +NGII+SNSRRWPLMIDPQGQANKWIKNM K N L VIKL+D+++VR LEN IQFGTPVLLEN+GEELD +LEP+LLKQTFKQ G   +KLG++ IEYS DFRFYITT LRNPHYLPE +VKV LLNFMITP GL+DQLLGIV ++E+PELEE+KN+LI +SA N K+LKE+E++IL VLS+SEGNILEDE+AI VL+SSK LS EI+EKQ     TE +IDE R+GY P+A HS+ILFF I+DLANIDPMYQYSLTWFINL+  SI +S  S++LQ R+ N+  +FT  +Y NVCRSLFEKDKLLFS +L   I++    + +  WRFLLTGGV L+NPH NP+  WL  KSW E+ R   LS   G+ +   E    WK+IYDS  P +++LP +W   +     +M VLRC RPDK+V A+Q F+ + IG+ YIEPP FDL  S++DSNC SPL+F+LSPG+DP A LLKFADD G GG + +++SLGQGQGP+A ++I+  +  G WV+LQNCHLA SWM  LEK  EE + PE TH  FRLWLTS PS  FPV++LQNGVKMTNEPPKGLR N+ RSYLSDPISD  FF +S     W+KLLFGLCFFHA+VQERR FGP+GWNI YEFNE+DLRIS++Q+ MF+D+Y+ V  +AL YLTGECNYGGRVTDD DRR L+++L  FY  Q+ +   Y+  +   YY P    Y+ Y++YI+ LP++ EP VFG+H NA+ITKDNQET  L D +LLT  R ++ G KS  ++VDE++  +L +LP +FD E+V  KYP  YE+SMNTVL QE++RFN L   +RSSL N +KA++G VVMSS+LE V  S+L  K+P MW  KSYPSLKPLGSYV+DFLARL+FL DW DNGPP +FW+S FYFTQ+FLTGV QN+ARKYTIPID + F++E+     + +E PEDGAY++GLFL+GARW+R+  +I ES PKVL D +P+IWLKP + +   ++  Y+ P+YKTS RRGTLSTTGHSTN+V+++ LP+D+P++HW+ RGVA LCQLD+
Sbjct:   59 SLRKSIVDYILLDPAERERLSISAVPQQFPSRVIRAPVPWSESYQEARSWQTENLFTVNPMLLHLEDLWMSSFSSLRFVNSDSLLSADLPLLPGEFEELVQRQCQNTKDELLNTWLPRCASLFVTFKDAWLPLLPKSSSIAPEKVEKLFRCVAALMSLQLRSLVIASLQDLLQFFQ-----------LHQDGNDFG---ERFDEMQYTQRPVLLVKLKLEDPRISFEPSLQGCWELIQQAFTQIISSAHNIPRVECKLFPE-IGETLMLRSVQADEMLVKDII----NTARETFQRNTIGPQRYLEVYKKYTHLLDH---QDIVNFL---KTKHSQQGFTKKITAVQNVWKDIA-SLHATVPLSLFCLDAVNLNQDLCDKAEHLIELLTTFVMEENRELNKSICHRYDEITDRITSKPSSTEELVELNKYLKHTSEVTIHKLRHEIEEAVKRLDFLLDYTTIQAEDMKLFSTVIHWPELILSSLEFSRDKLNNQKDEAEIHLMKRIGQLEETLKGLDKEVDIFKIKEKITLEEIKHNVEKLNNIGISLEAALKEIETSNKEESLLDKEQSQFPVLQTIIAKKQPYDQLWITALDFQTKSEMWMNGPFQQLNAETVSEDLGNMWRTMYKLAKSFPERTAPGRVTENFKKKIDKFKQHLPILTTICNPGLKDRHWEMISNTVGFDVKPDENTPLIKMVELGLSKYSDQLEEIGASASKEYSLEKSLEKMTREWAELHFMFAPYKDTGTSVLSAVDDIQLLLDDHIIKTQTMRGSPFIKPIEAEAKAWEEKLQRMQDILDGMLQCQSMWMYLEPIFSSEDIIAQMPENGRKFAIVDSYWKNIVAESLKDTHVLVATEQPNMLGRLQESNTFLEEIQQGLNSYLETKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFTPDLEITGMISSEKEIVPLIETIYPVKAKGMVEKWLLQVENTMLMSIRAVIKQGMEQYSEMPRKKWVLLWPGQVVICASCIFWTSEVSDAIQNN--TLPSYVEQSNAQITDIVELVRGKLSGGARMTLGALIVIDVHARDVVCKLAQDGVSSLNDFQWISQLRYFWEDGEVMLRMITTAIRYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKAMSKFFKGLAQSGAWACFDEFNRIEVEVLSVVAQQILSIQQAVMRNMKTFMFEGTELSLNPTCCVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYGLIGEISLYSMGFTASRSLAQKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPEEDEIVLLLRALMDVNMAKFVAQDLPLFQGIITDLFPGVVLAKPDYELLLKALHDNIGKMKLQPVPWFISKIIQVYEMMLVRHGFMIVGEPMGGKTSAYKVLAGALGDLYKEGLIEEFAVDFRIINPKAVTMGQLYGCFDPVSHEWSDGVLATSFRQQAQCTNDDRQWIIFDGPIDAVWIENMNTVLDDNKKLCLMSGEIIQMSPKMSLIFEPADLEQASPATVSRCGMIYMEPHQLGWTPLRDSYMNTLPESLADEHRTLIADLFNWLVQPCLDFIYHECGF-LVQTSPIHLAYSLMRLYTCLLDEIFQEGAESMTSQQMTL-WLQSLFLFAVVWSLGGTVNGNSRNKFDTFYRNLLMGTITDHPR-------PMSVKLTKNNG-FPERGTVYDYYF----HKQGPGQWNNWTESIAKEDRVIPAGAKVSDLIIPTAETSRQLFFLRTYLSHEVPVLIVGPTGTGKSVINNNFLMS-LSKERYTPICINFSARTSANQTQDIIMSKLDRRRKGVFGPPVGKKCIIYVDDLNMPAKEIYGAQPPIELLRQWIDHHHWYDKKDTSRLDIEDVLYMSAMGPPGGGRNDITGRFTRHLNILSIDTFDDETLSNIFTSITDWHF-SNGFDASFYRLGKIMVQATMAVYKDAIESFLPTPSKSHYIFNLRDFARVIRGVMLCPSTHMQEGDKVIRLWIHEVYRVFYDRLVDNDDRGKFFNIVKERTSAYFKLSLDKLLGHLTLS--GKVEDDSIRSLFFGDYSKPDSANKQYDEITDLSTLTEVMDFYLREFNNISKAPMNLVMFQFAIEHISRICRVLKQDNGHLLLVGIGGSGRQSATKLATFINDYELFQIELTKNYSMSDWRDNLKHLMLKSGIEGKKTTFLFSDSQIKDEAFVEDINMLLNTGDVPNIFPLDERADIIEKMQGIAQMEGKK--IDVTPLSMYNFFIDRVKTNLHIVLAMSPIGEDFRNRLRMFPSLINCCTIDWFQAWPKDALEMVANKFLEDLDLEDDIRIEVVEMCKTFQESVRELSERYYSQLRRHNYVTPTSYLELILTFKALLNSKRSEVNELRNRYIVGLQKLDFASSQVAVMQQELTALQPELIETAKQTDQMMVKIEKETVEVDAKKELVSADEKVANEAAAAAKAIKDECEGDLAEAMPALEAALAALDTLKPADITVLKTMQNPPGPVKLVMESICVMKGIKPERKQDPGGSGKMIEDFWGPSKKILGDMKFLESLKTFNKDNIPPASIKKIREKFIDHPDFQPSVIKSVSSACEGLCKWVRAMEVYERVAKVVAPKKEKLKEAEEELAVQMQKLNVKRAELKEVEDRLQALNDTFEGMIQKKKDLEANIELCSQKLVRAEKLIGGLGGEKDRWTEAARLLGIKYNNLTGDVLLSSATVSYLGAFTVDYRVECQQQWLELCNRKKIPYSEDFTLGNTLGNQVLIRSWQIAGLPVDLFSTDNGIIVSNSRRWPLMIDPQGQANKWIKNMNKANKLSVIKLSDSNYVRSLENAIQFGTPVLLENVGEELDAVLEPVLLKQTFKQQGVEYMKLGENTIEYSRDFRFYITTGLRNPHYLPEVAVKVCLLNFMITPLGLEDQLLGIVATKEKPELEEKKNQLILESAANNKQLKEIENQILQVLSSSEGNILEDETAITVLSSSKLLSEEISEKQKIASVTESEIDETRMGYRPVAEHSSILFFCISDLANIDPMYQYSLTWFINLYLQSIAHSVPSDDLQIRIANILDHFTLRVYYNVCRSLFEKDKLLFSLLLTVGIMQGKGQVDDIVWRFLLTGGVALENPHPNPAPEWLSDKSWSEVVRASQLSRLEGLFEHVQENIALWKQIYDSGHPQDEELPGKWHTVV--GMERMVVLRCFRPDKLVPAVQKFIVDNIGRAYIEPPTFDLAESYSDSNCCSPLIFVLSPGSDPTAGLLKFADDLGMGGSRTQTISLGQGQGPVAEQLIKAALSVGHWVVLQNCHLATSWMPTLEKICEEVITPENTHTSFRLWLTSQPSDKFPVSVLQNGVKMTNEPPKGLRANLLRSYLSDPISDPTFFNSSARQEIWQKLLFGLCFFHALVQERRTFGPLGWNIPYEFNESDLRISIRQIQMFLDEYEEVPLEALTYLTGECNYGGRVTDDKDRRLLMSLLSIFYSWQLIQQDQYRVCEGDLYYVPSHAPYQSYVDYIRNLPISAEPEVFGLHSNANITKDNQETNQLLDGVLLTLPRQTNSGAKSPQEVVDELAEGMLAKLPCDFDIEMVTNKYPLLYEESMNTVLRQELIRFNRLSKVVRSSLLNTQKALRGQVVMSSELENVFNSLLVGKVPAMWAAKSYPSLKPLGSYVSDFLARLQFLQDWIDNGPPSVFWVSAFYFTQSFLTGVSQNFARKYTIPIDYIGFEFEVCKQETHMEEKPEDGAYIRGLFLEGARWNREHMVIGESVPKVLFDSLPIIWLKPGESATFLHQNVYVCPVYKTSARRGTLSTTGHSTNYVLSIELPSDQPQKHWVNRGVACLCQLDN 3859          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Xenopus
Match: olfm4 (olfactomedin 4 [Source:Xenbase;Acc:XB-GENE-5725072])

HSP 1 Score: 5352.72 bits (13884), Expect = 0.000e+0
Identity = 2648/3898 (67.93%), Postives = 3184/3898 (81.68%), Query Frame = 3
Query:  420 ATEKDILRYYYYIHNGIDTEHVAKMEXXXXXXXXXXXXXXXXAEHPXXXXXXXXXXXXXXXXSVKKAIVDFVLKEPREKETDDTPIPEHRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHI-ITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLD 12110
             T    LRY YYIH+GIDTEHVA MED W+ N+  L+   L   + E +E L DEI+EDYLLSVKKAIVDFVLK+PR+KE   T    HR E+ +VPKPW +SF+      +++L   NP M  VL+LW  SF  LRLVD +EF  ++ ++EL  FQ+   RHI++AK+KL+KKW  ++QNI+YQGNK+K +PS  +   LE FFNCA+TLM   LQ+L L S+ DYT+L+  P                     P   LA   EHPGF++RLIL++T IKF+P   ++ET LLNVYD M+K ++ V R+E++LYS+W  + +K  L PII  EI+EKHK  V+  +  ES  P EH+K +DKY  LI+++ D ++D  L+E    H+FEE  + +  Y  L  +I+Y SR+ IRLGMFEL CDELIRAL+KR++ +  KL+ ++   H++ N+ L  E+E I  KAL  P++T ++M+L  +++  E   M+E+E+KL  +  RL+FL+DYA F+ SD+ LN S FH H+RMG IF+E+K+ +++K E+FQ  LK + E+F+EEL++  KQVEEFQ+ GDM E+ KYLKK+Q L++KL+ A+ +I+  N EEEAFGW  + YP R+++Q+ L PYL+LYE   EFN KYK WMEG    V PD V+ DVGNY+R+L+KLEK F   P    +  K+KTKVEEFKE++PLIQ +  PGLRDRHW  +S IVGY+++ +E   + K I++NL+PF+ KFE ISEAA KEF+LEKAMEKM  EW  +EF +  YRETGT+ILSSVDDIQ++LDDH+VKTQTMRGSPFIK FE EI++WESKL+L+Q+ILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGR+F++VDKTW+++MKQV+ DK VLTV+ IEKML+K KKSNE LE ILKGLN+YLEKKRL+FPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIA++ FT+ LDITH+KSSE E+V L + ISTSKARGQVEKWL+E+E  MI SV   I E +  Y  TPR +WVK+W GQ VL +S  +WT  VQ +I++G +AL+ YL+ NN QID+IVALVRG LSKQNR TL AL+VLDVHARDVL +L+++QV +ENDF WL QLRYYW E ++ TKMIN+ L+YGYEYLGNT RLVITPLTDRCYRTLFGAL+LHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGL SCGAW+CFDEFNRIDLEVLSVVAQQILTIQR I    + L+FEGTELKL+PTCAVFITMNPGYAGRSELPDNLKALFR+VAMMVPDYA+IAEI LYSCGFV ARPL+VKIVATYRLCSEQLSSQ HYDYGMRAVKSVLTAAGNLKLKYP+EDE+IL+LRSIIDVNLPKFL+ DLPLF GI SDLFPGV  P  DY +    IKENC  MNL+ +SFF EKI QIYEMMIVRHGFMIVGEPFGGKTSAY+VLAAAL DICE+GL +ENKVQ T+LNPK+ITMGQLYGQFDPVSHEWSDG+LAVSYRAFA+ST+PDRKWLIFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQ+SP  +LIFEPMDLEVASPATVSRCGM+YMEP  LGWRPI  SWL VLP  ++ +HKK    +F+R +   +  I +   KELSPTSD N+V+SL+NL+DC +D F+DE+ +  M +R+I +WLEG+F F+  WS+G +  E+ R  FD+L RE++ G + EE+R +  ++  V PP + +    P + T+YDY+F+  KQ+   G+WE W+E +    SI ++  FNEIIVPT DTV+YT LMNLL TH K  +FVGPTGTGKS YIIDFLLN+++K+ YKP LINFSAQT+A QTQNIIMSKLD+RRKGVFGPP+GKK +VFVDD+NMP RE YGAQPP+ELLRQWLDHWNWYDLKD + IKL+D+Q + AMGP GGGRNPITPRFLRH NT+TINEF D +M TIFS IL+WH+ I  NF  ++K    Q+I +T+ VYK A+ +LLPTPAKSHYLFNLRDFSRVIQG+ LS P T + P  +KRLW HE+ RVY+DRLV + DR W   YI EV   H+ EDF+ LF+HLDFD DGKV EDD+RSL++CDF D K  +  Y E+ D+E LR  VE +L+E+N +SKK MNLVLFRFAIEH+ RISRILKQPRSHALLVGVGGSGRQSLTRLA  MADY LFQVEISKSY + EWREDLK ILRKSTE +   VFLF+D+QIK+ESFLEDINNLLNAGEVPNL+  DEKQE+CE+MRQIDRQRDK +QTDGSP+AL+N F+ R RDQLH+VLAMSPIGDAFR+RLRKFP+LVNCCTIDWFQ WPEDAL AVATRFLEDVE+ + +++GCID+CK FHTST  LS+++  EL RYNYVTPTSYLELISTFK LL KK+TEV K KRRYEVGLEKL+SA+S ++ MQ EL   QP+L  ASKEVD+ M+++E++S E +K EK+VK +EA+AN+QA AA+AIK+ECD+DLA+A+PILESAL AL+TLT  DIT+V++M SPP GV+LVMEA+C+LKG+KPD++ DPSGSGKKIEDFWGP+KR+LGEMKFL+ L  +DKDNIP   M +IR++Y+TN +F PE++  ASTA EGLCKWV A++ YDKVAKVVAPKKI L +A +E   AM  L KK+AALKEVQDKL  L ++LE NK++K DLEN+VDLCSKKL RAEQLIGGLGGEK RW   A +LG  +INL GDIL+SSG+VAY GAFTSS+R  +T +W      K+IPCS+ FSL  +LG+PV+IR+WNI GLP+D FSI+NGIIISN+RRWPLMIDPQGQANKW+KNMEK N+L VIKL+D DFVR LENCIQFGTPVLLEN+GEELDP+LEPLLLKQTFKQGGS+CI+LGDS IEY+ DFRFYITTKLRNPHYLPETSVKVTLLNFMITPEG+QDQLLGIVV+RERP+LEEEK  LI Q A NK++LKE+ED+IL VLS+SEGNILEDE+AIK+L+SSK L++EI+ KQA  EETE+KID  R+GY PIAIHS+ILFFSIADLANI+PMYQYSLTWFINLF +SIDNSEKSE+LQ+RLQ LK +FTYSLY NVCRSLFEKDKLLFSF L +N++KH+ LI E+EW+FLLTGG+GLDNPH NP  WLP KSWDE+CRLD++ +F GIR+ F+  +D WK +YDS+EPH+   P +W E+L   F +M ++RCLRPDKI+  +Q FV   +GK +IEPPPFDL  +F DS+C +PL+F+LSPGADPMAALLKFADDQGFGGGK  SLSLGQGQGPIA++M ++ IKEG+WV+LQNCHLA SWM +LEK  EELNP+TTHPDFRLWLTSYPS  FPV++LQNGVKMTNE PKGLR NI RSYL DPISD EFF + K L  +KKLL+GLCFFHA+VQERRKFGP+GWNI YEFNETD+RISVQQLHMF++QY+ V YDALQY+TGECNYGGRVTDDWDRR L +IL KFY I++N++P+Y FD SG YYAPPD DY+ YIEY KTLPLN  P +FGM+ NADITKD  ETQ LFD+ILLTQ+R S GG KS+D++V EVSAD+L++LP NFDTE  MR+YPT Y QSMNTVLVQEM RFN LLSTIR S  NI+KAIKGLVVMS+DLEEVV S+LK KIPGMWMKKSYPSLKPLGSYV+DFLARLKFL DW++NG PP+FW+SGF+FTQAFLTG QQNYARKYTIPIDLL FD+E+L+D+ Y  APEDG Y+ GLFLDGARWDRK K + ES PK+L D +PV+WLKP K+++IPN+P Y++P+YKTSERRGTLSTTGHSTNFVIAMTLP+DKP+EHWI RGVALLCQL+
Sbjct:   20 CTNSSSLRYNYYIHHGIDTEHVAPMEDSWLENVLKLVPEHLNT-YRESIEMLSDEIREDYLLSVKKAIVDFVLKDPRKKEEYKTSNIPHRAEIEIVPKPWKKSFLVNCNTIKENLNAINPTMAAVLDLWHSSFGQLRLVDTDEFHSRQESMELSIFQNLVTRHIDSAKDKLLKKWFPEIQNIFYQGNKRKQIPSSSNYKKLESFFNCAATLMNGQLQSLALVSIQDYTDLIVQP---------------------PDSVLA--YEHPGFIIRLILDNTSIKFKPDFNEYETALLNVYDMMIKAVNVVPRVETKLYSEWV-NISKSTLKPIIPEEILEKHKWAVKEFVAKESFLPMEHLKLYDKYNFLISKQADLDVDQFLAE---EHTFEEIMREVLKYKALTSEIQYTSRKFIRLGMFELHCDELIRALTKRSEAISGKLVAKMFSVHQEVNKILCDEFERIAEKALSTPSSTHELMDLKAYIAKVEAQHMVEMEQKLVDAKNRLVFLVDYAIFSPSDIRLNNSTFHWHSRMGDIFEEHKRIVKEKTEQFQEELKLRCEKFVEELENCAKQVEEFQSYGDMQEVTKYLKKAQTLNSKLDQAVDKIDQLNAEEEAFGWGASQYPQRKKIQDALNPYLRLYEITSEFNAKYKSWMEGPYTSVNPDLVEQDVGNYWRSLYKLEKTFNESPSALSLTAKIKTKVEEFKEYLPLIQIVCNPGLRDRHWDSMSAIVGYSIKPQEDTNMMKFIEINLQPFLEKFEGISEAASKEFSLEKAMEKMICEWDKIEFGLHPYRETGTYILSSVDDIQMLLDDHLVKTQTMRGSPFIKAFENEIREWESKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRRFSTVDKTWRDLMKQVLLDKHVLTVVTIEKMLEKFKKSNEFLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIANVEFTDVLDITHIKSSEGEVVQLVNTISTSKARGQVEKWLVEVETAMIQSVHKVIGEAIEAYPKTPRIDWVKEWPGQTVLCVSQCFWTQEVQTSIQKGQQALEEYLEKNNKQIDDIVALVRGTLSKQNRVTLGALVVLDVHARDVLASLVKKQVNDENDFEWLSQLRYYWEEGHLQTKMINAGLQYGYEYLGNTPRLVITPLTDRCYRTLFGALNLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINTGSNLLVFEGTELKLNPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVRARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPNEDEEILLLRSIIDVNLPKFLSQDLPLFEGITSDLFPGVKLPKADYQVFMDAIKENCQNMNLQMTSFFSEKILQIYEMMIVRHGFMIVGEPFGGKTSAYRVLAAALNDICEKGLADENKVQITVLNPKSITMGQLYGQFDPVSHEWSDGILAVSYRAFASSTSPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMSLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPIMLSWLNVLPAGLSQMHKKFIEGLFDRMVPPCLQMI-RKCAKELSPTSDTNLVRSLMNLMDCMMDEFSDESLVQNMSEREICSWLEGIFLFSLIWSVGGSCKEDDRVKFDRLLREIIEGPLSEESRTRFKILHPVDPPEKPFTVPIPKENTVYDYKFV--KQD--VGRWELWTEALSSAPSIPREMMFNEIIVPTLDTVRYTELMNLLTTHQKSAVFVGPTGTGKSTYIIDFLLNRLDKETYKPLLINFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKKTVVFVDDVNMPAREVYGAQPPVELLRQWLDHWNWYDLKDCSMIKLVDIQIMCAMGPAGGGRNPITPRFLRHFNTVTINEFDDNSMYTIFSRILDWHLTIRYNFPNEYKALTPQIIHSTMAVYKEALKHLLPTPAKSHYLFNLRDFSRVIQGICLSRPETSDSPLLIKRLWVHEVLRVYFDRLVDNGDRSWLVGYIEEVVKSHMREDFNKLFQHLDFDGDGKVQEDDLRSLMFCDFHDLKREDTNYKEINDVEKLRLVVESHLEEFNNISKKTMNLVLFRFAIEHICRISRILKQPRSHALLVGVGGSGRQSLTRLAVHMADYRLFQVEISKSYGNNEWREDLKLILRKSTEGEMQGVFLFTDSQIKKESFLEDINNLLNAGEVPNLFAVDEKQEICERMRQIDRQRDKTKQTDGSPLALFNLFIDRCRDQLHVVLAMSPIGDAFRDRLRKFPALVNCCTIDWFQPWPEDALQAVATRFLEDVEISEEVRNGCIDMCKSFHTSTINLSDRFRSELQRYNYVTPTSYLELISTFKTLLQKKQTEVMKMKRRYEVGLEKLESASSQVATMQSELEALQPQLKVASKEVDEMMVVIERESIEVAKTEKVVKADEAVANEQAMAAKAIKDECDSDLAQALPILESALAALDTLTAQDITVVKSMKSPPSGVKLVMEAICILKGVKPDKIPDPSGSGKKIEDFWGPAKRVLGEMKFLQSLHEYDKDNIPPAYMNIIRKQYITNAEFVPEKVRNASTAAEGLCKWVIAMDSYDKVAKVVAPKKIKLNQAESELKVAMEGLKKKQAALKEVQDKLAKLEQKLEENKQKKADLENQVDLCSKKLDRAEQLIGGLGGEKTRWSLTAIELGKLYINLIGDILVSSGIVAYQGAFTSSYRQMQTNEWTMLCKSKNIPCSEDFSLANSLGEPVKIRAWNIAGLPSDSFSIDNGIIISNARRWPLMIDPQGQANKWVKNMEKTNSLHVIKLSDPDFVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSVCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQALILQGAENKRQLKEIEDKILEVLSSSEGNILEDETAIKILSSSKALASEISVKQAVAEETEKKIDATRMGYRPIAIHSSILFFSIADLANIEPMYQYSLTWFINLFVMSIDNSEKSEDLQKRLQILKDHFTYSLYENVCRSLFEKDKLLFSFCLTANLMKHEQLIDEEEWKFLLTGGIGLDNPHSNPCTWLPQKSWDEVCRLDNILLFKGIRKDFMRLRDGWKAVYDSLEPHHSTFPPDWQEKL-GQFQRMLMIRCLRPDKIIPMVQEFVSSYLGKPFIEPPPFDLSKAFGDSHCCAPLIFVLSPGADPMAALLKFADDQGFGGGKLSSLSLGQGQGPIALRMTEKAIKEGSWVVLQNCHLATSWMPMLEKVCEELNPDTTHPDFRLWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRSNIIRSYLMDPISDPEFFTSCKKLPEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDMRISVQQLHMFLNQYEEVPYDALQYMTGECNYGGRVTDDWDRRALRSILNKFYNIEMNKNPNYIFDSSGIYYAPPDGDYDSYIEYTKTLPLNSSPEIFGMNANADITKDQSETQQLFDNILLTQSRSSGGGAKSSDEVVFEVSADILSKLPSNFDTESAMRRYPTTYTQSMNTVLVQEMGRFNKLLSTIRDSCINIQKAIKGLVVMSADLEEVVSSILKGKIPGMWMKKSYPSLKPLGSYVSDFLARLKFLQDWYENGTPPVFWLSGFFFTQAFLTGAQQNYARKYTIPIDLLGFDFEVLEDKEYKHAPEDGVYIHGLFLDGARWDRKTKKLGESFPKILYDTVPVMWLKPCKRTDIPNRPCYIAPVYKTSERRGTLSTTGHSTNFVIAMTLPSDKPQEHWIGRGVALLCQLN 3883          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Xenopus
Match: olfm4 (olfactomedin 4 [Source:Xenbase;Acc:XB-GENE-5725072])

HSP 1 Score: 5351.95 bits (13882), Expect = 0.000e+0
Identity = 2646/3891 (68.00%), Postives = 3182/3891 (81.78%), Query Frame = 3
Query:  441 RYYYYIHNGIDTEHVAKMEXXXXXXXXXXXXXXXXAEHPXXXXXXXXXXXXXXXXSVKKAIVDFVLKEPREKETDDTPIPEHRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHI-ITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLD 12110
            RY YYIH+GIDTEHVA MED W+ N+  L+   L   + E +E L DEI+EDYLLSVKKAIVDFVLK+PR+KE   T    HR E+ +VPKPW +SF+      +++L   NP M  VL+LW  SF  LRLVD +EF  ++ ++EL  FQ+   RHI++AK+KL+KKW  ++QNI+YQGNK+K +PS  +   LE FFNCA+TLM   LQ+L L S+ DYT+L+  P                     P   LA   EHPGF++RLIL++T IKF+P   ++ET LLNVYD M+K ++ V R+E++LYS+W  + +K  L PII  EI+EKHK  V+  +  ES  P EH+K +DKY  LI+++ D ++D  L+E    H+FEE  + +  Y  L  +I+Y SR+ IRLGMFEL CDELIRAL+KR++ +  KL+ ++   H++ N+ L  E+E I  KAL  P++T ++M+L  +++  E   M+E+E+KL  +  RL+FL+DYA F+ SD+ LN S FH H+RMG IF+E+K+ +++K E+FQ  LK + E+F+EEL++  KQVEEFQ+ GDM E+ KYLKK+Q L++KL+ A+ +I+  N EEEAFGW  + YP R+++Q+ L PYL+LYE   EFN KYK WMEG    V PD V+ DVGNY+R+L+KLEK F   P    +  K+KTKVEEFKE++PLIQ +  PGLRDRHW  +S IVGY+++ +E   + K I++NL+PF+ KFE ISEAA KEF+LEKAMEKM  EW  +EF +  YRETGT+ILSSVDDIQ++LDDH+VKTQTMRGSPFIK FE EI++WESKL+L+Q+ILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGR+F++VDKTW+++MKQV+ DK VLTV+ IEKML+K KKSNE LE ILKGLN+YLEKKRL+FPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIA++ FT+ LDITH+KSSE E+V L + ISTSKARGQVEKWL+E+E  MI SV   I E +  Y  TPR +WVK+W GQ VL +S  +WT  VQ +I++G +AL+ YL+ NN QID+IVALVRG LSKQNR TL AL+VLDVHARDVL +L+++QV +ENDF WL QLRYYW E ++ TKMIN+ L+YGYEYLGNT RLVITPLTDRCYRTLFGAL+LHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGL SCGAW+CFDEFNRIDLEVLSVVAQQILTIQR I    + L+FEGTELKL+PTCAVFITMNPGYAGRSELPDNLKALFR+VAMMVPDYA+IAEI LYSCGFV ARPL+VKIVATYRLCSEQLSSQ HYDYGMRAVKSVLTAAGNLKLKYP+EDE+IL+LRSIIDVNLPKFL+ DLPLF GI SDLFPGV  P  DY +    IKENC  MNL+ +SFF EKI QIYEMMIVRHGFMIVGEPFGGKTSAY+VLAAAL DICE+GL +ENKVQ T+LNPK+ITMGQLYGQFDPVSHEWSDG+LAVSYRAFA+ST+PDRKWLIFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQ+SP  +LIFEPMDLEVASPATVSRCGM+YMEP  LGWRPI  SWL VLP  ++ +HKK    +F+R +   +  I +   KELSPTSD N+V+SL+NL+DC +D F+DE+ +  M +R+I +WLEG+F F+  WS+G +  E+ R  FD+L RE++ G + EE+R +  ++  V PP + +    P + T+YDY+F+  KQ+   G+WE W+E +    SI ++  FNEIIVPT DTV+YT LMNLL TH K  +FVGPTGTGKS YIIDFLLN+++K+ YKP LINFSAQT+A QTQNIIMSKLD+RRKGVFGPP+GKK +VFVDD+NMP RE YGAQPP+ELLRQWLDHWNWYDLKD + IKL+D+Q + AMGP GGGRNPITPRFLRH NT+TINEF D +M TIFS IL+WH+ I  NF  ++K    Q+I +T+ VYK A+ +LLPTPAKSHYLFNLRDFSRVIQG+ LS P T + P  +KRLW HE+ RVY+DRLV + DR W   YI EV   H+ EDF+ LF+HLDFD DGKV EDD+RSL++CDF D K  +  Y E+ D+E LR  VE +L+E+N +SKK MNLVLFRFAIEH+ RISRILKQPRSHALLVGVGGSGRQSLTRLA  MADY LFQVEISKSY + EWREDLK ILRKSTE +   VFLF+D+QIK+ESFLEDINNLLNAGEVPNL+  DEKQE+CE+MRQIDRQRDK +QTDGSP+AL+N F+ R RDQLH+VLAMSPIGDAFR+RLRKFP+LVNCCTIDWFQ WPEDAL AVATRFLEDVE+ + +++GCID+CK FHTST  LS+++  EL RYNYVTPTSYLELISTFK LL KK+TEV K KRRYEVGLEKL+SA+S ++ MQ EL   QP+L  ASKEVD+ M+++E++S E +K EK+VK +EA+AN+QA AA+AIK+ECD+DLA+A+PILESAL AL+TLT  DIT+V++M SPP GV+LVMEA+C+LKG+KPD++ DPSGSGKKIEDFWGP+KR+LGEMKFL+ L  +DKDNIP   M +IR++Y+TN +F PE++  ASTA EGLCKWV A++ YDKVAKVVAPKKI L +A +E   AM  L KK+AALKEVQDKL  L ++LE NK++K DLEN+VDLCSKKL RAEQLIGGLGGEK RW   A +LG  +INL GDIL+SSG+VAY GAFTSS+R  +T +W      K+IPCS+ FSL  +LG+PV+IR+WNI GLP+D FSI+NGIIISN+RRWPLMIDPQGQANKW+KNMEK N+L VIKL+D DFVR LENCIQFGTPVLLEN+GEELDP+LEPLLLKQTFKQGGS+CI+LGDS IEY+ DFRFYITTKLRNPHYLPETSVKVTLLNFMITPEG+QDQLLGIVV+RERP+LEEEK  LI Q A NK++LKE+ED+IL VLS+SEGNILEDE+AIK+L+SSK L++EI+ KQA  EETE+KID  R+GY PIAIHS+ILFFSIADLANI+PMYQYSLTWFINLF +SIDNSEKSE+LQ+RLQ LK +FTYSLY NVCRSLFEKDKLLFSF L +N++KH+ LI E+EW+FLLTGG+GLDNPH NP  WLP KSWDE+CRLD++ +F GIR+ F+  +D WK +YDS+EPH+   P +W E+L   F +M ++RCLRPDKI+  +Q FV   +GK +IEPPPFDL  +F DS+C +PL+F+LSPGADPMAALLKFADDQGFGGGK  SLSLGQGQGPIA++M ++ IKEG+WV+LQNCHLA SWM +LEK  EELNP+TTHPDFRLWLTSYPS  FPV++LQNGVKMTNE PKGLR NI RSYL DPISD EFF + K L  +KKLL+GLCFFHA+VQERRKFGP+GWNI YEFNETD+RISVQQLHMF++QY+ V YDALQY+TGECNYGGRVTDDWDRR L +IL KFY I++N++P+Y FD SG YYAPPD DY+ YIEY KTLPLN  P +FGM+ NADITKD  ETQ LFD+ILLTQ+R S GG KS+D++V EVSAD+L++LP NFDTE  MR+YPT Y QSMNTVLVQEM RFN LLSTIR S  NI+KAIKGLVVMS+DLEEVV S+LK KIPGMWMKKSYPSLKPLGSYV+DFLARLKFL DW++NG PP+FW+SGF+FTQAFLTG QQNYARKYTIPIDLL FD+E+L+D+ Y  APEDG Y+ GLFLDGARWDRK K + ES PK+L D +PV+WLKP K+++IPN+P Y++P+YKTSERRGTLSTTGHSTNFVIAMTLP+DKP+EHWI RGVALLCQL+
Sbjct:   11 RYNYYIHHGIDTEHVAPMEDSWLENVLKLVPEHLNT-YRESIEMLSDEIREDYLLSVKKAIVDFVLKDPRKKEEYKTSNIPHRAEIEIVPKPWKKSFLVNCNTIKENLNAINPTMAAVLDLWHSSFGQLRLVDTDEFHSRQESMELSIFQNLVTRHIDSAKDKLLKKWFPEIQNIFYQGNKRKQIPSSSNYKKLESFFNCAATLMNGQLQSLALVSIQDYTDLIVQP---------------------PDSVLA--YEHPGFIIRLILDNTSIKFKPDFNEYETALLNVYDMMIKAVNVVPRVETKLYSEWV-NISKSTLKPIIPEEILEKHKWAVKEFVAKESFLPMEHLKLYDKYNFLISKQADLDVDQFLAE---EHTFEEIMREVLKYKALTSEIQYTSRKFIRLGMFELHCDELIRALTKRSEAISGKLVAKMFSVHQEVNKILCDEFERIAEKALSTPSSTHELMDLKAYIAKVEAQHMVEMEQKLVDAKNRLVFLVDYAIFSPSDIRLNNSTFHWHSRMGDIFEEHKRIVKEKTEQFQEELKLRCEKFVEELENCAKQVEEFQSYGDMQEVTKYLKKAQTLNSKLDQAVDKIDQLNAEEEAFGWGASQYPQRKKIQDALNPYLRLYEITSEFNAKYKSWMEGPYTSVNPDLVEQDVGNYWRSLYKLEKTFNESPSALSLTAKIKTKVEEFKEYLPLIQIVCNPGLRDRHWDSMSAIVGYSIKPQEDTNMMKFIEINLQPFLEKFEGISEAASKEFSLEKAMEKMICEWDKIEFGLHPYRETGTYILSSVDDIQMLLDDHLVKTQTMRGSPFIKAFENEIREWESKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRRFSTVDKTWRDLMKQVLLDKHVLTVVTIEKMLEKFKKSNEFLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIANVEFTDVLDITHIKSSEGEVVQLVNTISTSKARGQVEKWLVEVETAMIQSVHKVIGEAIEAYPKTPRIDWVKEWPGQTVLCVSQCFWTQEVQTSIQKGQQALEEYLEKNNKQIDDIVALVRGTLSKQNRVTLGALVVLDVHARDVLASLVKKQVNDENDFEWLSQLRYYWEEGHLQTKMINAGLQYGYEYLGNTPRLVITPLTDRCYRTLFGALNLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINTGSNLLVFEGTELKLNPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVRARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPNEDEEILLLRSIIDVNLPKFLSQDLPLFEGITSDLFPGVKLPKADYQVFMDAIKENCQNMNLQMTSFFSEKILQIYEMMIVRHGFMIVGEPFGGKTSAYRVLAAALNDICEKGLADENKVQITVLNPKSITMGQLYGQFDPVSHEWSDGILAVSYRAFASSTSPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMSLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPIMLSWLNVLPAGLSQMHKKFIEGLFDRMVPPCLQMI-RKCAKELSPTSDTNLVRSLMNLMDCMMDEFSDESLVQNMSEREICSWLEGIFLFSLIWSVGGSCKEDDRVKFDRLLREIIEGPLSEESRTRFKILHPVDPPEKPFTVPIPKENTVYDYKFV--KQD--VGRWELWTEALSSAPSIPREMMFNEIIVPTLDTVRYTELMNLLTTHQKSAVFVGPTGTGKSTYIIDFLLNRLDKETYKPLLINFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKKTVVFVDDVNMPAREVYGAQPPVELLRQWLDHWNWYDLKDCSMIKLVDIQIMCAMGPAGGGRNPITPRFLRHFNTVTINEFDDNSMYTIFSRILDWHLTIRYNFPNEYKALTPQIIHSTMAVYKEALKHLLPTPAKSHYLFNLRDFSRVIQGICLSRPETSDSPLLIKRLWVHEVLRVYFDRLVDNGDRSWLVGYIEEVVKSHMREDFNKLFQHLDFDGDGKVQEDDLRSLMFCDFHDLKREDTNYKEINDVEKLRLVVESHLEEFNNISKKTMNLVLFRFAIEHICRISRILKQPRSHALLVGVGGSGRQSLTRLAVHMADYRLFQVEISKSYGNNEWREDLKLILRKSTEGEMQGVFLFTDSQIKKESFLEDINNLLNAGEVPNLFAVDEKQEICERMRQIDRQRDKTKQTDGSPLALFNLFIDRCRDQLHVVLAMSPIGDAFRDRLRKFPALVNCCTIDWFQPWPEDALQAVATRFLEDVEISEEVRNGCIDMCKSFHTSTINLSDRFRSELQRYNYVTPTSYLELISTFKTLLQKKQTEVMKMKRRYEVGLEKLESASSQVATMQSELEALQPQLKVASKEVDEMMVVIERESIEVAKTEKVVKADEAVANEQAMAAKAIKDECDSDLAQALPILESALAALDTLTAQDITVVKSMKSPPSGVKLVMEAICILKGVKPDKIPDPSGSGKKIEDFWGPAKRVLGEMKFLQSLHEYDKDNIPPAYMNIIRKQYITNAEFVPEKVRNASTAAEGLCKWVIAMDSYDKVAKVVAPKKIKLNQAESELKVAMEGLKKKQAALKEVQDKLAKLEQKLEENKQKKADLENQVDLCSKKLDRAEQLIGGLGGEKTRWSLTAIELGKLYINLIGDILVSSGIVAYQGAFTSSYRQMQTNEWTMLCKSKNIPCSEDFSLANSLGEPVKIRAWNIAGLPSDSFSIDNGIIISNARRWPLMIDPQGQANKWVKNMEKTNSLHVIKLSDPDFVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSVCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQALILQGAENKRQLKEIEDKILEVLSSSEGNILEDETAIKILSSSKALASEISVKQAVAEETEKKIDATRMGYRPIAIHSSILFFSIADLANIEPMYQYSLTWFINLFVMSIDNSEKSEDLQKRLQILKDHFTYSLYENVCRSLFEKDKLLFSFCLTANLMKHEQLIDEEEWKFLLTGGIGLDNPHSNPCTWLPQKSWDEVCRLDNILLFKGIRKDFMRLRDGWKAVYDSLEPHHSTFPPDWQEKL-GQFQRMLMIRCLRPDKIIPMVQEFVSSYLGKPFIEPPPFDLSKAFGDSHCCAPLIFVLSPGADPMAALLKFADDQGFGGGKLSSLSLGQGQGPIALRMTEKAIKEGSWVVLQNCHLATSWMPMLEKVCEELNPDTTHPDFRLWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRSNIIRSYLMDPISDPEFFTSCKKLPEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDMRISVQQLHMFLNQYEEVPYDALQYMTGECNYGGRVTDDWDRRALRSILNKFYNIEMNKNPNYIFDSSGIYYAPPDGDYDSYIEYTKTLPLNSSPEIFGMNANADITKDQSETQQLFDNILLTQSRSSGGGAKSSDEVVFEVSADILSKLPSNFDTESAMRRYPTTYTQSMNTVLVQEMGRFNKLLSTIRDSCINIQKAIKGLVVMSADLEEVVSSILKGKIPGMWMKKSYPSLKPLGSYVSDFLARLKFLQDWYENGTPPVFWLSGFFFTQAFLTGAQQNYARKYTIPIDLLGFDFEVLEDKEYKHAPEDGVYIHGLFLDGARWDRKTKKLGESFPKILYDTVPVMWLKPCKRTDIPNRPCYIAPVYKTSERRGTLSTTGHSTNFVIAMTLPSDKPQEHWIGRGVALLCQLN 3867          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Xenopus
Match: olfm4 (olfactomedin 4 [Source:Xenbase;Acc:XB-GENE-5725072])

HSP 1 Score: 4783.39 bits (12406), Expect = 0.000e+0
Identity = 2375/3419 (69.46%), Postives = 2802/3419 (81.95%), Query Frame = 3
Query: 1893 MLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQ-MDQRDILTWL----------EGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECD--NDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLD 12110
            M+E+E+KL  +  RL+FL+DYA F+ SD+ LN S FH H+RMG IF+E+K+ +++K E+FQ  LK + E+F+EEL++  KQVEEFQ+ GDM E+ KYLKK+Q L++KL+ AI ++   N EEEAFGW  + YP R+++Q+ L PYL+LYE   EFN KYK WMEG    V PD V+ DVGNY+R+L+KLEK F   P    +  K+KTKVEEFKE++PLIQ +  PGLRDRHW  +S IVGY+++ +E   + K I++NL+PF+ KFE ISEAA KEF+LEKAMEKM  EW  +EF +  YRETGT+ILSSVDDIQ++LDDH+VKTQTMRGSPFIK FE EI++WESKL+L+Q+ILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGR+F++VDKTW+++MKQV+ DK VLTV+ IEKML+K KKSNE LE ILKGLN+YLEKKRL+FPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIA++ FT+ LDITH+KSSE E+V L + ISTSKARGQVEKWL+E+E  MI SV   I E +  Y  TPR +WVK+W GQ VL +S  +WT           EAL+ YL+ NN QID+IVALVRG LSKQNR TL AL+VLDVHARDVL +L+++QV +ENDF WL QLRYYW  +++ TKMIN+ L+YGYEYLGNT RLVITPLTDRCYRTLFGAL+LHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGL SCGAW+CFDEFNRIDLEVLSVVAQQILTIQR         +FEGTELKL+PTCAVFITMNPGYAGRSELPDNLKALFR+VAMMVPDYA+IAEI LYSCGFV ARPL+VKIVATYRLCSEQLSSQ HYDYGMRAVKSVLTAAGNLKLKYP+EDE+IL+LRSIIDVNLPKFL+ DLPLF GI SDLFPGV  P  DY +    IKENC  MNL+ +SFF EKI QIYEMMIVRHGFMIVGEPFGGKTSAY+VLAAAL DICE       KVQ T+LNPK+ITMGQLYGQFDPVSHEWSDG+LAVSYRAFA+ST+PDRKWLIFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQ+SP  +LIFEPMDLEVASPATVSRCGM+YMEP  LGWRPI  SWL VLP  ++ +HKK    +F+R +   +  I+K    ELSPTSD N+V+SL+NL+DC +D F+DE+ I + M    +L  L          +G+F F+  WS+G +  E+ R  FD+L RE++ G + EE+R +  +             L+P + T+   + +        G+WE W+E +    SI ++  FNEIIVPT DTV+YT LMNLL TH K  +FVGPTGTGKS YIIDFLLN+++K+ YKP LINFSAQT+A QTQNIIMSKLD+RRKGVFGPP+GKK +VFVDD+NMP RE YGAQPP+ELLRQWLDHWNWYDLKD + IKL+D+Q + AMGP GGGRNPITPRFLRH NT+TINEF D +M TIFS IL+WH+  +            L   T+ VYK A+ +LLPTPAKSHYLFNLRDFSRVIQG+ LS P T + P  +KRLW HE+ RVY+DRLV + DR W   YI EV   H+ EDF+ LF+HLDFD DGKV EDD+RSL++CDF D K  +  Y E+ D+E LR  VE +L+E+N +SKK MNLVLFRFAIEH+ RISRILKQPRSHALLVGVGGSGRQSLTRLA  MADY LFQVEISKSY + EWREDLK ILRKSTE +   VFLF+D+QIK+ESFLEDINNLLNAGEVPNL+  DEKQE+CE+MRQIDRQRDK +QTDGSP+AL+N F+ R RDQLH+VLAMSPIGDAFR+RLRKFP+LVNCCTIDWFQ WPEDAL AVATRFLEDVE+ + +++GCID+CK FHTST  LS+++  EL RYNYVTPTSYLELISTFK LL KK+TEV K KRRYEVGLEKL+SA+S ++ MQ EL   QP+L  ASKEVD+ M+++E++S E +K EK+VK +EA+AN+QA AA+AIK+ECD  N L+++                 DIT+V++M SPP GV+LVMEA+C+LKG+KPD++ DPSGSGKKIEDFWGP+KR+LGEMKFL+ L  +DKDNIP   M +IR++Y+TN +F PE++  ASTA EGLCKWV A++ YDKVAKVVAPKKI L +A +E   AM  L KK+AALKEVQDKL  L ++LE NK++K DLEN+VDLCSKKL RAEQLIGGLGGEK RW   A +LG  +INL GDIL+SSG+VAY GAFTSS+R  +T +W      K+IPCS+ FSL  +LG+PV+IR+WNI GLP+D FSI+NGIIISN+RRWPLMIDPQGQANKW+KNMEK N+L VIKL+D DFVR LENCIQFGTPVLLEN+GEELDP+LEPLLLKQTFKQGGS+CI+LGDS IEY+ DFRFYITTKLRNPHYLPETSVKVTLLNFMITPEG+QDQLLGIVV+RERP+LEEEK  LI Q A NK++LKE+ED+IL VLS+SEGNILEDE+AIK+L+SSK L++EI+ KQA  EETE+KID  R+GY PIAIHS+ILFFSIADLANI+PMYQYSLTWFINLF +SIDNSEKSE+LQ+RLQ LK +FTYSLY NVCRSLFEKDKLLFSF L +N++KH+ LI E+EW+FLLTGG+GLDNPH NP  WLP KSWDE+CRLD++ +F GIR+ F+  +D WK +YDS               L   F +M ++RCLRPDKI+  +Q FV   +GK +IEPPPFDL  +F DS+C +PL+F+LSPGADPMAALLKFADDQGFGGGK  SLSLGQGQGPIA++M ++ IKEG+WV+LQNCHLA SWM +LEK  EELNP+TTHPDFRLWLTSYPS  FPV++LQNGVKMTNE PKGLR NI RSYL DPISD EFF + K L  +KKLL+GLCFFHA+VQERRKFGP+GWNI YEFNETD+RISVQQLHMF++QY+ V YDALQY+TGECNYGGRVTDDWDRR L +IL KFY I++N++P+Y FD SG YYAPPD DY+ YIEY KTLPLN  P +FGM+ NADITKD  ETQ LFD+ILLTQ+R S GG KS+D++V EVSAD+L++LP NFDTE  MR+YPT Y QSMNTVLVQEM RFN LLSTIR S  NI+KAIKGLVVMS+DLEEVV S+LK KIPGMWMKKSYPSLKPLGSYV+DFLARLKFL DW++NG PP+FW+SGF+FTQAFLTG QQNYARKYTIPIDLL FD+E+L+D+ Y  APEDG Y+ GLFLDGARWDRK K + ES PK+L D +PV+WLKP K+++IPN+P Y++P+YKTSERRGTLSTTGHSTNFVIAMTLP+DKP+EHWI RGVALLCQL+
Sbjct:   44 MVEMEQKLVDAKNRLVFLVDYAIFSPSDIRLNNSTFHWHSRMGDIFEEHKRIVKEKTEQFQEELKLRCEKFVEELENCAKQVEEFQSYGDMQEVTKYLKKAQTLNSKLDQAIDQL---NAEEEAFGWGASQYPQRKKIQDALNPYLRLYEITSEFNAKYKSWMEGPYTSVNPDLVEQDVGNYWRSLYKLEKTFNESPSALSLTAKIKTKVEEFKEYLPLIQIVCNPGLRDRHWDSMSAIVGYSIKPQEDTNMMKFIEINLQPFLEKFEGISEAASKEFSLEKAMEKMICEWDKIEFGLHPYRETGTYILSSVDDIQMLLDDHLVKTQTMRGSPFIKAFENEIREWESKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRRFSTVDKTWRDLMKQVLLDKHVLTVVTIEKMLEKFKKSNEFLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIANVEFTDVLDITHIKSSEGEVVQLVNTISTSKARGQVEKWLVEVETAMIQSVHKVIGEAIEAYPKTPRIDWVKEWPGQTVLCVSQCFWT----------QEALEEYLEKNNKQIDDIVALVRGTLSKQNRVTLGALVVLDVHARDVLASLVKKQVNDENDFEWLSQLRYYWEVSHLQTKMINAGLQYGYEYLGNTPRLVITPLTDRCYRTLFGALNLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQR---------VFEGTELKLNPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVRARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPNEDEEILLLRSIIDVNLPKFLSQDLPLFEGITSDLFPGVKLPKADYQVFMDAIKENCQNMNLQMTSFFSEKILQIYEMMIVRHGFMIVGEPFGGKTSAYRVLAAALNDICE-------KVQITVLNPKSITMGQLYGQFDPVSHEWSDGILAVSYRAFASSTSPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMSLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPIMLSWLNVLPAGLSQMHKKFIEGLFDRMVPPCLQMIRKCAK-ELSPTSDTNLVRSLMNLMDCMMDEFSDESTIHEFMKHLSVLLTLIKKQFVFLSFKGIFLFSLIWSVGGSCKEDDRVKFDRLLREIIEGPLSEESRTRFKI-------------LHPSRTTVICLQDV--------GRWELWTEALSSAPSIPREMMFNEIIVPTLDTVRYTELMNLLTTHQKSAVFVGPTGTGKSTYIIDFLLNRLDKETYKPLLINFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKKTVVFVDDVNMPAREVYGAQPPVELLRQWLDHWNWYDLKDCSMIKLVDIQIMCAMGPAGGGRNPITPRFLRHFNTVTINEFDDNSMYTIFSRILDWHLTIRYV----------LTFNTMAVYKEALKHLLPTPAKSHYLFNLRDFSRVIQGICLSRPETSDSPLLIKRLWVHEVLRVYFDRLVDNGDRSWLVGYIEEVVKSHMREDFNKLFQHLDFDGDGKVQEDDLRSLMFCDFHDLKREDTNYKEINDVEKLRLVVESHLEEFNNISKKTMNLVLFRFAIEHICRISRILKQPRSHALLVGVGGSGRQSLTRLAVHMADYRLFQVEISKSYGNNEWREDLKLILRKSTEGEMQGVFLFTDSQIKKESFLEDINNLLNAGEVPNLFAVDEKQEICERMRQIDRQRDKTKQTDGSPLALFNLFIDRCRDQLHVVLAMSPIGDAFRDRLRKFPALVNCCTIDWFQPWPEDALQAVATRFLEDVEISEEVRNGCIDMCKSFHTSTINLSDRFRSELQRYNYVTPTSYLELISTFKTLLQKKQTEVMKMKRRYEVGLEKLESASSQVATMQSELEALQPQLKVASKEVDEMMVVIERESIEVAKTEKVVKADEAVANEQAMAAKAIKDECDTYNPLSKS----------------KDITVVKSMKSPPSGVKLVMEAICILKGVKPDKIPDPSGSGKKIEDFWGPAKRVLGEMKFLQSLHEYDKDNIPPAYMNIIRKQYITNAEFVPEKVRNASTAAEGLCKWVIAMDSYDKVAKVVAPKKIKLNQAESELKVAMEGLKKKQAALKEVQDKLAKLEQKLEENKQKKADLENQVDLCSKKLDRAEQLIGGLGGEKTRWSLTAIELGKLYINLIGDILVSSGIVAYQGAFTSSYRQMQTNEWTMLCKSKNIPCSEDFSLANSLGEPVKIRAWNIAGLPSDSFSIDNGIIISNARRWPLMIDPQGQANKWVKNMEKTNSLHVIKLSDPDFVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSVCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQALILQGAENKRQLKEIEDKILEVLSSSEGNILEDETAIKILSSSKALASEISVKQAVAEETEKKIDATRMGYRPIAIHSSILFFSIADLANIEPMYQYSLTWFINLFVMSIDNSEKSEDLQKRLQILKDHFTYSLYENVCRSLFEKDKLLFSFCLTANLMKHEQLIDEEEWKFLLTGGIGLDNPHSNPCTWLPQKSWDEVCRLDNILLFKGIRKDFMRLRDGWKAVYDS---------------LVSQFQRMLMIRCLRPDKIIPMVQEFVSSYLGKPFIEPPPFDLSKAFGDSHCCAPLIFVLSPGADPMAALLKFADDQGFGGGKLSSLSLGQGQGPIALRMTEKAIKEGSWVVLQNCHLATSWMPMLEKVCEELNPDTTHPDFRLWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRSNIIRSYLMDPISDPEFFTSCKKLPEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDMRISVQQLHMFLNQYEEVPYDALQYMTGECNYGGRVTDDWDRRALRSILNKFYNIEMNKNPNYIFDSSGIYYAPPDGDYDSYIEYTKTLPLNSSPEIFGMNANADITKDQSETQQLFDNILLTQSRSSGGGAKSSDEVVFEVSADILSKLPSNFDTESAMRRYPTTYTQSMNTVLVQEMGRFNKLLSTIRDSCINIQKAIKGLVVMSADLEEVVSSILKGKIPGMWMKKSYPSLKPLGSYVSDFLARLKFLQDWYENGTPPVFWLSGFFFTQAFLTGAQQNYARKYTIPIDLLGFDFEVLEDKEYKHAPEDGVYIHGLFLDGARWDRKTKKLGESFPKILYDTVPVMWLKPCKRTDIPNRPCYIAPVYKTSERRGTLSTTGHSTNFVIAMTLPSDKPQEHWIGRGVALLCQLN 3370          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Xenopus
Match: olfm4 (olfactomedin 4 [Source:Xenbase;Acc:XB-GENE-5725072])

HSP 1 Score: 4680.93 bits (12140), Expect = 0.000e+0
Identity = 2311/3316 (69.69%), Postives = 2724/3316 (82.15%), Query Frame = 3
Query: 2163 MNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLD 12110
            M E+ KYLKK+Q L++KL+ A+ +I+  N EEEAFGW  + YP R+++Q+ L PYL+LYE   EFN KYK WMEG    V PD V+ DVGNY+R+L+KLEK F   P    +  K+KTKVEEFKE++PLIQ +  PGLRDRHW  +S IVGY+++ +E   + K I++NL+PF+ KFE ISEAA KEF+LEKAMEKM  EW  +EF +  YRETGT+ILSSVDDIQ++LDDH+VKTQTMRGSPFIK FE EI++WESKL+L+Q+ILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGR+F++VDKTW+++MKQV+ DK VLTV+ IEKML+K KKSNE LE ILKGLN+YLEKKRL+FPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIA++ FT+ LDITH+KSSE E+V L + ISTSKARGQVEKWL+E+E  MI SV   I E +  Y  TPR +WVK+W GQ VL +S  +WT  VQ +I++G +AL+ YL+ NN QID+IVALVRG LSKQNR TL AL+VLDVHARDVL +L+++QV +ENDF WL QLRYYW E ++ TKMIN+ L+YGYEYLGNT RLVITPLTDRCYRTLFGAL+LHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGL SCGAW+CFDEFNRIDLEVLSVVAQQILTIQR      + L+FEGTELKL+PTCAVFITMNPGYAGRSELPDNLKALFR+VAMMVPDYA+IAEI LYSCGFV ARPL+VKIVATYRLCSEQLSSQ HYDYGMRAVKSVLTAAGNLKLKYP+EDE+IL+LRSIIDVNLPKFL+ DLPLF GI SDLFPGV  P  DY +    IKENC  MNL+ +SFF EKI QIYEMMIVRHGFMIVGEPFGGKTSAY+VLAAAL DICE+GL +ENKVQ T+LNPK+ITMGQLYGQFDPVSHEWSDG+LAVSYRAFA+ST+PDRKWLIFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQ+SP  +LIFEPMDLEVASPATVSRCGM+YMEP  LGWRPI  SWL VLP  ++ +HKK    +F+R +     C++     ELSPTSD N+V+SL+NL+DC +D F+DE+               G+F F+  WS+G +  E+ R  FD+L RE++ G + EE+R +  ++ TV   LQD                         G+WE W+E +    SI ++  FNEIIVPT DTV+YT LMNLL TH K  +FVGPTGTGKS YIIDFLLN+++K+ YKP LINFSAQT+A QTQNIIMSKLD+RRKGVFGPP+GKK +VFVDD+NMP RE YGAQPP+ELLRQWLDHWNWYDLKD + IKL+D+Q + AMGP GGGRNPITPRFLRH NT+TINEF D +M TIFS IL+W+    NF  ++K    Q+I +T+ VYK A+ +LLPTPAKSHYLFNLRDFSRVIQG+ LS P T + P  +KRLW HE+ RVY+DRLV + DR W   YI EV   H+ EDF+ LF+HLDFD DGKV EDD+RSL++CDF D K  +  Y E+ D+E LR  VE +L+E+N +SKK MNLVLFRFAIEH+ RISRILKQPRSHALLVGVGGSGRQSLTRLA  MADY LFQVEISKSY + EWREDLK ILRKSTE +   VFLF+D+QIK+ESFLEDINNLLNAGEVPNL+  DEKQE+CE+MRQIDRQRDK +QTDGSP+AL+N F+ R RDQLH+VLAMSPIGDAFR+RLRKFP+LVNCCTIDWFQ WPEDAL AVATRFLEDVE+ + +++GCID+CK FHTST  LS+++ +  +                               K RYEVGLEKL+SA+S ++ MQ EL   QP+L  ASKEVD+ M+++E++S E +K EK+VK +EA+AN+QA AA+AIK+ECD+DLA+A+PILESAL AL+TLT  DIT+V++M SPP GV+LVMEA+C+LKG+KPD++ DPSGSGKKIEDFWGP+KR+LGEMKFL+ L  +DKDNIP   M +IR++Y+TN +F PE++  ASTA EGLCKWV A++ YDKVAKVVAPKKI L +A +E   AM  L KK+AALKEVQDKL  L ++LE NK++K DLEN+VDLCSKKL RAEQLIGGLGGEK RW   A +LG  +INL GDIL+SSG+VAY GAFTSS+R  +T +W      K+IPCS+ FSL  +LG+PV+IR+WNI GLP+D FSI+NGIIISN+RRWPLMIDPQGQANKW+KNMEK N+L VIKL+D DFVR LENCIQFGTPVLLEN+GEELDP+LEPLLLKQTFKQGGS+CI+LGDS IEY+ DFRFYITTKLRNPHYLPETSVKVTLLNFMITPEG+QDQLLGIVV+RERP+LEEEK  LI Q A NK++LKE+ED+IL VLS+SEGNILEDE+AIK+L+SSK L++EI+ KQA  EETE+KID  R+GY PIAIHS+ILFFSIADLANI+PMYQYSLTWFINLF +SIDNSEKSE+LQ+RLQ LK +FTYSLY NVCRSLFEKDKLLFSF L +N++KH+ L       FLLTGG+GLDNPH NP  WLP KSWDE+CRLD++ +F GIR+ F+  +D WK +YDS+EPH+   P +W E+L   F +M ++RCLRPDKI+  +Q FV   +GK +IEPPPFDL  +F DS+C +PL+F+LSPGADPMAALLKFADDQGFGGGK  SLSLGQGQGPIA++M ++ IKEG+WV+LQNCHLA SWM +LEK  EELNP+TTHPDFRLWLTSYPS  FPV++LQNGVKMTNE PKGLR NI RSYL DPISD EFF + K L     LL+GLCFFHA+VQERRKFGP+GWNI YEFNETD+RISVQQLHMF++QY+ +  + + Y+TGECNYGGRVTDDWDRR L +IL KFY I++N++P+Y FD SG YYAPPD DY+ YIEY KTLPLN  P +FGM+ NADITKD  ETQ LFD+ILLTQ        KS+D++V EVSAD+L++LP NFDTE  MR+YPT Y QSMNTVLVQEM RFN LLSTIR S  NI+KAIKGLVVMS+DLEEVV S+LK KIPGMWMKKSYPSLKPLGSYV+DFLARLKFL DW++NG PP+FW+SGF+FTQAFLTG QQNYARKYTIPIDLL FD+E+L+D+ Y  APEDG Y+ GLFLDGARWDRK K + ES PK+L D +PV+WLKP K+++IPN+P Y++P+YKTSERRGTLSTTGHSTNFVIAMTLP+DKP+EHWI RGVALLCQL+
Sbjct:    1 MQEVTKYLKKAQTLNSKLDQAVDKIDQLNAEEEAFGWGASQYPQRKKIQDALNPYLRLYEITSEFNAKYKSWMEGPYTSVNPDLVEQDVGNYWRSLYKLEKTFNESPSALSLTAKIKTKVEEFKEYLPLIQIVCNPGLRDRHWDSMSAIVGYSIKPQEDTNMMKFIEINLQPFLEKFEGISEAASKEFSLEKAMEKMICEWDKIEFGLHPYRETGTYILSSVDDIQMLLDDHLVKTQTMRGSPFIKAFENEIREWESKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRRFSTVDKTWRDLMKQVLLDKHVLTVVTIEKMLEKFKKSNEFLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIANVEFTDVLDITHIKSSEGEVVQLVNTISTSKARGQVEKWLVEVETAMIQSVHKVIGEAIEAYPKTPRIDWVKEWPGQTVLCVSQCFWTQEVQTSIQKGQQALEEYLEKNNKQIDDIVALVRGTLSKQNRVTLGALVVLDVHARDVLASLVKKQVNDENDFEWLSQLRYYWEEGHLQTKMINAGLQYGYEYLGNTPRLVITPLTDRCYRTLFGALNLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRG----SNLLVFEGTELKLNPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVRARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPNEDEEILLLRSIIDVNLPKFLSQDLPLFEGITSDLFPGVKLPKADYQVFMDAIKENCQNMNLQMTSFFSEKILQIYEMMIVRHGFMIVGEPFGGKTSAYRVLAAALNDICEKGLADENKVQITVLNPKSITMGQLYGQFDPVSHEWSDGILAVSYRAFASSTSPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMSLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPIMLSWLNVLPAGLSQMHKKFIEGLFDRMVPP---CLQMIRKCELSPTSDTNLVRSLMNLMDCMMDEFSDESL--------------GIFLFSLIWSVGGSCKEDDRVKFDRLLREIIEGPLSEESRTRFKILTTVIC-LQD------------------------VGRWELWTEALSSAPSIPREMMFNEIIVPTLDTVRYTELMNLLTTHQKSAVFVGPTGTGKSTYIIDFLLNRLDKETYKPLLINFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKKTVVFVDDVNMPAREVYGAQPPVELLRQWLDHWNWYDLKDCSMIKLVDIQIMCAMGPAGGGRNPITPRFLRHFNTVTINEFDDNSMYTIFSRILDWY----NFPNEYKALTPQIIHSTMAVYKEALKHLLPTPAKSHYLFNLRDFSRVIQGICLSRPETSDSPLLIKRLWVHEVLRVYFDRLVDNGDRSWLVGYIEEVVKSHMREDFNKLFQHLDFDGDGKVQEDDLRSLMFCDFHDLKREDTNYKEINDVEKLRLVVESHLEEFNNISKKTMNLVLFRFAIEHICRISRILKQPRSHALLVGVGGSGRQSLTRLAVHMADYRLFQVEISKSYGNNEWREDLKLILRKSTEGEMQGVFLFTDSQIKKESFLEDINNLLNAGEVPNLFAVDEKQEICERMRQIDRQRDKTKQTDGSPLALFNLFIDRCRDQLHVVLAMSPIGDAFRDRLRKFPALVNCCTIDWFQPWPEDALQAVATRFLEDVEISEEVRNGCIDMCKSFHTSTINLSDRFRICFA-------------------------------KIRYEVGLEKLESASSQVATMQSELEALQPQLKVASKEVDEMMVVIERESIEVAKTEKVVKADEAVANEQAMAAKAIKDECDSDLAQALPILESALAALDTLTAQDITVVKSMKSPPSGVKLVMEAICILKGVKPDKIPDPSGSGKKIEDFWGPAKRVLGEMKFLQSLHEYDKDNIPPAYMNIIRKQYITNAEFVPEKVRNASTAAEGLCKWVIAMDSYDKVAKVVAPKKIKLNQAESELKVAMEGLKKKQAALKEVQDKLAKLEQKLEENKQKKADLENQVDLCSKKLDRAEQLIGGLGGEKTRWSLTAIELGKLYINLIGDILVSSGIVAYQGAFTSSYRQMQTNEWTMLCKSKNIPCSEDFSLANSLGEPVKIRAWNIAGLPSDSFSIDNGIIISNARRWPLMIDPQGQANKWVKNMEKTNSLHVIKLSDPDFVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSVCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQALILQGAENKRQLKEIEDKILEVLSSSEGNILEDETAIKILSSSKALASEISVKQAVAEETEKKIDATRMGYRPIAIHSSILFFSIADLANIEPMYQYSLTWFINLFVMSIDNSEKSEDLQKRLQILKDHFTYSLYENVCRSLFEKDKLLFSFCLTANLMKHEQL-------FLLTGGIGLDNPHSNPCTWLPQKSWDEVCRLDNILLFKGIRKDFMRLRDGWKAVYDSLEPHHSTFPPDWQEKL-GQFQRMLMIRCLRPDKIIPMVQEFVSSYLGKPFIEPPPFDLSKAFGDSHCCAPLIFVLSPGADPMAALLKFADDQGFGGGKLSSLSLGQGQGPIALRMTEKAIKEGSWVVLQNCHLATSWMPMLEKVCEELNPDTTHPDFRLWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRSNIIRSYLMDPISDPEFFTSCKKL-----LLYGLCFFHALVQERRKFGPLGWNIPYEFNETDMRISVQQLHMFLNQYEVIM-NEITYMTGECNYGGRVTDDWDRRALRSILNKFYNIEMNKNPNYIFDSSGIYYAPPDGDYDSYIEYTKTLPLNSSPEIFGMNANADITKDQSETQQLFDNILLTQKTYGGSSTKSSDEVVFEVSADILSKLPSNFDTESAMRRYPTTYTQSMNTVLVQEMGRFNKLLSTIRDSCINIQKAIKGLVVMSADLEEVVSSILKGKIPGMWMKKSYPSLKPLGSYVSDFLARLKFLQDWYENGTPPVFWLSGFFFTQAFLTGAQQNYARKYTIPIDLLGFDFEVLEDKEYKHAPEDGVYIHGLFLDGARWDRKTKKLGESFPKILYDTVPVMWLKPCKRTDIPNRPCYIAPVYKTSERRGTLSTTGHSTNFVIAMTLPSDKPQEHWIGRGVALLCQLN 3221          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Xenopus
Match: olfm4 (olfactomedin 4 [Source:Xenbase;Acc:XB-GENE-5725072])

HSP 1 Score: 4669.76 bits (12111), Expect = 0.000e+0
Identity = 2316/3307 (70.03%), Postives = 2715/3307 (82.10%), Query Frame = 3
Query: 2229 GRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQ-MDQRDILTWL----------EGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECD--NDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLD 12110
            G I+  N EEEAFGW  + YP R+++Q+ L PYL+LYE   EFN KYK WMEG    V PD V+ DVGNY+R+L+KLEK F   P    +  K+KTKVEEFKE++PLIQ +  PGLRDRHW  +S IVGY+++ +E   + K I++NL+PF+ KFE ISEAA KEF+LEKAMEKM  EW  +EF +  YRETGT+ILSSVDDIQ++LDDH+VKTQTMRGSPFIK FE EI++WESKL+L+Q+ILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGR+F++VDKTW+++MKQV+ DK VLTV+ IEKML+K KKSNE LE ILKGLN+YLEKKRL+FPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIA++ FT+ LDITH+KSSE E+V L + ISTSKARGQVEKWL+E+E  MI SV   I E +  Y  TPR +WVK+W GQ VL +S  +WT           EAL+ YL+ NN QID+IVALVRG LSKQNR TL AL+VLDVHARDVL +L+++QV +ENDF WL QLRYYW  +++ TKMIN+ L+YGYEYLGNT RLVITPLTDRCYRTLFGAL+LHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGL SCGAW+CFDEFNRIDLEVLSVVAQQILTIQR         +FEGTELKL+PTCAVFITMNPGYAGRSELPDNLKALFR+VAMMVPDYA+IAEI LYSCGFV ARPL+VKIVATYRLCSEQLSSQ HYDYGMRAVKSVLTAAGNLKLKYP+EDE+IL+LRSIIDVNLPKFL+ DLPLF GI SDLFPGV  P  DY +    IKENC  MNL+ +SFF EKI QIYEMMIVRHGFMIVGEPFGGKTSAY+VLAAAL DICE       KVQ T+LNPK+ITMGQLYGQFDPVSHEWSDG+LAVSYRAFA+ST+PDRKWLIFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQ+SP  +LIFEPMDLEVASPATVSRCGM+YMEP  LGWRPI  SWL VLP  ++ +HKK    +F+R +   +  I+K    ELSPTSD N+V+SL+NL+DC +D F+DE+ I + M    +L  L          +G+F F+  WS+G +  E+ R  FD+L RE++ G + EE+R +  +             L+P + T+   + +        G+WE W+E +    SI ++  FNEIIVPT DTV+YT LMNLL TH K  +FVGPTGTGKS YIIDFLLN+++K+ YKP LINFSAQT+A QTQNIIMSKLD+RRKGVFGPP+GKK +VFVDD+NMP RE YGAQPP+ELLRQWLDHWNWYDLKD + IKL+D+Q + AMGP GGGRNPITPRFLRH NT+TINEF D +M TIFS IL+WH+  +            L   T+ VYK A+ +LLPTPAKSHYLFNLRDFSRVIQG+ LS P T + P  +KRLW HE+ RVY+DRLV + DR W   YI EV   H+ EDF+ LF+HLDFD DGKV EDD+RSL++CDF D K  +  Y E+ D+E LR  VE +L+E+N +SKK MNLVLFRFAIEH+ RISRILKQPRSHALLVGVGGSGRQSLTRLA  MADY LFQVEISKSY + EWREDLK ILRKSTE +   VFLF+D+QIK+ESFLEDINNLLNAGEVPNL+  DEKQE+CE+MRQIDRQRDK +QTDGSP+AL+N F+ R RDQLH+VLAMSPIGDAFR+RLRKFP+LVNCCTIDWFQ WPEDAL AVATRFLEDVE+ + +++GCID+CK FHTST  LS+++  EL RYNYVTPTSYLELISTFK LL KK+TEV K KRRYEVGLEKL+SA+S ++ MQ EL   QP+L  ASKEVD+ M+++E++S E +K EK+VK +EA+AN+QA AA+AIK+ECD  N L+++                 DIT+V++M SPP GV+LVMEA+C+LKG+KPD++ DPSGSGKKIEDFWGP+KR+LGEMKFL+ L  +DKDNIP   M +IR++Y+TN +F PE++  ASTA EGLCKWV A++ YDKVAKVVAPKKI L +A +E   AM  L KK+AALKEVQDKL  L ++LE NK++K DLEN+VDLCSKKL RAEQLIGGLGGEK RW   A +LG  +INL GDIL+SSG+VAY GAFTSS+R  +T +W      K+IPCS+ FSL  +LG+PV+IR+WNI GLP+D FSI+NGIIISN+RRWPLMIDPQGQANKW+KNMEK N+L VIKL+D DFVR LENCIQFGTPVLLEN+GEELDP+LEPLLLKQTFKQGGS+CI+LGDS IEY+ DFRFYITTKLRNPHYLPETSVKVTLLNFMITPEG+QDQLLGIVV+RERP+LEEEK  LI Q A NK++LKE+ED+IL VLS+SEGNILEDE+AIK+L+SSK L++EI+ KQA  EETE+KID  R+GY PIAIHS+ILFFSIADLANI+PMYQYSLTWFINLF +SIDNSEKSE+LQ+RLQ LK +FTYSLY NVCRSLFEKDKLLFSF L +N++KH+ LI E+EW+FLLTGG+GLDNPH NP  WLP KSWDE+CRLD++ +F GIR+ F+  +D WK +YDS               L   F +M ++RCLRPDKI+  +Q FV   +GK +IEPPPFDL  +F DS+C +PL+F+LSPGADPMAALLKFADDQGFGGGK  SLSLGQGQGPIA++M ++ IKEG+WV+LQNCHLA SWM +LEK  EELNP+TTHPDFRLWLTSYPS  FPV++LQNGVKMTNE PKGLR NI RSYL DPISD EFF + K L  +KKLL+GLCFFHA+VQERRKFGP+GWNI YEFNETD+RISVQQLHMF++QY+ V YDALQY+TGECNYGGRVTDDWDRR L +IL KFY I++N++P+Y FD SG YYAPPD DY+ YIEY KTLPLN  P +FGM+ NADITKD  ETQ LFD+ILLTQ+R S GG KS+D++V EVSAD+L++LP NFDTE  MR+YPT Y QSMNTVLVQEM RFN LLSTIR S  NI+KAIKGLVVMS+DLEEVV S+LK KIPGMWMKKSYPSLKPLGSYV+DFLARLKFL DW++NG PP+FW+SGF+FTQAFLTG QQNYARKYTIPIDLL FD+E+L+D+ Y  APEDG Y+ GLFLDGARWDRK K + ES PK+L D +PV+WLKP K+++IPN+P Y++P+YKTSERRGTLSTTGHSTNFVIAMTLP+DKP+EHWI RGVALLCQL+
Sbjct:   25 GIIDQLNAEEEAFGWGASQYPQRKKIQDALNPYLRLYEITSEFNAKYKSWMEGPYTSVNPDLVEQDVGNYWRSLYKLEKTFNESPSALSLTAKIKTKVEEFKEYLPLIQIVCNPGLRDRHWDSMSAIVGYSIKPQEDTNMMKFIEINLQPFLEKFEGISEAASKEFSLEKAMEKMICEWDKIEFGLHPYRETGTYILSSVDDIQMLLDDHLVKTQTMRGSPFIKAFENEIREWESKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRRFSTVDKTWRDLMKQVLLDKHVLTVVTIEKMLEKFKKSNEFLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIANVEFTDVLDITHIKSSEGEVVQLVNTISTSKARGQVEKWLVEVETAMIQSVHKVIGEAIEAYPKTPRIDWVKEWPGQTVLCVSQCFWT----------QEALEEYLEKNNKQIDDIVALVRGTLSKQNRVTLGALVVLDVHARDVLASLVKKQVNDENDFEWLSQLRYYWEVSHLQTKMINAGLQYGYEYLGNTPRLVITPLTDRCYRTLFGALNLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQR---------VFEGTELKLNPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVRARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPNEDEEILLLRSIIDVNLPKFLSQDLPLFEGITSDLFPGVKLPKADYQVFMDAIKENCQNMNLQMTSFFSEKILQIYEMMIVRHGFMIVGEPFGGKTSAYRVLAAALNDICE-------KVQITVLNPKSITMGQLYGQFDPVSHEWSDGILAVSYRAFASSTSPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMSLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPIMLSWLNVLPAGLSQMHKKFIEGLFDRMVPPCLQMIRKCAK-ELSPTSDTNLVRSLMNLMDCMMDEFSDESTIHEFMKHLSVLLTLIKKQFVFLSFKGIFLFSLIWSVGGSCKEDDRVKFDRLLREIIEGPLSEESRTRFKI-------------LHPSRTTVICLQDV--------GRWELWTEALSSAPSIPREMMFNEIIVPTLDTVRYTELMNLLTTHQKSAVFVGPTGTGKSTYIIDFLLNRLDKETYKPLLINFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKKTVVFVDDVNMPAREVYGAQPPVELLRQWLDHWNWYDLKDCSMIKLVDIQIMCAMGPAGGGRNPITPRFLRHFNTVTINEFDDNSMYTIFSRILDWHLTIRYV----------LTFNTMAVYKEALKHLLPTPAKSHYLFNLRDFSRVIQGICLSRPETSDSPLLIKRLWVHEVLRVYFDRLVDNGDRSWLVGYIEEVVKSHMREDFNKLFQHLDFDGDGKVQEDDLRSLMFCDFHDLKREDTNYKEINDVEKLRLVVESHLEEFNNISKKTMNLVLFRFAIEHICRISRILKQPRSHALLVGVGGSGRQSLTRLAVHMADYRLFQVEISKSYGNNEWREDLKLILRKSTEGEMQGVFLFTDSQIKKESFLEDINNLLNAGEVPNLFAVDEKQEICERMRQIDRQRDKTKQTDGSPLALFNLFIDRCRDQLHVVLAMSPIGDAFRDRLRKFPALVNCCTIDWFQPWPEDALQAVATRFLEDVEISEEVRNGCIDMCKSFHTSTINLSDRFRSELQRYNYVTPTSYLELISTFKTLLQKKQTEVMKMKRRYEVGLEKLESASSQVATMQSELEALQPQLKVASKEVDEMMVVIERESIEVAKTEKVVKADEAVANEQAMAAKAIKDECDTYNPLSKS----------------KDITVVKSMKSPPSGVKLVMEAICILKGVKPDKIPDPSGSGKKIEDFWGPAKRVLGEMKFLQSLHEYDKDNIPPAYMNIIRKQYITNAEFVPEKVRNASTAAEGLCKWVIAMDSYDKVAKVVAPKKIKLNQAESELKVAMEGLKKKQAALKEVQDKLAKLEQKLEENKQKKADLENQVDLCSKKLDRAEQLIGGLGGEKTRWSLTAIELGKLYINLIGDILVSSGIVAYQGAFTSSYRQMQTNEWTMLCKSKNIPCSEDFSLANSLGEPVKIRAWNIAGLPSDSFSIDNGIIISNARRWPLMIDPQGQANKWVKNMEKTNSLHVIKLSDPDFVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSVCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQALILQGAENKRQLKEIEDKILEVLSSSEGNILEDETAIKILSSSKALASEISVKQAVAEETEKKIDATRMGYRPIAIHSSILFFSIADLANIEPMYQYSLTWFINLFVMSIDNSEKSEDLQKRLQILKDHFTYSLYENVCRSLFEKDKLLFSFCLTANLMKHEQLIDEEEWKFLLTGGIGLDNPHSNPCTWLPQKSWDEVCRLDNILLFKGIRKDFMRLRDGWKAVYDS---------------LVSQFQRMLMIRCLRPDKIIPMVQEFVSSYLGKPFIEPPPFDLSKAFGDSHCCAPLIFVLSPGADPMAALLKFADDQGFGGGKLSSLSLGQGQGPIALRMTEKAIKEGSWVVLQNCHLATSWMPMLEKVCEELNPDTTHPDFRLWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRSNIIRSYLMDPISDPEFFTSCKKLPEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDMRISVQQLHMFLNQYEEVPYDALQYMTGECNYGGRVTDDWDRRALRSILNKFYNIEMNKNPNYIFDSSGIYYAPPDGDYDSYIEYTKTLPLNSSPEIFGMNANADITKDQSETQQLFDNILLTQSRSSGGGAKSSDEVVFEVSADILSKLPSNFDTESAMRRYPTTYTQSMNTVLVQEMGRFNKLLSTIRDSCINIQKAIKGLVVMSADLEEVVSSILKGKIPGMWMKKSYPSLKPLGSYVSDFLARLKFLQDWYENGTPPVFWLSGFFFTQAFLTGAQQNYARKYTIPIDLLGFDFEVLEDKEYKHAPEDGVYIHGLFLDGARWDRKTKKLGESFPKILYDTVPVMWLKPCKRTDIPNRPCYIAPVYKTSERRGTLSTTGHSTNFVIAMTLPSDKPQEHWIGRGVALLCQLN 3242          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Mouse
Match: Dnah7b (dynein, axonemal, heavy chain 7B [Source:MGI Symbol;Acc:MGI:2684953])

HSP 1 Score: 5263.74 bits (13653), Expect = 0.000e+0
Identity = 2624/4034 (65.05%), Postives = 3196/4034 (79.23%), Query Frame = 3
Query:   87 TKLLPTIPMKRVKPEWAQNPPSFTLDGKQK---------INEDAGIEL----------IYELTAK---PPTKPRKLKGEDLAFERSQLRKDREKFRKALVDMILQGEDRPIKESIETVRLPPLTQEKTPVGMSATEKDILRYYYYIHNGIDTEHVAKMEXXXXXXXXXXXXXXXXAEHPXXXXXXXXXXXXXXXXSVKKAIVDFVLKEPREKETDD--TPIPEHRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVE-TVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIIT-QNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLD 12110
            T +LP +    VKP+W Q  PSF L+ KQ+          NE +  +           +Y++  K   P T   K+K           +K+RE FR  LV +I+Q +     + I+   +P  T        +A EKDI RYYYYI +G+DT+HVA MED W+ ++  L+   LK  +   +  L DEI+EDYLLSVKK+IVDFVLK+PR+K+ D   T +P HR E+ V+PKPW RSF++A  + + HL   NP M  VL+LW  +FK LRLVD+EEF  ++ ++EL +FQ+  ++H+E+AKE L+K W  +VQNIYY+GNKKK +P+ +  A L+ FFNCA+TLMT  LQ+L L SM D+T+L+  P     +                        EHPGF++RLIL+   IKF P   D+  +L+NVY+ M+K++S V R+E++LYS W        L PIIL EII+ HK  +R V++ ESV PTEH+K +DKY+ LI  + +++ID  L + ++   +E   + ++ Y  L ++I+Y SR+++RLGMFE+ C+ELI++L KRA  +C KL+ ++   H++ N  L  E+E+I  KAL +P NT ++ME+   V   E   MLEL ++L  S   L FL++  NF+ +D+ LN SVF  + RMG IFDE++K ++ K E++Q  LKF+ ERF+EEL+SY KQVEEF   GD+ ++ +YLKK+QVL+ KL+AA  +IE FN EEEA+GW  + YP R+++Q+ L PYL+LYETAVEF+ K++ W EG   KV PDQV+ADVGNY+R L+KLEK F + P    +  KV++ VEEFK+++PLIQ +  PGLR RHW+ +S IVG+ L   +   +   IDMNLEPF+ +FE ISEAA KE++LEKAM+KM  EW  MEFV++ YRE+GT+ILSSVDDIQ++LDDHI+KTQTMRGSPFIKP+E ++++WE KL+L+Q+ILDEWLKVQATWLYLEPIFSSPDIM+QMPEEGR+F +VDKTW+++MK V+ DKRVL V+ IE+ML++LKKSNELLE ILKGLN+YLEKKRL+FPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIA + FTETLDITHMKSSE E+V L D IST+KARGQVEKWL+ELE  MI S+   I + +  Y    R  WV+ W GQ VL +S  +WT+ VQ AI +G  AL+ YL   N QID+IV LVRG+LSKQNR TL AL+VLDVHARDVL +L+ +++++++DF WL QLRYYW ENN+ TKMIN+ L+YGYEYLGN+ RLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDY+ALGKFFKGL SCGAW+CFDEFNRIDLEVLSVVAQQILTIQR I A  + L+FEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFR+VAMMVPDYA+IAEI LYSCGFV ARPL++KIVATYRLCSEQLSSQ HY+YGMRAVKSVLTAAGNLKLKYP+E+E+IL+LRSIIDVNLPKFL+HDLPLF GI SDLFPGV  P PDY+ L   I+ENC  MNL+ + FF EKI QIYEMMIVRHGFMIVGEPFGGKTSAY+VLA AL DICE+GLMEENKVQ T+LNPK++TMGQLYGQFD VSHEWSDG+LAVS+RAFA S+TPDRKWLIFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQ+SP  NLIFEPMDLEVASPATVSRCGM+YMEP  LGWRP+  SW+  LP +++ I K+    +F+R +   +  I++    ELSPTSD N+V+SL+NLIDC +D F DE K  + + R+  + LEG+F F+  WS+GAT  ++ R  FDK+ RELM G + + TR K  L+  T     + +   +P KGTIY+Y+FI E    G G+W+ W + +     I KD +F EIIVPT DT++Y+ LM+LL TH KP +FVGPTGTGKS YII+FLLNQ+NKDIYKP ++NFSAQT+A QTQNIIMSKLD+RRKGVFGPP+GK++IVFVDD+NMP RE YGAQPPIELLRQWLDHWNWYDLKD + IKL+D+Q + AMGPPGGGRNPITPR++RH N +TINEF D++M TIFS IL WH+ T   F  DF     Q++  T+ +YK AM NLLPTPAKSHYLFNLRDFSRVIQGV LS P T E    +KRLW HE+ RVYYDRLV + DR W  +YI+E+   ++ EDF  LFK+LDF++DG V EDD+RSL++CDF D K  +  Y E+ +++ LR  VEG+LDEYN MSKKPMNLVLFRFAIEH+SRISRILKQPRSHALLVGVGGSGRQS+TRLAA MADY LFQVEISK Y S EW EDLK ILRK  E D   VFLF+D QIK+ESFLED+NNLLNAGEVPNL+  DEKQE+CEKMRQ+DRQRDK RQTDGSP+AL+N F+ R R+QLH+VLAMSPIGDAFR RLRKFP+LVNCCTIDWFQ+WPEDAL AVA+RFLED+E+ + +++GCID+CK FHTST  LS  +  EL RYNYVTPTSYLELISTFK LL+KKR EV K KRRYEVGL+KL SA+S ++ MQ EL    P+L  AS+EVD+ MII+E++S E +K EKIVK +E +ANDQA AA+AIK+ECD DLAEA+PILESAL AL+TLT  DIT+V++M SPP GV+LVMEA+C+LKGIK D++ DP+GSGKKIEDFWGP+KRLLG+++FL+ L  +DKDNIP   M +IR+ Y+ N DF PE+I  ASTA EGLCKWV A++ YDKVAK+VAPKKI L  A  +   AM  L KK+AAL EVQDKL  L + LE NK++K DLEN+VDLCSKKL RAEQLIGGLGGEK RW  +A +LG  +INLTGDIL+SSGVVAYLGAFTS++R  +T++W     E+ IPCSD +SL+ TLG+ V IR+WNI GLP+D FSI+NGIII N+RRWPLMIDPQGQANKWIKNMEK N+LQ+IKL+D D+VR LENCIQFGTPVLLEN+GEELDP+LEPLLLKQTFKQGGS CI+LGDS IEY+ DFRFYITTKLRNPHYLPETSVKVTLLNFMITPEG+QDQLLGIVV+RERP+LEEEK  LI Q A+NK++LKE+ED+IL VLS SEGNILEDE+AIK+L+SSK L+NEI++KQ   EETE+KID  R+GY  IAIHS+ILFFSIADLANI+PMYQYSLTWFINLF LSI+NSEKS+ L +RLQ L+ +FTYSLY N+CRSLFEKDKLLFSF L  N+L H++ I + EWRFLLTGG+GLDNP+ NP  WLP KSWDE+CRLDDL  F  IR+ F+  KD WKK+YDS+EPH++  P++W  +  D F +M ++RCLRPDK++  +Q F+ +++G+ +IEPPPFDL  +F DSNC +PL+F+LSPGADPM ALLKFADDQG+GG K  SLSLGQGQGPIAMKM+++ +K+GTWV+LQNCHLA SWM  LEK  EEL+ E+THPDFR+WLTSYPS  FPV++LQNGVKMTNE PKGLR NI RSYL DPISD EFFG+ K    +KKLL+GLCFFHA+VQERRKFGP+GWNI YEFNETDLRISVQQLHMF+DQY+ + YDAL+Y+TGECNYGGRVTDDWDRRTL +IL KF+C ++ E+P YKFD SG Y+ PP  D++ YI Y KTLPL P P VFGM+ NADITKD  ETQLLFD+ILLTQ++ S  G KS+D++V+EV+ D+L++LP NFD E  MR+YPT Y QSMNTVLVQEM RFN LL TIR S  NI+KAIKGLVVMS++LEEVV S+L  KIP MWM KSYPSLKPLGSYVNDFL RLKFL  W++ GPPP+FW+SGF+FTQAFLTG QQN+ARK+TIPIDLL FDYE++DD+ Y  APEDG Y+ GLFLDGA W+RK K + ESHPKVL D +PV+WLKP KKS+IP +PSY++P+YKTSERRGTLSTTGHSTNFVIAM LP+D+P+EHWI RGVALLCQL+
Sbjct:   83 TTVLPQLTSTGVKPQWQQIAPSFHLNMKQENPILEPYPVKNEQSFADYMEYFQQKGKQLYQIDDKRSGPSTSRSKVKSP---------QKERENFRSTLVKLIMQQDGDLESDVIDESGIPKAT-------TTAREKDISRYYYYIRHGLDTDHVAPMEDSWLEHVLQLVPQHLKILN-NSIMVLSDEIREDYLLSVKKSIVDFVLKDPRKKDDDGKITELPPHRAEMEVLPKPWRRSFLSACSYIRDHLNAMNPMMLAVLDLWHSTFKKLRLVDIEEFHNRQDSLELSEFQNIVIKHMESAKEMLLKTWFPEVQNIYYKGNKKKQLPTGKSSAKLDSFFNCAATLMTLQLQDLILVSMQDFTDLIAQPPESTRAF-----------------------EHPGFIMRLILDKKTIKFAPDFNDYIDILINVYEIMIKMVSFVPRVETKLYSQWESKSKPTTLKPIILNEIIDTHKEKIREVVLRESVAPTEHLKMYDKYQFLITGKAERDIDEFLFQSQN---YERLIEEIRKYQKLEEEIQYTSRKAVRLGMFEMHCEELIKSLVKRADVICGKLIAKMFRDHQEVNTMLCDEFEKIAEKALSMPLNTAELMEMKAHVQKLETTDMLELRQRLVDSKNCLAFLIECVNFSPADIRLNNSVFQWYGRMGEIFDEHRKIIKDKTEQYQEALKFRCERFVEELESYAKQVEEFHTFGDLLDVQRYLKKAQVLNGKLDAAADKIEQFNAEEEAYGWVPSVYPQRKKIQDGLNPYLRLYETAVEFSTKHRGWTEGPYHKVNPDQVEADVGNYWRGLYKLEKVFHDSPNALAMTKKVQSMVEEFKQYIPLIQVICNPGLRPRHWEAMSTIVGFPLLPSDDSTVFSFIDMNLEPFLDRFEGISEAASKEYSLEKAMDKMMTEWDSMEFVILPYRESGTYILSSVDDIQMLLDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMSQMPEEGRRFKAVDKTWRDVMKTVVQDKRVLAVVTIERMLERLKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIAKVEFTETLDITHMKSSEGEVVELVDTISTAKARGQVEKWLVELERTMIKSIHKVIGDAIAAYTKNSRISWVRDWPGQTVLCVSQTFWTVEVQTAIPKGHRALEGYLAKCNHQIDDIVTLVRGKLSKQNRVTLGALVVLDVHARDVLASLVDKKISDDSDFQWLSQLRYYWQENNLETKMINAGLRYGYEYLGNSPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINAGTELLVFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSIKIVATYRLCSEQLSSQHHYNYGMRAVKSVLTAAGNLKLKYPNENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNELLAAIRENCHTMNLQMTDFFSEKILQIYEMMIVRHGFMIVGEPFGGKTSAYRVLAGALNDICEKGLMEENKVQITVLNPKSVTMGQLYGQFDLVSHEWSDGILAVSFRAFAASSTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPLMVSWINTLPQSVSIIQKEFIEGLFDRMVPLSVEFIRRHTK-ELSPTSDTNLVQSLMNLIDCFMDDFADENKQKERNDRESFSLLEGIFMFSLAWSVGATCTDDDRLKFDKILRELMEGPISDLTRNKFKLLSGTEQTSSKVFIVPFPEKGTIYEYQFIPE----GLGRWDKWIKKLADTPPIPKDVQFIEIIVPTLDTIRYSALMHLLTTHQKPSIFVGPTGTGKSVYIINFLLNQLNKDIYKPLIVNFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKRMIVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSVIKLVDIQIMCAMGPPGGGRNPITPRYMRHFNIVTINEFSDKSMFTIFSRILAWHLRTCYKFPDDFLDLTTQIVNGTMALYKDAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETAENKEAIKRLWVHEVLRVYYDRLVDNADRSWLIHYIQEILKNYMQEDFHDLFKNLDFNQDGTVEEDDLRSLMFCDFHDPKREDFGYREIANVDALRMIVEGHLDEYNNMSKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSLFQVEISKGYGSHEWHEDLKVILRKCAENDMQGVFLFTDTQIKRESFLEDVNNLLNAGEVPNLFALDEKQEICEKMRQLDRQRDKTRQTDGSPIALFNMFIDRCRNQLHVVLAMSPIGDAFRIRLRKFPALVNCCTIDWFQSWPEDALEAVASRFLEDIEMSEEIQEGCIDMCKRFHTSTINLSTSFHNELQRYNYVTPTSYLELISTFKLLLEKKRNEVMKMKRRYEVGLDKLDSASSQVATMQSELEALHPQLKVASREVDEMMIIIERESMEVAKTEKIVKADETVANDQAMAAKAIKDECDADLAEALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAICILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGDIRFLQSLHEYDKDNIPPAYMNIIRKSYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGKLRIAMEGLRKKQAALYEVQDKLAKLQDTLELNKQKKADLENQVDLCSKKLERAEQLIGGLGGEKTRWSNSALELGHLYINLTGDILISSGVVAYLGAFTSNYRQNQTQEWSQSCKERDIPCSDDYSLMGTLGEAVTIRAWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQGQANKWIKNMEKTNSLQLIKLSDPDYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQSLIVQGADNKRQLKEIEDKILEVLSLSEGNILEDETAIKILSSSKSLANEISQKQEVAEETEKKIDNTRMGYRIIAIHSSILFFSIADLANIEPMYQYSLTWFINLFILSIENSEKSDILSKRLQILRDHFTYSLYVNICRSLFEKDKLLFSFCLTVNLLIHENAINKTEWRFLLTGGIGLDNPYTNPCTWLPQKSWDEICRLDDLPAFKTIRREFMRLKDGWKKVYDSMEPHHEMFPEDWENKAND-FQRMLIIRCLRPDKVIPMLQEFIIKKLGRPFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMNALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKDGTWVVLQNCHLATSWMPTLEKVCEELSAESTHPDFRIWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCKKPEEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLDQYEELPYDALRYMTGECNYGGRVTDDWDRRTLRSILNKFFCTELVENPQYKFDSSGIYFVPPSGDHKSYINYTKTLPLIPAPEVFGMNANADITKDQSETQLLFDNILLTQSQSSGSGTKSSDEVVNEVAGDILSKLPNNFDVEAAMRRYPTTYTQSMNTVLVQEMGRFNKLLITIRESCINIQKAIKGLVVMSTELEEVVSSILNVKIPVMWMGKSYPSLKPLGSYVNDFLERLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNFARKFTIPIDLLGFDYEVMDDKEYKNAPEDGVYIHGLFLDGASWNRKTKKLAESHPKVLYDTVPVMWLKPCKKSDIPKRPSYVAPLYKTSERRGTLSTTGHSTNFVIAMILPSDQPKEHWIGRGVALLCQLN 4067          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Mouse
Match: Dnah7a (dynein, axonemal, heavy chain 7A [Source:MGI Symbol;Acc:MGI:2685838])

HSP 1 Score: 5262.58 bits (13650), Expect = 0.000e+0
Identity = 2632/4038 (65.18%), Postives = 3187/4038 (78.93%), Query Frame = 3
Query:   87 TKLLPTIPMKRVKPEWAQNPPSFTLDGKQK---------INEDAGIELIYELTAK-------------PPTKPRKLKGEDLAFERSQLRKDREKFRKALVDMILQGEDRPIKESIETVRLPPLTQEKTPVGMSATEKDILRYYYYIHNGIDTEHVAKMEXXXXXXXXXXXXXXXXAEH----PXXXXXXXXXXXXXXXXSVKKAIVDFVLKEPREKETDD--TPIPEHRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVE-TVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIIT-QNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLD 12110
            T +LP + +  VKP+W Q  PSF L+ KQ+          NE +  E +     K             P T   K+K           +K+RE  R  L  +I+Q +     + I+   +P  T        SATEKDI RYYYYI  G+DT+HVA MED W+ ++  L+      EH       ++ L DEI+EDYLLSVKK+IVDFVLK+PREK+ D   T +P HR E+ V+PKPW RSF++A  + + HL   NP M  VL+LW  +FK LRLVD+EEF   + A+EL +FQ+  ++H+E+AKE L+K W  +VQNI+ QGNKKK +P+ +  A L+ FFNCA+TLMT  LQ+L L SM D+T+L+  P   +ES+                     + EHPGF++RL+L+   IKFEP   ++   L+N+Y+ M+K +S V R+E++LYS W        L PIIL EII+ HK  +R V++ ESV PTEH+K +DKY+ LI  + +++ID LL + ++   +E   + ++ Y  L ++I+Y S++++ LGMFE+ C+ELIR+L KRA  +C KL+ ++   H++ N  L  E+E+I  KAL  P NT ++ME+   V   E   MLEL ++L  S   L FL++  NF+ +D+ LN SVF  + RMG IFDE++K +++K E +Q  LKF+ ERF+EEL+SY KQVEEF   GD+ ++ +YL+K+QVL+ KL+AA  +I+ FN EEEAFGW  + YP R+++Q+ L PYL LYETAVEF+ K++ W EG   KV PDQV+ADVGNY+R L+KLEK F + P    +  KV + VEEFK+++PLIQ    PGLR RHW+ +S IVGY L+  +   +   IDMNLEPF+ +F SISEAA KE++LEKAM+KM  EW  MEFV++ YRE+GT+ILSSVDDIQ++LDDHI+KTQTMRGSPFIKP+E ++++WE KL+L+Q+ILDEWLKVQATWLYLEPIFSS DIM+QMPEEGR+FT+VDKTW+++MK V+ DK+VL V+ IE+ML++LKKSNELLE ILKGLN+YLEKKRL+FPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIA + FTETLDITHMKSSE E+V L D IST+KARGQVEKWL+ELE  MI S+   I + +V Y  T R  WV+ W GQ VL +S  +WT+ VQ AI EG  AL+ YL   N QID+IV LVRG+LSKQNR TL AL+VLDVHARDVL +L+ +++++++DF WL QLRYYW ENN+ TKMIN+ L+YGYEYLGN+ RLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDY+ALGKFFKGL SCGAW+CFDEFNRIDLEVLSVVAQQILTIQR I A  D L+FEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFR+VAMMVPDYA+IAEI LYSCGFV ARPL++KIVATYRLCSEQLSSQ HYDYGMRAVKSVLTAAGNLKLKYP+E+E+IL+LRSIIDVNLPKFL+HDLPLF GI SDLFPGV  P PDY+ L   I++NC  MNL+ + FF EKI QIYEMMIVRHGFMIVGEPFGGKTSAY+VLA AL DICE+GLMEENKVQ T+LNPK++TMGQLYGQFD VSHEWSDGVLAVS+RAFA S+TPDRKWLIFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQ+SP  NLIFEPMDLEVASPATVSRCGM+YMEP  LGWRP+  SW+  LP +++ I K+    +F+R +   +  I++    ELSPTSD N+V+SL+NLIDC +D F DE K  + + R+  + LEG+F F+  WS+GAT  ++ R  FDK+ REL+ G +   TR K  L+  T     + +   +P KGTIYDY+FI E    G G+W+ W + +     I KD +FNEIIVPT DT++Y+ LMNLL TH KP +FVGPTGTGKS YII+FLLNQ+NKDIYKP ++NFSAQT+A QTQNIIMSKLD+RRKGVFGPP+GK++IVFVDD+NMP RE YGAQPPIELLRQWLDHWNWYDLKD + IKL+D+Q + AMGPPGGGRNPITPR++RH N +TINEF +++M TIFS IL WH+ T   F  DF     Q++  T+ +YK AM NLLPTPAKSHYLFNLRDFSRVIQGV LS P T E    +KRLW HE+ RVYYDRLV + DR W  NYI+E+   ++ EDF  LFK+LDF+ DG V EDD+RSL++CDF D K  +  Y E+ +++ LR  VEG+LDEYN MSKKPMNLVLFRFAIEH+SRISRILKQPRSHALLVGVGGSGRQS+TRLAA MADY LFQVEISK Y S EW EDLK ILRK  E+D   VFLF+D QIK+ESFLED+NNLLNAGEVPNL+  DEKQE+CEKMRQIDRQRDK +QTDGSP+AL+N F+   R+QLH+VLAMSPIGDAFR RLRKFP+LVNCCTIDWFQ+WPEDAL AVA+RFLED+E+ + +++GCID+CK FHTST  LS  +  EL RYNYVTPTSYLELISTFK LL+KKR EV K KRRYEVGL+KL SA+S ++ MQ EL    P+L  AS+EVD+ MII+E++S E +K EKIVK +E +ANDQA AA+AIK+ECD DLA A+PILESAL AL+TLT  DIT+V++M SPP GV+LVMEAVC+LKGIK D++ DP+GSGKK EDFWGP+KRLLG+++FL+ L  +DKDNIP   M +IR+ Y+ N DF PE+I  ASTA EGLCKWV A++ YDKVAK+VAPKKI L  A  +   AM  L KK+AAL EVQDKL  L + LE NK++K DLE++VDLCSKKL RAEQLIGGLGGEK RW  +A +LG  +INLTGDIL+SSGVVAYLGAFTS++R  +TKQW     E+ IPCSD +SL+ TLG+ V IR+WNI GLP+D FSI+NGIII N+RRWPLMIDPQGQANKWIKNMEK N+LQ+IKL+D  +VR LENCIQFGTPVLLEN+GEELDP+LEPLLLKQTFKQGGS CI+LGDS IEYS DFRFYITTKLRNPHYLPETSVKVTLLNFMITPEG+QDQLLGIVV+RERP+LEEEK  LI Q A+NK++LKE+ED+IL VLS SEGNILEDE+AIK+L+SSK L+NEI++KQ   EETE+KID  R+GY PIAIHS+ILFFSIADLANI+PMYQYSLTWFINLF LSI+NSEKS+ L +RLQ L+ +FTYSLY N+CRSLFEKDKLLFSF L  N+L HD+ I + EWRFLLTGG+GLDNP+ NP  WLP KSWDE+CRLDDL  F  IR+ F+  KD WKK+YDS+EPH++  P++W  +  D F +M ++RCLRPDK++  +Q F+ +++G+ +IEPPPFDL  +F DSNC +PL+F+LSPGADPM ALLKFADDQG+GG K  SLSLGQGQGPIAMKM+++ +K+GTWV+LQNCHLA SWM  LEK  EEL+ E+THPDFR+WLTSYPS  FPV++LQNGVKMTNE PKGLR NI RSYL DPISD EFFG+ K    +KKLL+GLCFFHA+VQERRKFGP+GWNI YEFNETDLRISVQQLHMF+DQY+ + YDAL+Y+TGECNYGGRVTDDWDRRTL +IL KF+C ++ E+P YKFD SG Y+ PP  D++ YI+Y KTLPL P P VFGM+ NADITKD  ETQLLFD+ILLTQ+  S  G KS+D++V+EV+ D+L +LP NFD E  MR+YPT Y QSMNTVLVQEM RFN LL TIR S  NI+KA+KGLVVMS++LEEVV S+L  KIP MWM KSYPSLKPLGSYVNDFL RLKFL  W++ GPPP+FW+SGF+FTQAFLTG QQNYARK+TIPIDLL FDYE++DD+ Y +APEDG Y+ GLFLDGA WDRK K + ESHPKVL D +PV+WLKP KKS+IP +PSY++P+YKTSERRGTLSTTGHSTNFVIAM LP+  P+EHWI RGVALLCQL+
Sbjct:   39 TTVLPQLSLTGVKPQWQQTAPSFHLNIKQENPVLEPYTVKNEQSFAEYMEHCQKKGKLLDQIDDDRSAPSTSRSKIKSP---------QKERENLRSTLAKVIMQKDGGLESDVIDESGIPKETT-------SATEKDISRYYYYIRQGLDTDHVAPMEDSWLEHVLQLV-----PEHLKVLTNSIKVLSDEIREDYLLSVKKSIVDFVLKDPREKDDDGKITELPPHRAEMEVLPKPWRRSFLSACSYIRDHLNAMNPMMLAVLDLWHSTFKKLRLVDIEEFHSCQDALELSEFQNIVIKHMESAKETLLKTWFPEVQNIFNQGNKKKQLPTGKSTAKLDSFFNCAATLMTLQLQDLILVSMQDFTDLIAQP---LESI--------------------RVFEHPGFIMRLVLDKEAIKFEPEFNEYIDSLINIYEIMIKAVSFVPRVETKLYSQWESKSKPTTLKPIILNEIIDTHKEKIREVILRESVAPTEHLKMYDKYQFLITGKAERDIDELLFQNQN---YERLIEEIRKYQKLGEEIQYTSQKTVCLGMFEMHCEELIRSLVKRADVICGKLIAKMFRDHQEVNTMLCDEFEKIAEKALSTPLNTAELMEMKAHVQKLETTDMLELGQRLVDSKICLAFLIECVNFSPADIRLNKSVFQWYGRMGEIFDEHRKIIKEKTELYQEFLKFRCERFVEELESYAKQVEEFHAFGDLLDVQRYLQKAQVLNGKLDAAADKIDQFNAEEEAFGWVPSAYPQRKKIQDALNPYLHLYETAVEFSTKHRGWTEGPYHKVNPDQVEADVGNYWRGLYKLEKVFHDSPNALAMTKKVHSMVEEFKQYIPLIQVFCNPGLRPRHWEAMSTIVGYPLQPSDDSTVFSFIDMNLEPFLDRFGSISEAASKEYSLEKAMDKMMTEWDSMEFVILPYRESGTYILSSVDDIQMLLDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSRDIMSQMPEEGRRFTAVDKTWRDVMKTVVQDKQVLAVVTIERMLERLKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIAKVEFTETLDITHMKSSEGEVVELVDTISTAKARGQVEKWLVELERTMIKSIHKVIRDAIVAYTKTSRISWVRDWPGQTVLCVSQTFWTVEVQIAIPEGHRALEGYLAKCNHQIDDIVTLVRGKLSKQNRVTLGALVVLDVHARDVLASLVDKKISDDSDFQWLSQLRYYWQENNLETKMINAGLRYGYEYLGNSPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINAGTDLLVFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSIKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPNENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNDLLAAIRDNCHSMNLQMTDFFSEKILQIYEMMIVRHGFMIVGEPFGGKTSAYRVLAGALNDICEKGLMEENKVQITVLNPKSVTMGQLYGQFDLVSHEWSDGVLAVSFRAFAASSTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPLMVSWINTLPQSVSIIQKEFIEGLFDRMVPLSVEFIRRHTK-ELSPTSDTNLVRSLMNLIDCFMDDFADENKQKERNDRESFSLLEGIFLFSLIWSVGATCTDDDRLKFDKILRELLEGPISNLTRNKFKLLSGTEQTSSKVFIVPFPEKGTIYDYQFIPE----GLGRWDKWIKDLADTPPIPKDVQFNEIIVPTLDTIRYSALMNLLTTHQKPSIFVGPTGTGKSVYIINFLLNQLNKDIYKPLIVNFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKRMIVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSVIKLVDIQIMCAMGPPGGGRNPITPRYMRHFNIVTINEFSNKSMFTIFSRILAWHLRTCYKFPDDFLDLTTQIVNGTMALYKDAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETAENKEAIKRLWVHEVLRVYYDRLVDNADRSWLINYIQEILKNYMQEDFHDLFKNLDFNHDGTVEEDDLRSLMFCDFHDPKREDFGYREIANVDALRMIVEGHLDEYNNMSKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSLFQVEISKGYGSHEWHEDLKVILRKCAESDMQGVFLFTDTQIKRESFLEDVNNLLNAGEVPNLFALDEKQEICEKMRQIDRQRDKSKQTDGSPIALFNMFIDCCRNQLHVVLAMSPIGDAFRIRLRKFPALVNCCTIDWFQSWPEDALEAVASRFLEDIEMSEEIREGCIDMCKRFHTSTINLSTSFHNELQRYNYVTPTSYLELISTFKLLLEKKRNEVMKMKRRYEVGLDKLDSASSQVATMQSELEALHPQLKVASREVDEMMIIIERESMEVAKTEKIVKADETVANDQAMAAKAIKDECDADLAGALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAVCILKGIKADKIPDPTGSGKKTEDFWGPAKRLLGDIRFLQSLHEYDKDNIPPAYMNIIRKSYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGKLKVAMEGLRKKQAALHEVQDKLAKLQDTLELNKQKKADLEHQVDLCSKKLERAEQLIGGLGGEKTRWSNSALELGHLYINLTGDILISSGVVAYLGAFTSNYRQNQTKQWSQSCKERDIPCSDDYSLMGTLGEAVTIRAWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQGQANKWIKNMEKTNSLQLIKLSDPSYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYSPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQALILQGADNKRQLKEIEDKILEVLSLSEGNILEDETAIKILSSSKSLANEISQKQEVAEETEKKIDITRMGYRPIAIHSSILFFSIADLANIEPMYQYSLTWFINLFILSIENSEKSDILSKRLQILRDHFTYSLYVNICRSLFEKDKLLFSFCLTVNLLIHDNAINKTEWRFLLTGGIGLDNPYTNPCTWLPQKSWDEICRLDDLPAFKTIREEFMRLKDGWKKVYDSMEPHHEMFPEDWGNKAND-FQRMLIIRCLRPDKVIPMLQEFIIKKLGRSFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMNALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKDGTWVVLQNCHLATSWMPTLEKVCEELSAESTHPDFRIWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCKKPEEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLDQYEELPYDALRYMTGECNYGGRVTDDWDRRTLRSILNKFFCTELVENPQYKFDSSGIYFVPPSGDHKSYIDYTKTLPLIPAPEVFGMNANADITKDQSETQLLFDNILLTQSHSSGSGTKSSDEVVNEVAGDILGKLPNNFDVEAAMRRYPTTYTQSMNTVLVQEMGRFNKLLITIRESCINIQKAVKGLVVMSTELEEVVSSILNVKIPAMWMGKSYPSLKPLGSYVNDFLERLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNYARKFTIPIDLLGFDYEVMDDKEYKKAPEDGVYIHGLFLDGASWDRKTKKLAESHPKVLYDTVPVMWLKPCKKSDIPRRPSYVAPLYKTSERRGTLSTTGHSTNFVIAMILPSVHPKEHWIGRGVALLCQLN 4023          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Mouse
Match: Dnah7b (dynein, axonemal, heavy chain 7B [Source:MGI Symbol;Acc:MGI:2684953])

HSP 1 Score: 5261.43 bits (13647), Expect = 0.000e+0
Identity = 2624/4034 (65.05%), Postives = 3196/4034 (79.23%), Query Frame = 3
Query:   87 TKLLPTIPMKRVKPEWAQNPPSFTLDGKQK---------INEDAGIEL----------IYELTAK---PPTKPRKLKGEDLAFERSQLRKDREKFRKALVDMILQGEDRPIKESIETVRLPPLTQEKTPVGMSATEKDILRYYYYIHNGIDTEHVAKMEXXXXXXXXXXXXXXXXAEHPXXXXXXXXXXXXXXXXSVKKAIVDFVLKEPREKETDD--TPIPEHRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVE-TVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIIT-QNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLD 12110
            T +LP +    VKP+W Q  PSF L+ KQ+          NE +  +           +Y++  K   P T   K+K           +K+RE FR  LV +I+Q +     + I+   +P  T        +A EKDI RYYYYI +G+DT+HVA MED W+ ++  L+   LK  +   +  L DEI+EDYLLSVKK+IVDFVLK+PR+K+ D   T +P HR E+ V+PKPW RSF++A  + + HL   NP M  VL+LW  +FK LRLVD+EEF  ++ ++EL +FQ+  ++H+E+AKE L+K W  +VQNIYY+GNKKK +P+ +  A L+ FFNCA+TLMT  LQ+L L SM D+T+L+  P     +                        EHPGF++RLIL+   IKF P   D+  +L+NVY+ M+K++S V R+E++LYS W        L PIIL EII+ HK  +R V++ ESV PTEH+K +DKY+ LI  + +++ID  L + ++   +E   + ++ Y  L ++I+Y SR+++RLGMFE+ C+ELI++L KRA  +C KL+ ++   H++ N  L  E+E+I  KAL +P NT ++ME+   V   E   MLEL ++L  S   L FL++  NF+ +D+ LN SVF  + RMG IFDE++K ++ K E++Q  LKF+ ERF+EEL+SY KQVEEF   GD+ ++ +YLKK+QVL+ KL+AA  +IE FN EEEA+GW  + YP R+++Q+ L PYL+LYETAVEF+ K++ W EG   KV PDQV+ADVGNY+R L+KLEK F + P    +  KV++ VEEFK+++PLIQ +  PGLR RHW+ +S IVG+ L   +   +   IDMNLEPF+ +FE ISEAA KE++LEKAM+KM  EW  MEFV++ YRE+GT+ILSSVDDIQ++LDDHI+KTQTMRGSPFIKP+E ++++WE KL+L+Q+ILDEWLKVQATWLYLEPIFSSPDIM+QMPEEGR+F +VDKTW+++MK V+ DKRVL V+ IE+ML++LKKSNELLE ILKGLN+YLEKKRL+FPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIA + FTETLDITHMKSSE E+V L D IST+KARGQVEKWL+ELE  MI S+   I + +  Y    R  WV+ W GQ VL +S  +WT+ VQ AI +G  AL+ YL   N QID+IV LVRG+LSKQNR TL AL+VLDVHARDVL +L+ +++++++DF WL QLRYYW ENN+ TKMIN+ L+YGYEYLGN+ RLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDY+ALGKFFKGL SCGAW+CFDEFNRIDLEVLSVVAQQILTIQR I A  + L+FEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFR+VAMMVPDYA+IAEI LYSCGFV ARPL++KIVATYRLCSEQLSSQ HY+YGMRAVKSVLTAAGNLKLKYP+E+E+IL+LRSIIDVNLPKFL+HDLPLF GI SDLFPGV  P PDY+ L   I+ENC  MNL+ + FF EKI QIYEMMIVRHGFMIVGEPFGGKTSAY+VLA AL DICE+GLMEENKVQ T+LNPK++TMGQLYGQFD VSHEWSDG+LAVS+RAFA S+TPDRKWLIFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQ+SP  NLIFEPMDLEVASPATVSRCGM+YMEP  LGWRP+  SW+  LP +++ I K+    +F+R +   +  I++    ELSPTSD N+V+SL+NLIDC +D F DE K  + + R+  + LEG+F F+  WS+GAT  ++ R  FDK+ RELM G + + TR K  L+  T     + +   +P KGTIY+Y+FI E    G G+W+ W + +     I KD +F EIIVPT DT++Y+ LM+LL TH KP +FVGPTGTGKS YII+FLLNQ+NKDIYKP ++NFSAQT+A QTQNIIMSKLD+RRKGVFGPP+GK++IVFVDD+NMP RE YGAQPPIELLRQWLDHWNWYDLKD + IKL+D+Q + AMGPPGGGRNPITPR++RH N +TINEF D++M TIFS IL WH+ T   F  DF     Q++  T+ +YK AM NLLPTPAKSHYLFNLRDFSRVIQGV LS P T E    +KRLW HE+ RVYYDRLV + DR W  +YI+E+   ++ EDF  LFK+LDF++DG V EDD+RSL++CDF D K  +  Y E+ +++ LR  VEG+LDEYN MSKKPMNLVLFRFAIEH+SRISRILKQPRSHALLVGVGGSGRQS+TRLAA MADY LFQVEISK Y S EW EDLK ILRK  E D   VFLF+D QIK+ESFLED+NNLLNAGEVPNL+  DEKQE+CEKMRQ+DRQRDK RQTDGSP+AL+N F+ R R+QLH+VLAMSPIGDAFR RLRKFP+LVNCCTIDWFQ+WPEDAL AVA+RFLED+E+ + +++GCID+CK FHTST  LS  +  EL RYNYVTPTSYLELISTFK LL+KKR EV K KRRYEVGL+KL SA+S ++ MQ EL    P+L  AS+EVD+ MII+E++S E +K EKIVK +E +ANDQA AA+AIK+ECD DLAEA+PILESAL AL+TLT  DIT+V++M SPP GV+LVMEA+C+LKGIK D++ DP+GSGKKIEDFWGP+KRLLG+++FL+ L  +DKDNIP   M +IR+ Y+ N DF PE+I  ASTA EGLCKWV A++ YDKVAK+VAPKKI L  A  +   AM  L KK+AAL EVQDKL  L + LE NK++K DLEN+VDLCSKKL RAEQLIGGLGGEK RW  +A +LG  +INLTGDIL+SSGVVAYLGAFTS++R  +T++W     E+ IPCSD +SL+ TLG+ V IR+WNI GLP+D FSI+NGIII N+RRWPLMIDPQGQANKWIKNMEK N+LQ+IKL+D D+VR LENCIQFGTPVLLEN+GEELDP+LEPLLLKQTFKQGGS CI+LGDS IEY+ DFRFYITTKLRNPHYLPETSVKVTLLNFMITPEG+QDQLLGIVV+RERP+LEEEK  LI Q A+NK++LKE+ED+IL VLS SEGNILEDE+AIK+L+SSK L+NEI++KQ   EETE+KID  R+GY  IAIHS+ILFFSIADLANI+PMYQYSLTWFINLF LSI+NSEKS+ L +RLQ L+ +FTYSLY N+CRSLFEKDKLLFSF L  N+L H++ I + EWRFLLTGG+GLDNP+ NP  WLP KSWDE+CRLDDL  F  IR+ F+  KD WKK+YDS+EPH++  P++W  +  D F +M ++RCLRPDK++  +Q F+ +++G+ +IEPPPFDL  +F DSNC +PL+F+LSPGADPM ALLKFADDQG+GG K  SLSLGQGQGPIAMKM+++ +K+GTWV+LQNCHLA SWM  LEK  EEL+ E+THPDFR+WLTSYPS  FPV++LQNGVKMTNE PKGLR NI RSYL DPISD EFFG+ K    +KKLL+GLCFFHA+VQERRKFGP+GWNI YEFNETDLRISVQQLHMF+DQY+ + YDAL+Y+TGECNYGGRVTDDWDRRTL +IL KF+C ++ E+P YKFD SG Y+ PP  D++ YI Y KTLPL P P VFGM+ NADITKD  ETQLLFD+ILLTQ++ S  G KS+D++V+EV+ D+L++LP NFD E  MR+YPT Y QSMNTVLVQEM RFN LL TIR S  NI+KAIKGLVVMS++LEEVV S+L  KIP MWM KSYPSLKPLGSYVNDFL RLKFL  W++ GPPP+FW+SGF+FTQAFLTG QQN+ARK+TIPIDLL FDYE++DD+ Y  APEDG Y+ GLFLDGA W+RK K + ESHPKVL D +PV+WLKP KKS+IP +PSY++P+YKTSERRGTLSTTGHSTNFVIAM LP+D+P+EHWI RGVALLCQL+
Sbjct:   39 TTVLPQLTSTGVKPQWQQIAPSFHLNMKQENPILEPYPVKNEQSFADYMEYFQQKGKQLYQIDDKRSGPSTSRSKVKSP---------QKERENFRSTLVKLIMQQDGDLESDVIDESGIPKAT-------TTAREKDISRYYYYIRHGLDTDHVAPMEDSWLEHVLQLVPQHLKILN-NSIMVLSDEIREDYLLSVKKSIVDFVLKDPRKKDDDGKITELPPHRAEMEVLPKPWRRSFLSACSYIRDHLNAMNPMMLAVLDLWHSTFKKLRLVDIEEFHNRQDSLELSEFQNIVIKHMESAKEMLLKTWFPEVQNIYYKGNKKKQLPTGKSSAKLDSFFNCAATLMTLQLQDLILVSMQDFTDLIAQPPESTRAF-----------------------EHPGFIMRLILDKKTIKFAPDFNDYIDILINVYEIMIKMVSFVPRVETKLYSQWESKSKPTTLKPIILNEIIDTHKEKIREVVLRESVAPTEHLKMYDKYQFLITGKAERDIDEFLFQSQN---YERLIEEIRKYQKLEEEIQYTSRKAVRLGMFEMHCEELIKSLVKRADVICGKLIAKMFRDHQEVNTMLCDEFEKIAEKALSMPLNTAELMEMKAHVQKLETTDMLELRQRLVDSKNCLAFLIECVNFSPADIRLNNSVFQWYGRMGEIFDEHRKIIKDKTEQYQEALKFRCERFVEELESYAKQVEEFHTFGDLLDVQRYLKKAQVLNGKLDAAADKIEQFNAEEEAYGWVPSVYPQRKKIQDGLNPYLRLYETAVEFSTKHRGWTEGPYHKVNPDQVEADVGNYWRGLYKLEKVFHDSPNALAMTKKVQSMVEEFKQYIPLIQVICNPGLRPRHWEAMSTIVGFPLLPSDDSTVFSFIDMNLEPFLDRFEGISEAASKEYSLEKAMDKMMTEWDSMEFVILPYRESGTYILSSVDDIQMLLDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMSQMPEEGRRFKAVDKTWRDVMKTVVQDKRVLAVVTIERMLERLKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIAKVEFTETLDITHMKSSEGEVVELVDTISTAKARGQVEKWLVELERTMIKSIHKVIGDAIAAYTKNSRISWVRDWPGQTVLCVSQTFWTVEVQTAIPKGHRALEGYLAKCNHQIDDIVTLVRGKLSKQNRVTLGALVVLDVHARDVLASLVDKKISDDSDFQWLSQLRYYWQENNLETKMINAGLRYGYEYLGNSPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINAGTELLVFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSIKIVATYRLCSEQLSSQHHYNYGMRAVKSVLTAAGNLKLKYPNENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNELLAAIRENCHTMNLQMTDFFSEKILQIYEMMIVRHGFMIVGEPFGGKTSAYRVLAGALNDICEKGLMEENKVQITVLNPKSVTMGQLYGQFDLVSHEWSDGILAVSFRAFAASSTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPLMVSWINTLPQSVSIIQKEFIEGLFDRMVPLSVEFIRRHTK-ELSPTSDTNLVQSLMNLIDCFMDDFADENKQKERNDRESFSLLEGIFMFSLAWSVGATCTDDDRLKFDKILRELMEGPISDLTRNKFKLLSGTEQTSSKVFIVPFPEKGTIYEYQFIPE----GLGRWDKWIKKLADTPPIPKDVQFIEIIVPTLDTIRYSALMHLLTTHQKPSIFVGPTGTGKSVYIINFLLNQLNKDIYKPLIVNFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKRMIVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSVIKLVDIQIMCAMGPPGGGRNPITPRYMRHFNIVTINEFSDKSMFTIFSRILAWHLRTCYKFPDDFLDLTTQIVNGTMALYKDAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETAENKEAIKRLWVHEVLRVYYDRLVDNADRSWLIHYIQEILKNYMQEDFHDLFKNLDFNQDGTVEEDDLRSLMFCDFHDPKREDFGYREIANVDALRMIVEGHLDEYNNMSKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSLFQVEISKGYGSHEWHEDLKVILRKCAENDMQGVFLFTDTQIKRESFLEDVNNLLNAGEVPNLFALDEKQEICEKMRQLDRQRDKTRQTDGSPIALFNMFIDRCRNQLHVVLAMSPIGDAFRIRLRKFPALVNCCTIDWFQSWPEDALEAVASRFLEDIEMSEEIQEGCIDMCKRFHTSTINLSTSFHNELQRYNYVTPTSYLELISTFKLLLEKKRNEVMKMKRRYEVGLDKLDSASSQVATMQSELEALHPQLKVASREVDEMMIIIERESMEVAKTEKIVKADETVANDQAMAAKAIKDECDADLAEALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAICILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGDIRFLQSLHEYDKDNIPPAYMNIIRKSYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGKLRIAMEGLRKKQAALYEVQDKLAKLQDTLELNKQKKADLENQVDLCSKKLERAEQLIGGLGGEKTRWSNSALELGHLYINLTGDILISSGVVAYLGAFTSNYRQNQTQEWSQSCKERDIPCSDDYSLMGTLGEAVTIRAWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQGQANKWIKNMEKTNSLQLIKLSDPDYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQSLIVQGADNKRQLKEIEDKILEVLSLSEGNILEDETAIKILSSSKSLANEISQKQEVAEETEKKIDNTRMGYRIIAIHSSILFFSIADLANIEPMYQYSLTWFINLFILSIENSEKSDILSKRLQILRDHFTYSLYVNICRSLFEKDKLLFSFCLTVNLLIHENAINKTEWRFLLTGGIGLDNPYTNPCTWLPQKSWDEICRLDDLPAFKTIRREFMRLKDGWKKVYDSMEPHHEMFPEDWENKAND-FQRMLIIRCLRPDKVIPMLQEFIIKKLGRPFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMNALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKDGTWVVLQNCHLATSWMPTLEKVCEELSAESTHPDFRIWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCKKPEEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLDQYEELPYDALRYMTGECNYGGRVTDDWDRRTLRSILNKFFCTELVENPQYKFDSSGIYFVPPSGDHKSYINYTKTLPLIPAPEVFGMNANADITKDQSETQLLFDNILLTQSQSSGSGTKSSDEVVNEVAGDILSKLPNNFDVEAAMRRYPTTYTQSMNTVLVQEMGRFNKLLITIRESCINIQKAIKGLVVMSTELEEVVSSILNVKIPVMWMGKSYPSLKPLGSYVNDFLERLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNFARKFTIPIDLLGFDYEVMDDKEYKNAPEDGVYIHGLFLDGASWNRKTKKLAESHPKVLYDTVPVMWLKPCKKSDIPKRPSYVAPLYKTSERRGTLSTTGHSTNFVIAMILPSDQPKEHWIGRGVALLCQLN 4023          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Mouse
Match: Dnah7b (dynein, axonemal, heavy chain 7B [Source:MGI Symbol;Acc:MGI:2684953])

HSP 1 Score: 5261.43 bits (13647), Expect = 0.000e+0
Identity = 2624/4034 (65.05%), Postives = 3196/4034 (79.23%), Query Frame = 3
Query:   87 TKLLPTIPMKRVKPEWAQNPPSFTLDGKQK---------INEDAGIEL----------IYELTAK---PPTKPRKLKGEDLAFERSQLRKDREKFRKALVDMILQGEDRPIKESIETVRLPPLTQEKTPVGMSATEKDILRYYYYIHNGIDTEHVAKMEXXXXXXXXXXXXXXXXAEHPXXXXXXXXXXXXXXXXSVKKAIVDFVLKEPREKETDD--TPIPEHRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVE-TVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIIT-QNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLD 12110
            T +LP +    VKP+W Q  PSF L+ KQ+          NE +  +           +Y++  K   P T   K+K           +K+RE FR  LV +I+Q +     + I+   +P  T        +A EKDI RYYYYI +G+DT+HVA MED W+ ++  L+   LK  +   +  L DEI+EDYLLSVKK+IVDFVLK+PR+K+ D   T +P HR E+ V+PKPW RSF++A  + + HL   NP M  VL+LW  +FK LRLVD+EEF  ++ ++EL +FQ+  ++H+E+AKE L+K W  +VQNIYY+GNKKK +P+ +  A L+ FFNCA+TLMT  LQ+L L SM D+T+L+  P     +                        EHPGF++RLIL+   IKF P   D+  +L+NVY+ M+K++S V R+E++LYS W        L PIIL EII+ HK  +R V++ ESV PTEH+K +DKY+ LI  + +++ID  L + ++   +E   + ++ Y  L ++I+Y SR+++RLGMFE+ C+ELI++L KRA  +C KL+ ++   H++ N  L  E+E+I  KAL +P NT ++ME+   V   E   MLEL ++L  S   L FL++  NF+ +D+ LN SVF  + RMG IFDE++K ++ K E++Q  LKF+ ERF+EEL+SY KQVEEF   GD+ ++ +YLKK+QVL+ KL+AA  +IE FN EEEA+GW  + YP R+++Q+ L PYL+LYETAVEF+ K++ W EG   KV PDQV+ADVGNY+R L+KLEK F + P    +  KV++ VEEFK+++PLIQ +  PGLR RHW+ +S IVG+ L   +   +   IDMNLEPF+ +FE ISEAA KE++LEKAM+KM  EW  MEFV++ YRE+GT+ILSSVDDIQ++LDDHI+KTQTMRGSPFIKP+E ++++WE KL+L+Q+ILDEWLKVQATWLYLEPIFSSPDIM+QMPEEGR+F +VDKTW+++MK V+ DKRVL V+ IE+ML++LKKSNELLE ILKGLN+YLEKKRL+FPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIA + FTETLDITHMKSSE E+V L D IST+KARGQVEKWL+ELE  MI S+   I + +  Y    R  WV+ W GQ VL +S  +WT+ VQ AI +G  AL+ YL   N QID+IV LVRG+LSKQNR TL AL+VLDVHARDVL +L+ +++++++DF WL QLRYYW ENN+ TKMIN+ L+YGYEYLGN+ RLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDY+ALGKFFKGL SCGAW+CFDEFNRIDLEVLSVVAQQILTIQR I A  + L+FEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFR+VAMMVPDYA+IAEI LYSCGFV ARPL++KIVATYRLCSEQLSSQ HY+YGMRAVKSVLTAAGNLKLKYP+E+E+IL+LRSIIDVNLPKFL+HDLPLF GI SDLFPGV  P PDY+ L   I+ENC  MNL+ + FF EKI QIYEMMIVRHGFMIVGEPFGGKTSAY+VLA AL DICE+GLMEENKVQ T+LNPK++TMGQLYGQFD VSHEWSDG+LAVS+RAFA S+TPDRKWLIFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQ+SP  NLIFEPMDLEVASPATVSRCGM+YMEP  LGWRP+  SW+  LP +++ I K+    +F+R +   +  I++    ELSPTSD N+V+SL+NLIDC +D F DE K  + + R+  + LEG+F F+  WS+GAT  ++ R  FDK+ RELM G + + TR K  L+  T     + +   +P KGTIY+Y+FI E    G G+W+ W + +     I KD +F EIIVPT DT++Y+ LM+LL TH KP +FVGPTGTGKS YII+FLLNQ+NKDIYKP ++NFSAQT+A QTQNIIMSKLD+RRKGVFGPP+GK++IVFVDD+NMP RE YGAQPPIELLRQWLDHWNWYDLKD + IKL+D+Q + AMGPPGGGRNPITPR++RH N +TINEF D++M TIFS IL WH+ T   F  DF     Q++  T+ +YK AM NLLPTPAKSHYLFNLRDFSRVIQGV LS P T E    +KRLW HE+ RVYYDRLV + DR W  +YI+E+   ++ EDF  LFK+LDF++DG V EDD+RSL++CDF D K  +  Y E+ +++ LR  VEG+LDEYN MSKKPMNLVLFRFAIEH+SRISRILKQPRSHALLVGVGGSGRQS+TRLAA MADY LFQVEISK Y S EW EDLK ILRK  E D   VFLF+D QIK+ESFLED+NNLLNAGEVPNL+  DEKQE+CEKMRQ+DRQRDK RQTDGSP+AL+N F+ R R+QLH+VLAMSPIGDAFR RLRKFP+LVNCCTIDWFQ+WPEDAL AVA+RFLED+E+ + +++GCID+CK FHTST  LS  +  EL RYNYVTPTSYLELISTFK LL+KKR EV K KRRYEVGL+KL SA+S ++ MQ EL    P+L  AS+EVD+ MII+E++S E +K EKIVK +E +ANDQA AA+AIK+ECD DLAEA+PILESAL AL+TLT  DIT+V++M SPP GV+LVMEA+C+LKGIK D++ DP+GSGKKIEDFWGP+KRLLG+++FL+ L  +DKDNIP   M +IR+ Y+ N DF PE+I  ASTA EGLCKWV A++ YDKVAK+VAPKKI L  A  +   AM  L KK+AAL EVQDKL  L + LE NK++K DLEN+VDLCSKKL RAEQLIGGLGGEK RW  +A +LG  +INLTGDIL+SSGVVAYLGAFTS++R  +T++W     E+ IPCSD +SL+ TLG+ V IR+WNI GLP+D FSI+NGIII N+RRWPLMIDPQGQANKWIKNMEK N+LQ+IKL+D D+VR LENCIQFGTPVLLEN+GEELDP+LEPLLLKQTFKQGGS CI+LGDS IEY+ DFRFYITTKLRNPHYLPETSVKVTLLNFMITPEG+QDQLLGIVV+RERP+LEEEK  LI Q A+NK++LKE+ED+IL VLS SEGNILEDE+AIK+L+SSK L+NEI++KQ   EETE+KID  R+GY  IAIHS+ILFFSIADLANI+PMYQYSLTWFINLF LSI+NSEKS+ L +RLQ L+ +FTYSLY N+CRSLFEKDKLLFSF L  N+L H++ I + EWRFLLTGG+GLDNP+ NP  WLP KSWDE+CRLDDL  F  IR+ F+  KD WKK+YDS+EPH++  P++W  +  D F +M ++RCLRPDK++  +Q F+ +++G+ +IEPPPFDL  +F DSNC +PL+F+LSPGADPM ALLKFADDQG+GG K  SLSLGQGQGPIAMKM+++ +K+GTWV+LQNCHLA SWM  LEK  EEL+ E+THPDFR+WLTSYPS  FPV++LQNGVKMTNE PKGLR NI RSYL DPISD EFFG+ K    +KKLL+GLCFFHA+VQERRKFGP+GWNI YEFNETDLRISVQQLHMF+DQY+ + YDAL+Y+TGECNYGGRVTDDWDRRTL +IL KF+C ++ E+P YKFD SG Y+ PP  D++ YI Y KTLPL P P VFGM+ NADITKD  ETQLLFD+ILLTQ++ S  G KS+D++V+EV+ D+L++LP NFD E  MR+YPT Y QSMNTVLVQEM RFN LL TIR S  NI+KAIKGLVVMS++LEEVV S+L  KIP MWM KSYPSLKPLGSYVNDFL RLKFL  W++ GPPP+FW+SGF+FTQAFLTG QQN+ARK+TIPIDLL FDYE++DD+ Y  APEDG Y+ GLFLDGA W+RK K + ESHPKVL D +PV+WLKP KKS+IP +PSY++P+YKTSERRGTLSTTGHSTNFVIAM LP+D+P+EHWI RGVALLCQL+
Sbjct:   39 TTVLPQLTSTGVKPQWQQIAPSFHLNMKQENPILEPYPVKNEQSFADYMEYFQQKGKQLYQIDDKRSGPSTSRSKVKSP---------QKERENFRSTLVKLIMQQDGDLESDVIDESGIPKAT-------TTAREKDISRYYYYIRHGLDTDHVAPMEDSWLEHVLQLVPQHLKILN-NSIMVLSDEIREDYLLSVKKSIVDFVLKDPRKKDDDGKITELPPHRAEMEVLPKPWRRSFLSACSYIRDHLNAMNPMMLAVLDLWHSTFKKLRLVDIEEFHNRQDSLELSEFQNIVIKHMESAKEMLLKTWFPEVQNIYYKGNKKKQLPTGKSSAKLDSFFNCAATLMTLQLQDLILVSMQDFTDLIAQPPESTRAF-----------------------EHPGFIMRLILDKKTIKFAPDFNDYIDILINVYEIMIKMVSFVPRVETKLYSQWESKSKPTTLKPIILNEIIDTHKEKIREVVLRESVAPTEHLKMYDKYQFLITGKAERDIDEFLFQSQN---YERLIEEIRKYQKLEEEIQYTSRKAVRLGMFEMHCEELIKSLVKRADVICGKLIAKMFRDHQEVNTMLCDEFEKIAEKALSMPLNTAELMEMKAHVQKLETTDMLELRQRLVDSKNCLAFLIECVNFSPADIRLNNSVFQWYGRMGEIFDEHRKIIKDKTEQYQEALKFRCERFVEELESYAKQVEEFHTFGDLLDVQRYLKKAQVLNGKLDAAADKIEQFNAEEEAYGWVPSVYPQRKKIQDGLNPYLRLYETAVEFSTKHRGWTEGPYHKVNPDQVEADVGNYWRGLYKLEKVFHDSPNALAMTKKVQSMVEEFKQYIPLIQVICNPGLRPRHWEAMSTIVGFPLLPSDDSTVFSFIDMNLEPFLDRFEGISEAASKEYSLEKAMDKMMTEWDSMEFVILPYRESGTYILSSVDDIQMLLDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMSQMPEEGRRFKAVDKTWRDVMKTVVQDKRVLAVVTIERMLERLKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIAKVEFTETLDITHMKSSEGEVVELVDTISTAKARGQVEKWLVELERTMIKSIHKVIGDAIAAYTKNSRISWVRDWPGQTVLCVSQTFWTVEVQTAIPKGHRALEGYLAKCNHQIDDIVTLVRGKLSKQNRVTLGALVVLDVHARDVLASLVDKKISDDSDFQWLSQLRYYWQENNLETKMINAGLRYGYEYLGNSPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINAGTELLVFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSIKIVATYRLCSEQLSSQHHYNYGMRAVKSVLTAAGNLKLKYPNENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNELLAAIRENCHTMNLQMTDFFSEKILQIYEMMIVRHGFMIVGEPFGGKTSAYRVLAGALNDICEKGLMEENKVQITVLNPKSVTMGQLYGQFDLVSHEWSDGILAVSFRAFAASSTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPLMVSWINTLPQSVSIIQKEFIEGLFDRMVPLSVEFIRRHTK-ELSPTSDTNLVQSLMNLIDCFMDDFADENKQKERNDRESFSLLEGIFMFSLAWSVGATCTDDDRLKFDKILRELMEGPISDLTRNKFKLLSGTEQTSSKVFIVPFPEKGTIYEYQFIPE----GLGRWDKWIKKLADTPPIPKDVQFIEIIVPTLDTIRYSALMHLLTTHQKPSIFVGPTGTGKSVYIINFLLNQLNKDIYKPLIVNFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKRMIVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSVIKLVDIQIMCAMGPPGGGRNPITPRYMRHFNIVTINEFSDKSMFTIFSRILAWHLRTCYKFPDDFLDLTTQIVNGTMALYKDAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETAENKEAIKRLWVHEVLRVYYDRLVDNADRSWLIHYIQEILKNYMQEDFHDLFKNLDFNQDGTVEEDDLRSLMFCDFHDPKREDFGYREIANVDALRMIVEGHLDEYNNMSKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSLFQVEISKGYGSHEWHEDLKVILRKCAENDMQGVFLFTDTQIKRESFLEDVNNLLNAGEVPNLFALDEKQEICEKMRQLDRQRDKTRQTDGSPIALFNMFIDRCRNQLHVVLAMSPIGDAFRIRLRKFPALVNCCTIDWFQSWPEDALEAVASRFLEDIEMSEEIQEGCIDMCKRFHTSTINLSTSFHNELQRYNYVTPTSYLELISTFKLLLEKKRNEVMKMKRRYEVGLDKLDSASSQVATMQSELEALHPQLKVASREVDEMMIIIERESMEVAKTEKIVKADETVANDQAMAAKAIKDECDADLAEALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAICILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGDIRFLQSLHEYDKDNIPPAYMNIIRKSYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGKLRIAMEGLRKKQAALYEVQDKLAKLQDTLELNKQKKADLENQVDLCSKKLERAEQLIGGLGGEKTRWSNSALELGHLYINLTGDILISSGVVAYLGAFTSNYRQNQTQEWSQSCKERDIPCSDDYSLMGTLGEAVTIRAWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQGQANKWIKNMEKTNSLQLIKLSDPDYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQSLIVQGADNKRQLKEIEDKILEVLSLSEGNILEDETAIKILSSSKSLANEISQKQEVAEETEKKIDNTRMGYRIIAIHSSILFFSIADLANIEPMYQYSLTWFINLFILSIENSEKSDILSKRLQILRDHFTYSLYVNICRSLFEKDKLLFSFCLTVNLLIHENAINKTEWRFLLTGGIGLDNPYTNPCTWLPQKSWDEICRLDDLPAFKTIRREFMRLKDGWKKVYDSMEPHHEMFPEDWENKAND-FQRMLIIRCLRPDKVIPMLQEFIIKKLGRPFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMNALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKDGTWVVLQNCHLATSWMPTLEKVCEELSAESTHPDFRIWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCKKPEEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLDQYEELPYDALRYMTGECNYGGRVTDDWDRRTLRSILNKFFCTELVENPQYKFDSSGIYFVPPSGDHKSYINYTKTLPLIPAPEVFGMNANADITKDQSETQLLFDNILLTQSQSSGSGTKSSDEVVNEVAGDILSKLPNNFDVEAAMRRYPTTYTQSMNTVLVQEMGRFNKLLITIRESCINIQKAIKGLVVMSTELEEVVSSILNVKIPVMWMGKSYPSLKPLGSYVNDFLERLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNFARKFTIPIDLLGFDYEVMDDKEYKNAPEDGVYIHGLFLDGASWNRKTKKLAESHPKVLYDTVPVMWLKPCKKSDIPKRPSYVAPLYKTSERRGTLSTTGHSTNFVIAMILPSDQPKEHWIGRGVALLCQLN 4023          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Mouse
Match: Dnah7c (dynein, axonemal, heavy chain 7C [Source:MGI Symbol;Acc:MGI:3639762])

HSP 1 Score: 5259.89 bits (13643), Expect = 0.000e+0
Identity = 2630/4045 (65.02%), Postives = 3190/4045 (78.86%), Query Frame = 3
Query:   54 SQKRGRKGPDLTKLLPTIPMKRVKPEWAQNPPSFTLDGKQK---------INEDAGIELIYELTAK-------------PPTKPRKLKGEDLAFERSQLRKDREKFRKALVDMILQGEDRPIKESIETVRLPPLTQEKTPVGMSATEKDILRYYYYIHNGIDTEHVAKMEXXXXXXXXXXXXXXXXAEHPXXXXXXXXXXXXXXXXSVKKAIVDFVLKEPREKETDD--TPIPEHRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVE-TVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIIT-QNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLD 12110
            S K   K P  T +LP + +  VK +W Q  PSF L+ KQ+          NE +  E +     K             P T   K+K            K+RE  R  LV +I+Q +     + I+   +P        V  S  EKDILRYYYYI +GID++HVA +ED W+ ++  L+   LK      +  L DEI+EDYLLSVKK+IVDFVLK+PREK+ D   T +P HR E+ V+PKPW RSF++A  + + HL   NP M  VL+LW  +FK LRLVD+EEF  ++ A+EL +FQ+  ++H+E+AKE L+K W  +VQNIYY+GNKKK +P+ +  A L+ FFNCA+TLMT  LQ+L L SM D+T+L+  P     +                        EHPGF++RL+L+   I FEP   D+  +L+N+Y+ M+K +S V R+E++LYS W        L PIIL EII+ HK  +R V++ ESV PTEH+K +DKY+ LI  + +++ID  L + ++   +E   + ++ Y  L ++I+Y SR+++RLGMFE+ C+ELI++L KRA  +C KL+ ++   H++ +  L  E+E+I  KAL  P NT ++ME+   +   E   MLEL ++L  S   L FL++  NF+ +D+ LN SVF  + RMG IFDE++K ++ K E++Q  LKF+ ERF+EEL+SY KQVEEF   GD+ ++ +YL+K+QVL++KL+AA  +I+ FN EEEA+GW  + YP R+++Q+ L PYL+LYETAVEF+ K+K W EG   KV PDQV+ DVGNY+R L+KLEK F + P    +  KV++ VEEFK+++PLIQ +  PGL  RHW+ +S IVGY L+  +   +   IDMNLEPF+ +FE ISEAA KE++LEKAM+KM  EW+ MEFV+  YRE+GT+ILSSVDDIQ++LDDHI+KTQTMRGSPFIKP+E ++++WE KL+L+Q+ILDEWLKVQATWLYLEPIFSSPDIM+QMPEEGR+F +VDKTW+++MK V+ DK+VL V+ IE+ML++LKKSNELLE ILKGLN+YLEKKRL+FPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIA + FTETLDITHMKSSE E+V L D IST+KARGQVEKWL+ELE  MI S+   I + +  Y    R  WV+ W GQ VL +S  +WT+ VQ AI +G +AL+ YL   N QID+IV LVRG+LSKQNR TL AL+VLDVHARDVL +L  +++++++DF WL QLRYYW ENN+ TKMIN+ L+YGYEYLGN+ RLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDY+ALGKFFKGL SCGAW+CFDEFNRIDLEVLSVVAQQILTIQR I A  D L+FEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFR+VAMMVPDYA+IAEI LYSCGFV ARPL++KIVATYRLCSEQLSSQ HYDYGMRAVKSVLTAAGNLKLKYP+E+E+IL+LRSIIDVNLPKFL+HDLPLF GI SDLFPGV  P PDY+ L   I++NC  MNL+ + FF EKI QIYEMMIVRHGFMIVGEPFGGKTSAY+VLA AL DICE+GLMEENKVQ T+LNPK++TMGQLYGQFD VSHEWSDGVLAVS+RAFA S+TPDRKWLIFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQ+SP  NLIFEPMDLEVASPATVSRCGM+YMEP  LGWRP+  SW+  LP +++ I K+    +F+R +   +  I++    ELSPTSD N+V SL+NLIDC +D F DE K  + + ++  + LEG+F F+  WS+GAT  ++ R  FDK+ RELM G + ++TR K  L+  T     + +   +P KGTIYDY+FI E      G+W+ W + +     I KD +FNEIIVPT DTV+Y+ LM+LL TH KP +FVGPTGTGKS YII+FLLNQ+NKDIYKP ++NFSAQT+A QTQNIIMSKLD+RRKGVFGPP+GK++IVFVDD+NMP RE YGAQPPIELLRQWLDHWNWYDLKD + IKL+D+Q + AMGPPGGGRNPITPR++RH N +TINEF D++M TIFS IL WH+ T   F  DF     Q++  T+ +YK AM NLLPTPAKSHYLFNLRDFSRVIQGV LS P T E    +KRLW HE+ RVYYDRLV + DR W  NYI+ +   ++ EDF  LFK+LDF+ DG V EDD+RSL++CDF D K  +  Y EV +++ LR  VEG+LDEYN MSKKPMNLVLFRFAIEH+SRISRILKQPRSHALLVGVGGSGRQS+TRLAA MADY LFQVEISK Y S EW EDLK ILRK  E D   VFLF+D QIK+ESFLED+NNLLNAGEVPNL+  DEKQE+CEKMRQ+DRQRDK +QTDGSP+AL+N F+ R R+QLH+VLAMSPIGDAFR RLRKFP+LVNCCTIDWFQ+WPEDAL AVA+RFLED+E+ +  ++GCID+CK FHTST  LS  +  EL RYNYVTPTSYLELISTFK LL+KKR EV K KRRYEVGL+KL SA+S ++ MQ EL    P+L  AS+EVD+ MII+E++S E +K EKIVK +E +ANDQA AA+AIK+ECD DLAEA+PILESAL AL+TLT  DIT+V++M SPP GV+LVMEAVC+LKGIK D++ DP+GSGKKIEDFWGP+KRLLG+++FL+ L  +DKDNIP   M +IR+ Y+ N DF PE+I  ASTA EGLCKWV A++ YDKVAK+VAPKKI L  A  +   AM  L KK+AAL EVQDKL  L + LE NK++K DLEN+VDLCSKKL RAEQLIGGLGGEK RW  +A +LG  +INLTGDIL+SSGVVAYLGAFTS++R  +TK+W     E+ IPCSD +SL+ TLG+ V IR+WNI GLP+D FSI+NGIII N+RRWPLMIDPQGQANKWIKNMEK N+LQ+IKL+D D+VR LENCIQFGTPVLLEN+GEELDP+LEPLLLKQTFKQGGS CI+LGDS IEY+ DFRFYITTKLRNPHYLPETSVKVTLLNFMITPEG+QDQLLGIVV+RERP+LEEEK  LI Q A+NK++LKE+ED+IL VLS SEGNILEDE+AIK+L+SSK L+NEI++KQ   EETE+KID  R+GY  IAIHS+ILFFSIADLANI+PMYQYSLTWFINLF LSI+NSEKS+ L +RLQ L+ +FTYSLY N+CRSLFEKDKLLFSF L  N+L HD+LI + EWRFLLTGG+GLDNP+ NP  WLP KSWDE+CRLDDL  F  IR+ F+  KD WKK+YDS+EPH++  P++W  +  D F +M ++RCLRPDK++  +Q F+ +++G+ +IEPPPFDL  +F DSNC +PL+F+LSPGADPM ALLKFADDQG+GG K  SLSLGQGQGPIAMKM+++ +K+GTWV+LQNCHLA SWM  LEK  EELNPE+THPDFR+WLTSYPS  FPV++LQNGVKMTNE PKGLR NI RSYL DPISD EFF + K    +KKLL+GLCFFHA+VQERRKFGP+GWNI YEFNETDLRISVQQLHMF+DQY+ + YDAL+Y+TGECNYGGRVTDDWDRRTL +IL KF+C ++ E+P YKFD SG Y+ PP  D++ YI+Y KTLPL P P VFGM+ NADITKD  ETQLLFD+ILLTQ++ S  G KS+D++V+EV+ D+L++LP NFD E  MR+YPT Y QSMNTVLVQEM RFN LL TIR S  NI+KAIKGLVVMS++LEEVV S+L  KIP MWM KSYPSLKPLGSYVNDFL RLKFL  W++ GPPP+FW+SGF+FTQAFLTG QQNYARK+TIPIDLL FDYE++DD+ Y  APEDG Y+ GLFLDGA WDRK K + ESHPKVL D +PV+WLKP KKS+I  +PSY++P+YKTSERRGTLSTTGHSTNFVIAM LP+D+P+EHWI RGVALLCQL+
Sbjct:   30 SSKEKAKLP--TTVLPQLTLTGVKHQWQQTAPSFHLNIKQENPILEPYTVKNEQSFAEYMEHYRRKGKLLDQIDDDRSAPSTSRSKVKSP---------HKERENLRSTLVKVIMQQDGGLESDVIDESGIPK-------VATSPREKDILRYYYYIRHGIDSDHVAPLEDSWLEHVLQLVPQHLKV-MTNSIMVLSDEIREDYLLSVKKSIVDFVLKDPREKDDDGKITELPPHRAEIEVLPKPWRRSFLSACSYIRDHLNAMNPMMLAVLDLWHSTFKKLRLVDIEEFHKRQDALELSEFQNIVIKHMESAKETLLKTWFPEVQNIYYKGNKKKQLPTGKSSAKLDSFFNCAATLMTLQLQDLILVSMQDFTDLIAQPPESTRAF-----------------------EHPGFIMRLVLDKDNISFEPEFNDYIDILVNIYEIMIKAVSFVPRVETKLYSQWESKSKPTTLKPIILNEIIDGHKEKIREVILRESVAPTEHLKMYDKYQFLITGKAERDIDEFLFQSQN---YERLIEEIRKYQKLEEEIQYTSRKAVRLGMFEMHCEELIKSLVKRADIICGKLIAKMFRNHQKESTMLCDEFEKIAEKALSTPLNTAELMEMKADIQKVETTDMLELRQRLVDSKNCLAFLIECVNFSPADIRLNNSVFQWYGRMGEIFDEHRKIIKDKTEQYQEALKFRCERFVEELESYAKQVEEFHTFGDLMDMQRYLQKAQVLNSKLDAAADKIDQFNAEEEAYGWVPSVYPQRKKIQDALNPYLRLYETAVEFSAKHKWWTEGPYHKVNPDQVETDVGNYWRGLYKLEKVFHDSPNALAMTKKVQSMVEEFKQYIPLIQVICNPGLHPRHWEAMSTIVGYPLKPSDDSTVLSFIDMNLEPFLDRFEGISEAASKEYSLEKAMDKMMTEWNSMEFVIHPYRESGTYILSSVDDIQMLLDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMSQMPEEGRRFKAVDKTWRDMMKTVVQDKQVLAVVTIERMLERLKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIAKVEFTETLDITHMKSSEGEVVELVDTISTAKARGQVEKWLVELERTMIKSIHKVIRDAIAAYTKYSRISWVRDWPGQTVLCVSQTFWTVEVQTAIPKGHQALEDYLAKCNQQIDDIVTLVRGKLSKQNRVTLGALVVLDVHARDVLASLADKKISDDSDFQWLSQLRYYWQENNLETKMINAGLRYGYEYLGNSPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINAGTDLLVFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSIKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPNENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNDLLAAIRDNCHTMNLQMTDFFSEKILQIYEMMIVRHGFMIVGEPFGGKTSAYRVLAGALNDICEKGLMEENKVQITVLNPKSVTMGQLYGQFDLVSHEWSDGVLAVSFRAFAASSTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPLMVSWINTLPQSVSIIQKEFIEGLFDRMVPLSVEFIRRHTK-ELSPTSDTNLVHSLMNLIDCFMDDFADENKQKERNDQESFSLLEGIFLFSLIWSVGATCTDDDRMKFDKILRELMEGPISDQTRNKFTLLSSTEQTSSKAFIVPFPEKGTIYDYQFILE----DLGRWDKWIKKLADTPPIPKDVQFNEIIVPTLDTVRYSALMHLLTTHQKPSIFVGPTGTGKSVYIINFLLNQLNKDIYKPLIVNFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKRMIVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSVIKLVDIQIMCAMGPPGGGRNPITPRYMRHFNIVTINEFSDKSMFTIFSRILAWHLRTCYKFPDDFLDMTTQIVNGTMALYKDAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETAENKEAIKRLWVHEVLRVYYDRLVDNADRGWLINYIQGILKNYMQEDFHDLFKNLDFNHDGTVEEDDLRSLMFCDFHDPKREDFGYREVENVDALRMIVEGHLDEYNNMSKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSLFQVEISKGYGSHEWHEDLKVILRKCAENDMQGVFLFTDTQIKRESFLEDVNNLLNAGEVPNLFALDEKQEICEKMRQLDRQRDKTKQTDGSPIALFNMFIDRCRNQLHVVLAMSPIGDAFRIRLRKFPALVNCCTIDWFQSWPEDALEAVASRFLEDIEMSEETQEGCIDMCKRFHTSTINLSTSFHNELQRYNYVTPTSYLELISTFKLLLEKKRNEVMKMKRRYEVGLDKLDSASSQVATMQSELEALHPQLKVASREVDEMMIIIERESMEVAKTEKIVKADETVANDQAMAAKAIKDECDADLAEALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAVCILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGDIRFLQSLHEYDKDNIPPAYMNIIRKSYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGKLRIAMEGLRKKQAALYEVQDKLAKLQDTLELNKQKKADLENQVDLCSKKLERAEQLIGGLGGEKTRWSNSALELGHLYINLTGDILISSGVVAYLGAFTSNYRQNQTKEWSQSCKERDIPCSDDYSLMGTLGEAVTIRAWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQGQANKWIKNMEKTNSLQLIKLSDPDYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQALIVQGADNKRQLKEIEDKILEVLSLSEGNILEDETAIKILSSSKSLANEISQKQEVAEETEKKIDNTRMGYRIIAIHSSILFFSIADLANIEPMYQYSLTWFINLFILSIENSEKSDILSKRLQILRDHFTYSLYVNICRSLFEKDKLLFSFCLTVNLLIHDNLINKTEWRFLLTGGIGLDNPYTNPCTWLPQKSWDEICRLDDLPAFKTIRREFMRLKDGWKKVYDSMEPHHEMFPEDWENKAND-FQRMLIIRCLRPDKVIPMLQEFIIKKLGRPFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMNALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKDGTWVVLQNCHLATSWMPTLEKVCEELNPESTHPDFRIWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFDSCKKPEEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLDQYEELPYDALRYMTGECNYGGRVTDDWDRRTLRSILNKFFCTELVENPQYKFDSSGIYFIPPSGDHKSYIDYTKTLPLIPAPEVFGMNANADITKDQSETQLLFDNILLTQSQSSGSGTKSSDEVVNEVAGDILSKLPNNFDIEAAMRRYPTTYTQSMNTVLVQEMGRFNKLLITIRESCINIQKAIKGLVVMSTELEEVVSSILNVKIPAMWMGKSYPSLKPLGSYVNDFLERLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNYARKFTIPIDLLAFDYEVMDDKEYKNAPEDGVYIHGLFLDGASWDRKTKKLAESHPKVLYDTVPVMWLKPCKKSDISKRPSYVAPLYKTSERRGTLSTTGHSTNFVIAMILPSDQPKEHWIGRGVALLCQLN 4023          
BLAST of Dynein heavy chain 7 axonemal vs. UniProt/SwissProt
Match: sp|Q63170|DYH7_RAT (Dynein heavy chain 7, axonemal OS=Rattus norvegicus OX=10116 GN=Dnah7 PE=2 SV=2)

HSP 1 Score: 5270.67 bits (13671), Expect = 0.000e+0
Identity = 2619/4031 (64.97%), Postives = 3188/4031 (79.09%), Query Frame = 3
Query:  120 VKPEWAQNPPSFTLDGKQK--------INEDAGIELIYELTAK-------------PPTKPRKLKGEDLAFERSQLRKDREKFRKALVDMILQGEDRPIKESIETVRLPPLTQEKTPVGMSATEKDILRYYYYIHNGIDTEHVAKMEXXXXXXXXXXXXXXXXAEHPXXXXXXXXXXXXXXXXSVKKAIVDFVLKEPREKETDD--TPIPEHRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVE----------TVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIIT-QNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLD 12110
            VKP+W Q  PSF L+ KQ+         NE +  E +     K             P T   K+K            K+RE FR  LV++I+Q +     +  +   +P  T        SA EKDILRYYYYIH+GIDT++VA MED W+ ++  L+   LK      +  L DE++EDYLLSVKK+IVDFVLK+PREKE D   T +P HR E+ V+PKPW RSF++A  + + HL   NP M  VL+LW  +FK LRLVD+EEF  ++ A+EL  FQ+  ++H+E+AKE L+K W  +VQNIYYQGNKKK +P+    A LE FFNCA+TLMT  LQ+L L SM D+T+L+  P   I +                        EHPGF++RL+L+   +KFEP   D+  +L+NVY+ M+K +S V R+E++LYS W        L PIIL EII+ HK  +R V++ ESV PTEH+K +DKY+ LI R+ +Q+I+  L++ ++   +E   + ++ Y  L ++I+Y SR+++RLGMFE+ C+ELIR+L KRA  +C KL+ ++   H++ N  L +E+E+I  KAL  P NT ++ME+   +   E   ML+L ++L  S   L FL++  NF+ +D+ LN SVF  + RMG IFDE++K ++ K E++Q  LK + ERF+EEL+SY KQ EEF   GD+ ++ +YLKK+QVL++KL+AA  +IE FN EEEAFGW  + YP R+++Q+ L PYL+LYETAVEF+ K++ W EG   KV PDQV+ADVGNY+R L+KLEK F + P    +  KV+ +VE+FK+++PL+Q +  PGLR RHW+ +S IVGY L+  +   +   IDMNLEPF+ +FE ISEAA KE++LEK+M+KM  EW  MEFV+  YRE+GTFILS+VDDIQ++LDDHI+KTQTMRGSPFIKP+E ++++WE KL+L+Q+ILDEWLKVQATWLYLEPIFSSPDIM+QMPEEGR+FT+VDKTW+++MK V+ +K VL V+ IE+ML+++KKSNELLE ILKGLN+YLEKKRL+FPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIA + FTETLDITHMKSSE E+V L D IST+KARGQVEKWL+ELE  MI S+   I + +  Y    R  WV+ W GQ VL +S  +WT+ VQ AI  G +AL+ YL   N QID+IV LVRG+LSKQNR TL AL+VLDVHARDVL NL++++++++ DF WL QLRYYW ENN+ TKMIN+ L+YGYEYLGN+ R+V+ P  D C+ TLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDY+ALGKFFKGL SCGAW+CFDEFNRIDLEVLSVVAQQILTIQ  I +  + L+FEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFR+VAMMVPDYA+IAEI LYSCGFV ARPL++KIVATYRLCSEQLSSQ HYDYGMRAVKSVLTAAGNLKLKYP+E+E+IL+LRSIIDVNLPKFL+HDLPLF GI SDLFPGV  P PDY+ L   I+ENC  MNL+ ++FF EKI QIYEMMIVRHGFMIVGEPFGGKTSAY+VLA ALGDICE+GLMEENKVQ T+LNPK++TMGQLYGQFD VSHEWSDG+LAVS+RAFA S+TPDRKWLIFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQ+SP  NLIFEPMDLEVASPATVSRCGM+YMEP  LGWRP+  SW+  LP +++ I K+    +F+R +   +  I++    ELSPTSD N+V+SL+NLIDC +D F DE K  + + R+  + LEG+F F+  WS+GA+   + R  ++K+ RELM G + + TR K  L+           TVP         +P KGTIYDY+FI E    G G+W+ W + +     I KD +FNEIIVPT DTV+Y+ LM+LL TH KP +FVGPTGTGKS YII+FLLNQ+NKDIYKP ++NFSAQT+A QTQNIIMSKLD+RRKGVFGPP+GK++IVFVDD+NMP RE YGAQPPIELLRQWLDHWNWYDLKD + IKL+D+Q + AMGPPGGGRNPITPR++RH N ITINEF D++M TIFS IL WH+ T   F  DF     Q++  T+ +YK AM NLLPTPAKSHYLFNLRDFSRVIQGV LS P T E    +KRLW HE+ RVYYDRL+ + DR W  NYI+E+   ++ EDF  LFK+LDFD DG V EDD+RSL++CDF D K  +  Y E+ +++ LR  VEG+LDEYN MSKKPMNLVLFRFAIEH+SRISRILKQPRSHALLVGVGGSGRQS+TRLAA MADY LFQVEISK Y S EW EDLK ILRK  E D   VFLF+D QIK+ESFLED+NNLLNAGEVPNL+  DEKQE+CEKMRQ+DRQRDK +QTDGSP+AL+N F+ R R+QLH+VLAMSPIGDAFR RLRKFP+LVNCCTIDWFQ+WPEDAL AVA+RFLED+E+ + +++GCID+CK FHTST  LS  +  EL RYNYVTPTSYLELISTFK LL+KKR EV K KRRYEVGL+KL SA+S ++ MQ EL    P+L  AS++VD  MI++E++S E +K EKIVK +E +ANDQA AA+AIK+ECD DLAEA+PILESAL AL+TLT  DIT+V++M SPP GV+LVMEA+C+LKGIK D++ DP+GSGKKIEDFWGP+KRLLG+++FL+ L  +DKDNIP   M +IR+ Y+ N DF PE+I  ASTA EGLCKWV A++ YDKVAK+VAPKKI L  A  E   AM  L KK+AAL+EVQDKL  L + LE NK++K DLEN+VDLCSKKL RAEQLIGGLGGEK RW  +A +LG  ++NLTGDIL+SSGVVAYLGAFTS++R  +TK+W H   E+ IPCSD +SL+ TLG+ V IR+WNI GLP+D FSI+NGIII N+RRWPLMIDPQGQANKWIKNMEK N+LQ+IKL+D D+VR LENCIQFGTPVLLEN+GEELDP+LEPLLLKQTFKQGGS CI+LGDS IEY+ DFRFYITTKLRNPHYLPETSVKVTLLNFMITPEG+QDQLLGIVV+RERP+LEEEK  LI Q A NK++LKE+ED+IL VLS+SEGNILEDE+AIK+L+SSK L+NEI++KQ   EETE+KID  R+GY PIA+HS+ILFFSIADLANI+PMYQYSLTWFINLF LSI+NSEKS+ L QRL  L+ +FTYSLY N+CRSLFEKDK+LFSF L  N+L H++ I + EWRFLLTGG+GLDNP+ NP  WLP KSWDE+CRLD+L  F  IR+ F+  K+ WKK+YDS+EPH++  P+EW  +  D F +M ++RCLRPDK++  +Q F+ +++G+ +IEPPPFDL  +F DSNC +PL+F+LSPGADPM ALLKFADDQG+GG K  SLSLGQGQGPIAMKM+++ +K+GTWV+LQNCHLA SWM  LEK  EEL+PE+THPDFR+WLTSYPS  FPV++LQNGVKMTNE PKGLR NI RSYL DPISD EFFG+ +    +KKLL+GLCFFHA+VQERRKFGP+GWNI YEFNETDLRISVQQLHMF++QY+ + YDAL+Y+TGECNYGGRVTDDWDRRTL +IL KF+C ++ E+P YKFD SG Y+ PP  D++ YIEY KTLPL P+P +FGM+ NADITKD  ETQLLFD+ILLTQ+R S  G KS+D++V+EV+ D+L +LP NFD E  MR+YPT Y QSMNTVLVQEM RFN LL TIR S  NI+KAIKGLVVMS++LEEVV S+L  KIPGMWM KSYPSLKPLGSYVNDFLARLKFL  W++ GPPP+FW+SGF+FTQAFLTG QQNYARK+TIPIDLL FDYE++DD+ Y  APEDG Y+ GLFLDGA W+RK K + ESHPKVL D +PV+WLKP KKS+IP +PSY++P+YKTSERRGTLSTTGHSTNFVIAM LP+D+P+EHWI RGVALLCQL+
Sbjct:   84 VKPQWQQTAPSFHLNVKQENPIEPYNVKNEQSYAEYMEHFGKKGKLLDQIDDTRSAPSTSRSKVKSP---------HKERENFRSTLVNVIMQQDSSLEPDVTDESGIPKATT-------SAIEKDILRYYYYIHHGIDTDNVAPMEDSWLEHVLQLVPQHLKV-LTNSITVLSDEMREDYLLSVKKSIVDFVLKDPREKEDDTKITELPPHRAEMEVLPKPWRRSFLSACSYIRDHLNAMNPTMLAVLDLWHSTFKKLRLVDIEEFHNRQDALELSGFQNIVIKHMESAKETLLKTWFPEVQNIYYQGNKKKQLPTGDSSAKLESFFNCAATLMTLQLQDLILVSMQDFTDLIAQPPESIRAF-----------------------EHPGFIMRLVLDKKAVKFEPEFTDYIDILVNVYEIMIKAVSFVPRVETKLYSKWESKSKPTTLKPIILDEIIDAHKEKIREVVLRESVAPTEHLKMYDKYQFLITRQAEQDIEEFLTQSQN---YERLIEEIRKYQKLGEEIQYTSRKTVRLGMFEMHCEELIRSLVKRADIICGKLIAKMFRDHQEVNTMLCEEFEKIAEKALSTPPNTAELMEMKAHIQKVETTDMLDLGQRLVDSKNCLAFLIECVNFSPADIRLNNSVFQWYGRMGEIFDEHRKIIKDKTEQYQEGLKLRCERFVEELESYAKQAEEFYTFGDLQDVQRYLKKAQVLNSKLDAAADKIEQFNAEEEAFGWIPSVYPQRKKIQDGLNPYLRLYETAVEFSTKHRAWTEGPYHKVNPDQVEADVGNYWRGLYKLEKAFHDSPNALAMTKKVRARVEDFKQYIPLVQVICNPGLRPRHWEAMSAIVGYPLQPSDDSTVFSFIDMNLEPFLDRFEGISEAASKEYSLEKSMDKMMTEWEAMEFVIHPYRESGTFILSAVDDIQMLLDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMSQMPEEGRRFTAVDKTWRDVMKMVVQNKHVLAVVTIERMLERMKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIARVEFTETLDITHMKSSEGEVVELVDTISTTKARGQVEKWLVELERIMIKSIHKVIGDAITAYTKNARINWVRDWPGQTVLCVSQTFWTVEVQVAIPMGHKALEDYLGKCNHQIDDIVTLVRGKLSKQNRVTLGALVVLDVHARDVLANLVKKRISDDTDFEWLSQLRYYWHENNLETKMINAGLRYGYEYLGNSPRMVLAPFCDYCFLTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQIGINSGTELLVFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSIKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPNENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNDLLAAIRENCHSMNLQMTNFFSEKILQIYEMMIVRHGFMIVGEPFGGKTSAYRVLAGALGDICEKGLMEENKVQITVLNPKSVTMGQLYGQFDLVSHEWSDGILAVSFRAFAASSTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPQMLGWRPLMVSWINTLPQSVSIIQKEFIEGLFDRMVPLSVEFIRRHTK-ELSPTSDTNLVRSLMNLIDCFMDDFADENKQKERNDRENFSLLEGIFLFSLIWSVGASCTADDRIKYNKILRELMEGPISDLTRNKFKLLSGTEQTSSKALTVP---------FPEKGTIYDYQFIPE----GLGRWDQWIKKLADTPPIPKDVQFNEIIVPTLDTVRYSALMSLLTTHQKPSIFVGPTGTGKSVYIINFLLNQLNKDIYKPLIVNFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKRMIVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSMIKLVDIQIMCAMGPPGGGRNPITPRYMRHFNIITINEFSDKSMFTIFSRILTWHLRTCYKFPDDFLDLTTQIVNGTMTLYKDAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETAENKEAIKRLWVHEVLRVYYDRLLDNADRSWLVNYIQEILRNYMQEDFHDLFKNLDFDNDGIVEEDDLRSLMFCDFHDPKREDFGYREIPNVDALRVIVEGHLDEYNNMSKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSLFQVEISKGYGSHEWHEDLKVILRKCAEGDMQGVFLFTDTQIKRESFLEDVNNLLNAGEVPNLFALDEKQEICEKMRQLDRQRDKTKQTDGSPIALFNMFIDRCRNQLHVVLAMSPIGDAFRIRLRKFPALVNCCTIDWFQSWPEDALEAVASRFLEDIEMSEEIREGCIDMCKSFHTSTINLSTTFHNELQRYNYVTPTSYLELISTFKLLLEKKRNEVMKMKRRYEVGLDKLDSASSQVATMQGELEALHPQLKVASRQVDDMMIMIEKESIEVAKTEKIVKADETVANDQAMAAKAIKDECDADLAEALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAICILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGDIRFLQSLHEYDKDNIPPAYMNIIRKSYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGELRIAMEGLRKKQAALREVQDKLAKLQDTLELNKQKKADLENQVDLCSKKLERAEQLIGGLGGEKTRWSNSALELGHLYVNLTGDILISSGVVAYLGAFTSNYRQHQTKEWSHSCKERDIPCSDDYSLMGTLGEAVTIRAWNIAGLPSDLFSIDNGIIIMNARRWPLMIDPQGQANKWIKNMEKTNSLQLIKLSDPDYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQALILQGAENKRQLKEIEDKILEVLSSSEGNILEDETAIKILSSSKALANEISQKQEVAEETEKKIDNTRMGYRPIAVHSSILFFSIADLANIEPMYQYSLTWFINLFILSIENSEKSDILSQRLHILRDHFTYSLYVNICRSLFEKDKMLFSFCLTVNLLIHENAINKAEWRFLLTGGIGLDNPYTNPCTWLPQKSWDEICRLDELHAFKTIRREFMRLKEGWKKVYDSMEPHHEIFPEEWENKAND-FQRMLIIRCLRPDKVIPMLQEFIIKKLGRSFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMNALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKDGTWVVLQNCHLATSWMPTLEKVCEELSPESTHPDFRIWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCRKPEEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLNQYEELPYDALRYMTGECNYGGRVTDDWDRRTLRSILNKFFCTELVENPQYKFDSSGIYFVPPSGDHKSYIEYTKTLPLIPDPEIFGMNANADITKDQSETQLLFDNILLTQSRSSGSGAKSSDEVVNEVAGDILGKLPNNFDIESAMRRYPTTYTQSMNTVLVQEMGRFNKLLITIRESCINIQKAIKGLVVMSTELEEVVSSILNVKIPGMWMGKSYPSLKPLGSYVNDFLARLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNYARKFTIPIDLLGFDYEVMDDKEYKNAPEDGVYIHGLFLDGASWNRKTKKLAESHPKVLYDTVPVMWLKPCKKSDIPKRPSYVAPLYKTSERRGTLSTTGHSTNFVIAMILPSDQPKEHWIGRGVALLCQLN 4056          
BLAST of Dynein heavy chain 7 axonemal vs. UniProt/SwissProt
Match: sp|Q8WXX0|DYH7_HUMAN (Dynein heavy chain 7, axonemal OS=Homo sapiens OX=9606 GN=DNAH7 PE=1 SV=2)

HSP 1 Score: 5263.35 bits (13652), Expect = 0.000e+0
Identity = 2623/4051 (64.75%), Postives = 3191/4051 (78.77%), Query Frame = 3
Query:   39 SCETTSQKRGRKGPDLTKLLPTIPMKRVKPEWAQNPPSFTLDGKQK---------INEDAGIELIYELTAKPPTKPRKLKGEDLAFERSQLR-----KDREKFRKALVDMILQGEDRPIKESIETVRLPPLTQEKTPVGMSATEKDILRYYYYIHNGIDTEHVAKMEXXXXXXXXXXXXXXXXAEHPXXXXXXXXXXXXXXXXSVKKAIVDFVLKEPREKETDDTP--IPEHRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVE----------TVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHI-ITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLD 12110
            S E  + K   K P   + LP + M   KP W Q  PSF L  KQ           NE +  E + E   K    P ++    +    S+ +     K+RE FR  LV++I+Q +D  +  ++     P  +    P   SA EKDILRYYYYIH+GIDT+HVA MED W+ ++ +L+   LK    + +  L DE++EDYLLSV+K+IVDFVLK+PREK  D     +P HR E+ ++PKPW +SF+ A  + + HL   NP M  VL+LW  +FK LRLVD++EF   + A+EL  FQ+  MRH+++AKE L+K W  +VQNIYYQGNKKK +P+    A LE FFNCA+ LMT  LQ+L L SM D+T+L+  P                        D     EHPGF++RLIL++  IKFEP + D+  + LNVYD M+K +S V R+E++LYS W        L PIIL EI++ HK  ++ V++ ESV PTEH++ +DKY  LI R+ ++++D  L+E    HS+E+    +  Y  L+++I+Y S ++IRLGMFE+ C+ELIRAL KRA  +C KLL ++   H++ N  L  E+E I  KAL  P NT ++ME+  ++   E   M+ELE++L  S   L FL++Y NF+ +DM LN SVF  + RMG IF+E++K +++K E++Q  LK + ERF+EEL+SY KQ EEF + GD+ ++ +YLKK+Q+L+ KL+ A  +IE FN EEEAFGW  + YP R+++Q+ L PYL+LYETAVEF+  Y+ W EG   KV PDQV+AD+GNY+R L+KLEK F + P    +  KV++KVE+FK+H+PLIQ +  PGLR RHW+ +S IVGY L+  +   +S  +DMNLEP+I +FE ISEAA KE++LEKAMEKM  EW  +EFV+ +YRETGTFIL+SVD+IQ++LDDHI+KTQTMRGSPFIKP+E ++++WE KL+L+Q+ILDEWLKVQATWLYLEPIFSSPDIM+QMPEEGR+FT+VDKTW++IM+ V+ DK VLTV+ I++ML++LKKSNELLE ILKGLN+YLEKKRL+FPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIA + FTETLDITHMKSSE E+V L ++IST+KARGQVEKWL+ELE  MI S+     +    Y    R  WV+ W GQ VL +S  +WT  VQ AI  G +AL+ YLK  N QID+IV LVRG+LS QNR TL AL+VLDVHARDVL +L+++ +++++DF WL QLRYYW EN++ TKMIN+ L+YGYEYLGN+ RLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDY+ALGKFFKGL SCGAW+CFDEFNRIDLEVLSVVAQQILTIQR I A  D LMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFR+VAMMVPDYA+IAEI LYSCGFV ARPL+VKIVATYRLCSEQLSSQ HYDYGMRAVKSVLTAAGNLKLKYP+E+E+IL+LRSIIDVNLPKFL+HDLPLF GI SDLFPGV  P PDY+ L   IK+NC  MNL+ ++FF EKI Q+YEMMIVRHGFMIVGEPFGGKTSAY+VLA AL DICE+GLMEENKVQ T+LNPK++TMGQLYGQFD VSHEWSDGVLAVS+RAFA+S TPDRKWLIFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQ+SP  NLIFEPMDLEVASPATVSRCGM+YMEP  LGWRP+  SW+ +LP +++ I K+    +F+R +   +  I+K    ELSPTSD N+V+SL+NLIDC +D F DE K+ + + R+  + LEG+F F+  WS+GA+  ++ R  F+K+ RELM   + + TR    L            TVP         +P KGTIYDY+F+ E    G GKWE W + +K    I KD  FNEIIVPT DT++Y+ LM LL TH KP +FVGPTGTGKS YI +FLLNQ+NK+IYKP LINFSAQT+A QTQNI+MSKLD+RRKGVFGPP+GK+++VFVDD+NMP RE YGAQPPIELLRQWLDHWNWYDLKD + IKL+D+Q + AMGPPGGGRNP+TPR++RH N ITINEF D++M TIFS IL WH+ I   F  +F     Q++  T+ +YK AM NLLPTPAKSHYLFNLRDFSRVIQGV LS P T E    +KRLW HE+ RVYYDRL+ + DR W  NYI+E+   ++ EDF  LF+ LDFD DG V  DD+RSL++CDF D K  +  Y E+ D++ LR  VE +L+EYN +SKKPMNLVLFRFAIEH+SRISRILKQPRSHALLVGVGGSGRQS+TRLAA MADY +FQVEISK Y +TEW EDLK ILRK  E +   VFLF+D QIK+ESFLED++NLLNAGE+PNL+  DEKQE+C+KMRQ+DRQRDK +QTDGSP+AL+N F+   R QLH+VLAMSPIGDAFRNRLRKFP+LVNCCTIDWFQ+WPEDAL AVA+RFLE++E+ + ++DGCID+CK FHTST  LS+ + +EL RYNYVTPTSYLELISTFK LL+KKR+EV K K+RYEVGLEKL SA+S ++ MQ EL    P+L  ASKEVD+ MI++E++S E +K EKIVK +E IAN+QA A++AIK+ECD DLA A+PILESAL AL+TLT  DIT+V++M SPP GV+LVMEA+C+LKGIK D++ DP+GSGKKIEDFWGP+KRLLG+M+FL+ L  +DKDNIP   M +IR+ Y+ N DF PE+I  ASTA EGLCKWV A++ YDKVAK+VAPKKI L  A  E   AM  L KK+AALKEVQDKL  L + LE NK++K DLEN+VDLCSKKL RAEQLIGGLGGEK RW   A +LG  +INLTGDIL+SSGVVAYLGAFTS++R  +TK+W      + IPCSD  SL+ TLG+ V IR+WNI GLP+D FSI+NGIII N+RRWPLMIDPQ QANKWIKNMEK N+L VIKL++ D+VR LENCIQFGTPVLLEN+GEELDP+LEPLLLKQTFKQGGS CI+LGDS IEY+ DFRFYITTKLRNPHYLPETSVKVTLLNFMITPEG+QDQLLGIVV++ERP+LEEEK  LI Q A NK++LKE+ED+IL VLS+SEGNILEDE+AIK+L+SSK L+NEI++KQ   EETE+KID  R+GY PIAIHS+ILFFS+ADLANI+PMYQYSLTWFINLF LSI+NSEKSE L +RLQ LK +FTYSLY NVCRSLFEKDKLLFSF L  N+L H+  I + EWRFLLTGG+GLDNP+ N   WLP KSWDE+CRLDDL  F  IR+ F+  KD WKK+YDS+EPH++  P+EW ++  + F +M ++RCLRPDK++  +Q F+  R+G+ +IEPPPFDL  +F DSNC +PL+F+LSPGADPMAALLKFADDQG+GG K  SLSLGQGQGPIAMKM+++ +KEGTWV+LQNCHLA SWM  LEK  EEL+PE+THPDFR+WLTSYPS  FPV++LQNGVKMTNE PKGLR NI RSYL DPISD EFFG+ K    +KKLL+GLCFFHA+VQERRKFGP+GWNI YEFNETDLRISVQQLHMF++QY+ + Y+AL+Y+TGECNYGGRVTDDWDRRTL +IL KF+  ++ E+ DYKFD SG Y+ PP  D++ YIEY KTLPL P P +FGM+ NADITKD  ETQLLFD+ILLTQ+R +  G KS+D++V+EV++D+L +LP NFD E  MR+YPT Y QSMNTVLVQEM RFN LL TIR S  NI+KAIKGL VMS+DLEEVV S+L  KIP MWM KSYPSLKPLGSYVNDFLARLKFL  W++ GPPP+FW+SGF+FTQAFLTG QQNYARKYTIPIDLL FDYE+++D+ Y   PEDG ++ GLFLDGA W+RK+K + ESHPK+L D +PV+WLKP K+++IP +PSY++P+YKTSERRG LSTTGHSTNFVIAMTLP+D+P+EHWI RGVALLCQL+
Sbjct:   25 SMEKLASKEKFKAP--ARALPQLSMVSTKPHWQQAAPSFHLSVKQDDESPEPFSVKNEQSHAEYM-ERFGKKGKLPHQVDDSYVGPSTSKSKGKSPHKERENFRSTLVNVIMQ-QDADLDSAV-----PDGSTIPKPTA-SAIEKDILRYYYYIHHGIDTDHVAPMEDSWLEHVLDLVPQHLKV-FTDSIVTLSDEMREDYLLSVRKSIVDFVLKDPREKGDDKKTDELPAHRAEMEILPKPWRKSFLAASSYIRDHLNAMNPTMLAVLDLWHTNFKKLRLVDIKEFHNCQDALELSSFQNIIMRHMDSAKETLLKMWFPEVQNIYYQGNKKKQLPTGDSSAKLESFFNCAAALMTLQLQDLTLVSMQDFTDLIAQPP-----------------------DSVRAFEHPGFIMRLILDNDTIKFEPELSDYIDIFLNVYDVMIKAVSFVPRVETKLYSKWESKSKPTTLKPIILNEIVDAHKEKIKEVIMKESVAPTEHLRLYDKYDFLITRKAERDVDNFLAEN---HSYEKIIDEICKYQKLIEEIQYTSIKTIRLGMFEMHCEELIRALVKRADIICGKLLAKMFRDHQEVNTRLCDEFERIAEKALSTPPNTAELMEMKAYIQKVEVTDMIELEQRLVDSKNCLAFLIEYVNFSPADMRLNNSVFQWYGRMGEIFEEHRKIIKEKIEQYQEGLKLRCERFVEELESYAKQSEEFYSFGDLQDVQRYLKKAQILNGKLDLAADKIEQFNAEEEAFGWLPSVYPQRKKIQDGLNPYLRLYETAVEFSSNYRAWTEGPYHKVNPDQVEADIGNYWRGLYKLEKTFHDSPYALAMTKKVRSKVEDFKQHIPLIQVICNPGLRPRHWEAMSAIVGYPLQPSDDSTVSSFLDMNLEPYIDRFEGISEAASKEYSLEKAMEKMITEWDAVEFVIHSYRETGTFILASVDEIQMLLDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMSQMPEEGRRFTAVDKTWRDIMRSVMQDKHVLTVVTIDRMLERLKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIAKVEFTETLDITHMKSSEGEVVELIEIISTAKARGQVEKWLVELERVMINSIHKVTGDATFAYTKYERINWVRDWPGQTVLCVSQIFWTKEVQTAIPMGIKALEQYLKTCNRQIDDIVTLVRGKLSMQNRVTLGALVVLDVHARDVLSSLVKKNISDDSDFEWLSQLRYYWQENHLETKMINAGLRYGYEYLGNSPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINAGADILMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPNENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNDLLAAIKDNCASMNLQMTAFFSEKILQVYEMMIVRHGFMIVGEPFGGKTSAYRVLAGALNDICEKGLMEENKVQITVLNPKSVTMGQLYGQFDSVSHEWSDGVLAVSFRAFASSVTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPLMLSWVNLLPASVSVIQKEFIMGLFDRMVPVSVEFIRKHTK-ELSPTSDTNLVRSLMNLIDCFMDDFADEVKLKERNDRETYSLLEGIFLFSLIWSVGASCTDDDRLKFNKILRELMESPISDRTRNTFKLQSGTEQTSSKALTVP---------FPEKGTIYDYQFVTE----GIGKWEPWIKKLKEAPPIPKDVMFNEIIVPTLDTIRYSALMELLTTHQKPSIFVGPTGTGKSVYITNFLLNQLNKEIYKPLLINFSAQTTAAQTQNIVMSKLDKRRKGVFGPPLGKRMVVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSMIKLVDIQIMCAMGPPGGGRNPVTPRYMRHFNIITINEFSDKSMYTIFSRILTWHLEICYKFPDEFLDLTTQIVNGTMTLYKEAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETTETTEVIKRLWVHEVLRVYYDRLLDNTDRSWLINYIQEILRNYMYEDFHELFQRLDFDNDGMVEADDLRSLMFCDFHDPKREDTNYREIADVDNLRMIVEIHLEEYNNISKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSVFQVEISKGYDTTEWHEDLKVILRKCAEGEMQGVFLFTDTQIKEESFLEDVSNLLNAGEIPNLFALDEKQEICDKMRQLDRQRDKTKQTDGSPIALFNMFIDHCRSQLHVVLAMSPIGDAFRNRLRKFPALVNCCTIDWFQSWPEDALQAVASRFLEEIEMSEEIRDGCIDMCKSFHTSTIDLSKSFFVELQRYNYVTPTSYLELISTFKLLLEKKRSEVMKMKKRYEVGLEKLDSASSQVATMQMELEALHPQLKVASKEVDEMMIMIEKESVEVAKTEKIVKADETIANEQAMASKAIKDECDADLAGALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAICILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGDMRFLQSLHEYDKDNIPPAYMNIIRKNYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGELKIAMDGLRKKQAALKEVQDKLARLQDTLELNKQKKADLENQVDLCSKKLERAEQLIGGLGGEKTRWSHTALELGQLYINLTGDILISSGVVAYLGAFTSTYRQNQTKEWTTLCKGRDIPCSDDCSLMGTLGEAVTIRTWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQSQANKWIKNMEKANSLYVIKLSEPDYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVAQERPDLEEEKQALILQGAENKRQLKEIEDKILEVLSSSEGNILEDETAIKILSSSKALANEISQKQEVAEETEKKIDTTRMGYRPIAIHSSILFFSLADLANIEPMYQYSLTWFINLFILSIENSEKSEILAKRLQILKDHFTYSLYVNVCRSLFEKDKLLFSFCLTINLLLHERAINKAEWRFLLTGGIGLDNPYANLCTWLPQKSWDEICRLDDLPAFKTIRREFMRLKDGWKKVYDSLEPHHEVFPEEWEDK-ANEFQRMLIIRCLRPDKVIPMLQEFIINRLGRAFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMAALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKEGTWVVLQNCHLATSWMPTLEKVCEELSPESTHPDFRMWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCKKPEEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLNQYEELPYEALRYMTGECNYGGRVTDDWDRRTLRSILNKFFNPELVENSDYKFDSSGIYFVPPSGDHKSYIEYTKTLPLTPAPEIFGMNANADITKDQSETQLLFDNILLTQSRSAGAGAKSSDEVVNEVASDILGKLPNNFDIEAAMRRYPTTYTQSMNTVLVQEMGRFNKLLKTIRDSCVNIQKAIKGLAVMSTDLEEVVSSILNVKIPEMWMGKSYPSLKPLGSYVNDFLARLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNYARKYTIPIDLLGFDYEVMEDKEYKHPPEDGVFIHGLFLDGASWNRKIKKLAESHPKILYDTVPVMWLKPCKRADIPKRPSYVAPLYKTSERRGVLSTTGHSTNFVIAMTLPSDQPKEHWIGRGVALLCQLN 4023          
BLAST of Dynein heavy chain 7 axonemal vs. UniProt/SwissProt
Match: sp|Q8TD57|DYH3_HUMAN (Dynein heavy chain 3, axonemal OS=Homo sapiens OX=9606 GN=DNAH3 PE=2 SV=1)

HSP 1 Score: 3907.45 bits (10132), Expect = 0.000e+0
Identity = 2065/3962 (52.12%), Postives = 2730/3962 (68.90%), Query Frame = 3
Query:  390 TQEKTPVGMSATEKDILRYYYYIHNGIDTEHVAKMEXXXXXXXXXXXXXXXXAEH--PXXXXXXXXXXXXXXXXSVKKAIVDFVLKEPRE-KETDDTPIPEHRKELSV-VPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKK--KLVP--SVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIE----SRLYSDWAGDKT----------KIYLNPIILPEI---------IEKHKSTVRNVLID-------ESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYAN--FNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQ----VEEFQ-NLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFN-----DEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELV-KGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSA-WLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEE-LNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDE-APEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD 12113
            ++EK P     +E D+ RYYYY+ NGI  + +A  E + M  +  L+ N L        L+  L  E + DY  S+ K+IVD++L +P E K      IP    +  +  P PW   + +A K+ ++HL+  NP M ++ ELW   F++LR V   E    K  ++ Q+F     +H   A + L+ KW+     ++    +      P  +     N+E +F   ++ M+  L+ L + S+ D  +L              M  K    F  P +++         +++L + + +I F PS +    L+ + + +++K  + + +++       ++  A D+            ++     + E+         +   +  V + LI          VGP +++  + KY  L++   +Q I   L E  D   F      +K   + +  +      ++ L MF L    L   L +RAQN+ + L+   ++ +R +N  +  +Y  I  K   +PANT++++ LI+F+  +  +T+ +L ++L  ++ERL FLMDYA+  +   D+  N      H R  +  D  K+          +  + + E +  EL+S+RK+     EE + N+  +NE++K L +          A    E  NKEEE    + +TYP+ Q +     PY +L+ TA EF+ K ++WM G +  +  +Q+  ++GN +RT +KL K   + P P+++A  VK K+++FK+++P++     PG++DRHWQQIS+IVGY ++  E  CLS +++     F+ K E I  AA KE++LEK +++MK +W  + F  + YR+T T IL ++DDIQ++LDDH++KTQTM GSPFIKP EAE + WE KLI +QD LD WLK QATWLYLEPIFSS DI+AQMPEEGRKF  VD  WK +M Q + D R+L      +M +KL+++N LLE I KGLN YLEKKRL+FPRFFFLSNDELLEILSETKDP RVQPHLKKCFEGIA L FT+ L+I  M SSE E V     I  + A+G VEKWL ++E  M+AS+R  I  G+  Y   PR  WV +W GQ V+ +S  +WT  V  A+ E    L  +LK +N QI +IV LVRG+LS   R TL AL V+DVHARDV+  L +++V++ NDF W+ QLRYYWV  ++  ++I +   YGYEYLGN+ RLVITPLTDRCYRTL GAL L+LGGAPEGPAGTGKTETTKDLAKA+AKQCVVFNCSDGLDY A+GKFFKGLA  GAW+CFDEFNRI++EVLSVVAQQIL+IQ+AI  +  T +FEGTEL L+PTCAVFITMNPGYAGR+ELPDNLKALFR+VAMMVPDYALI EISLYS GF+++R LA KIVATYRLCSEQLSSQ HYDYGMRAVKSVLTAAGNLKLKYP+E+E +L+LR+++DVNL KFL  D+PLF GI SDLFPGV  P PDY++  K + +N  KM L+   +F+ KI QIYEMM+VRHG+MIVG+P GGKTSAYKVLAAALGD+     MEE  V+Y I+NPKAITMGQLYG FD VSHEW DGVLA ++R  A+S + DRKW+IFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQ++   +LIFEP DLE ASPATVSRCGM+YMEP  LGW+P+ +S++  LP ++T  HK++  D+F   +   +    +   K +  TS I++  S++ L    +D        +      +  + I  WL+G+F F+  W++  T N + RK FD   R L+ G  M++   +   V+           ++P +G+IYD+ FI +      G WE W++ + K ++ +   AK +E+I+PT +T + ++ +   L H+ P LFVGPTGTGKS    +FLL+ + K+ Y PN INFSA+TSANQTQ+IIMSKLDRRRKG+FGPP+GKK +VFVDDLNMP +E YGAQPPIELLRQW+DH  W+D KDTT + ++D+  + AMGPPGGGRN IT RF RHLN I+IN F D+ +  IFSSI++WH   + F   F      L+QAT  +Y+ A+ N LPTP+KSHY+FNLRDFSRVIQGVLL     +++     RLW HE++RV+YDRL+  +DR+ FFN ++E ++    +  + +  HL     GK+ +D+IRSL + D+   +S  K Y E+TDL+ L   +E YL+E+N +SK PM+LV+FRFAIEH+SRI R+LKQ + H LLVG+GGSGRQS  +L+  M  Y+L+Q+EI+K+Y   +WREDLK+I+ +        VFLF+DNQIK ESF+EDIN LLN G+VPN++P DEK ++ EKM+   R + +    + +P+++YNFF++RV +++   LAMSPIGDAFRNRLR FPSL+NCCTIDWFQ+WP DAL  VA +FLEDVELD +++   + +CK F  S + LS  Y  +L R+NYVTPTSYLELI TFK LL+ KR EV   + RY  GL+KL  AAS ++VMQ+EL   QP+L+  S+E  K M+ +E ++ EA  ++ +V+ +E  AN  A  A+ IKNEC+ DLAEA+P LE+AL AL+TL PADI++V++M +PP  V+LVME++C++KG+KP+R  DPSGSGK IED+WG SK++LG++KFLE LK +DKDNIP   MK IRE+++ + +F+P  I   S+ACEGLCKWV A+E YD+VAKVVAPK+  L +A  +    M  LN+KRA LK V D+L+ L ++ E    +K DLE  +++CS+KLVRAE+LI GLGGEKDRW +AA  LG+R+ NLTGD+LLSSG VAYLGAFT  +R +   QWL +  +K IP    FSL  TLGDP++IR+W I GLP D FSI+NGII+SNSRRW LMIDP GQANKWIKNMEK N L VIK +D++++R+LEN +Q GTPVL+ENIGEELD  +EP+LLK TFKQ G   ++LG++IIEYS DF+ YITT+LRNPHYLPE +VKV LLNFMITP GLQDQLLGIV ++E+PELEE+KN+LI +SA NKK LKE+ED+IL VLS S+GNILEDE+AIKVL+SSK LS EI+EKQ     TE +IDE R+GY P+A+HS  +FF I+DLANI+PMYQYSLTWFINL+  S+ +S KSE L  R++ +  +FT S+Y NVCRSLFEKDKLLFS +L   I+K    I E+ W FLLTGG+ LDNP+ NP+  WL  K+W E+ R   L   HG+ +   +    WK IYDS  PH +QLP  W  +      KM +LRCLRPDK+V A++ F+ E +GK YIE P FDL GS+NDS+C +PL+F+LSP ADPMA LLKFADD G GG + +++SLGQGQGPIA KMI   IK+GTWV+LQNCHLA SWM  LEK  EE + PE+T+  FRLWLTSYPS  FPV+ILQNG+KMTNEPPKGLR N+ RSYL+DPISD  FF +      W+K+LFGLCFFHA+VQERR FGP+GWNI YEFNE+DLRIS+ Q+ MF++ Y  V +DAL YLTGECNYGGRVTDD DRR L+++L  FYC ++ ED  Y       YY PP   Y+ YI+Y++ LP+   P VFG+H+NADITKDNQET  LF+ +LLT  R S G GKS  ++V+E++ D+L++LP +FD E VM+ YP  YE+SMNTVL QE++RFN L   +R SL N+ +AIKG V+MSS+LEEV  SML  K+P MW  KSYPSLKPLG YV D LARL F  +W D GPP +FWISGFYFTQ+FLTGV QNYARKYTIPID + F++E+       E  PEDGAY+KGLFL+GARWDRK   I ES PK+L DP+P+IWLKP + +   ++  Y+ P+YKTS RRGTLSTTGHSTN+V+++ LPTD P++HWI RGVA LCQLD+
Sbjct:  221 SKEKKP-----SESDLERYYYYLTNGIRKDMIAPEEGEVMVRISKLISNTLLTSPFLEPLMVVLVQEKENDYYCSLMKSIVDYILMDPMERKRLFIESIPRLFPQRVIRAPVPWHSVYRSAKKWNEEHLHTVNPMMLRLKELWFAEFRDLRFVRTAEILAGKLPLQPQEFWDVIQKHCLEAHQTLLNKWIPTCAQLFTSRKEHWIHFAPKSNYDSSRNIEEYFASVASFMSLQLRELVIKSLEDLVSLF-------------MIHKDGNDFKEPYQEMKFFIPQL-IMIKLEVSEPIIVFNPSFDGCWELIRDSFLEIIKNSNGIPKLKYIPLKFSFTAAAADRQCVKAAEPGEPSMHAAATAMAELKGYNLLLGTVNAEEKLVSDFLIQTFKVFQKNQVGPCKYLNVYKKYVDLLDNTAEQNIAAFLKENHDIDDFVTKINAIKKRRNEIASMNI----TVPLAMFCLDATALNHDLCERAQNLKDHLIQFQVDVNRDTNTSICNQYSHIADKVSEVPANTKELVSLIEFLKKSSAVTVFKLRRQLRDASERLEFLMDYADLPYQIEDIFDNSRNLLLHKRDQAEMDLIKRC---------SEFELRLEGYHRELESFRKREVMTTEEMKHNVEKLNELSKNLNR----------AFAEFELINKEEELLEKEKSTYPLLQAMLKNKVPYEQLWSTAYEFSIKSEEWMNGPLFLLNAEQIAEEIGNMWRTTYKLIKTLSDVPAPRRLAENVKIKIDKFKQYIPILSISCNPGMKDRHWQQISEIVGYEIKPTETTCLSNMLEFGFGKFVEKLEPIGAAASKEYSLEKNLDRMKLDWVNVTFSFVKYRDTDTNILCAIDDIQMLLDDHVIKTQTMCGSPFIKPIEAECRKWEEKLIRIQDNLDAWLKCQATWLYLEPIFSSEDIIAQMPEEGRKFGIVDSYWKSLMSQAVKDNRILVAADQPRMAEKLQEANFLLEDIQKGLNDYLEKKRLFFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIAKLEFTDNLEIVGMISSEKETVPFIQKIYPANAKGMVEKWLQQVEQMMLASMREVIGLGIEAYVKVPRNHWVLQWPGQVVICVSSIFWTQEVSQALAEN--TLLDFLKKSNDQIAQIVQLVRGKLSSGARLTLGALTVIDVHARDVVAKLSEDRVSDLNDFQWISQLRYYWVAKDVQVQIITTEALYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIEVEVLSVVAQQILSIQQAIIRKLKTFIFEGTELSLNPTCAVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYALIGEISLYSMGFLDSRSLAQKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPEENESVLLLRALLDVNLAKFLAQDVPLFQGIISDLFPGVVLPKPDYEVFLKVLNDNIKKMKLQPVPWFIGKIIQIYEMMLVRHGYMIVGDPMGGKTSAYKVLAAALGDLHAANQMEEFAVEYKIINPKAITMGQLYGCFDQVSHEWMDGVLANAFREQASSLSDDRKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMNSKMSLIFEPADLEQASPATVSRCGMIYMEPHQLGWKPLKDSYMDTLPSSLTKEHKELVNDMFMWLVQPCLE-FGRLHCKFVVQTSPIHLAFSMMRLYSSLLDEIRAVEEEEMELGEGLSSQQIFLWLQGLFLFSLVWTVAGTINADSRKKFDVFFRNLIMG--MDDNHPRPKSVKLTK------NNIFPERGSIYDFYFIKQAS----GHWETWTQYITKEEEKVPAGAKVSELIIPTMETARQSFFLKTYLDHEIPMLFVGPTGTGKSAITNNFLLH-LPKNTYLPNCINFSARTSANQTQDIIMSKLDRRRKGLFGPPIGKKAVVFVDDLNMPAKEVYGAQPPIELLRQWIDHGYWFDKKDTTRLDIVDMLLVTAMGPPGGGRNDITGRFTRHLNIISINAFEDDILTKIFSSIVDWHF-GKGFDVMFLRYGKMLVQATKTIYRDAVENFLPTPSKSHYVFNLRDFSRVIQGVLLCPHTHLQDVEKCIRLWIHEVYRVFYDRLIDKEDRQVFFNMVKETTSNCFKQTIEKVLIHLS--PTGKIVDDNIRSLFFGDYFKPESDQKIYDEITDLKQLTVVMEHYLEEFNNISKAPMSLVMFRFAIEHISRICRVLKQDKGHLLLVGIGGSGRQSAAKLSTFMNAYELYQIEITKNYAGNDWREDLKKIILQVGVATKSTVFLFADNQIKDESFVEDINMLLNTGDVPNIFPADEKADIVEKMQTAARTQGEK--VEVTPLSMYNFFIERVINKISFSLAMSPIGDAFRNRLRMFPSLINCCTIDWFQSWPTDALELVANKFLEDVELDDNIRVEVVSMCKYFQESVKKLSLDYYNKLRRHNYVTPTSYLELILTFKTLLNSKRQEVAMMRNRYLTGLQKLDFAASQVAVMQRELTALQPQLILTSEETAKMMVKIEAETREADGKKLLVQADEKEANVAAAIAQGIKNECEGDLAEAMPALEAALAALDTLNPADISLVKSMQNPPGPVKLVMESICIMKGMKPERKPDPSGSGKMIEDYWGVSKKILGDLKFLESLKTYDKDNIPPLTMKRIRERFINHPEFQPAVIKNVSSACEGLCKWVRAMEVYDRVAKVVAPKRERLREAEGKLAAQMQKLNQKRAELKLVVDRLQALNDDFEEMNTKKKDLEENIEICSQKLVRAEKLISGLGGEKDRWTEAARQLGIRYTNLTGDVLLSSGTVAYLGAFTVDYRVQCQNQWLAECKDKVIPGFSDFSLSHTLGDPIKIRAWQIAGLPVDSFSIDNGIIVSNSRRWALMIDPHGQANKWIKNMEKANKLAVIKFSDSNYMRMLENALQLGTPVLIENIGEELDASIEPILLKATFKQQGVEYMRLGENIIEYSRDFKLYITTRLRNPHYLPEVAVKVCLLNFMITPLGLQDQLLGIVAAKEKPELEEKKNQLIVESAKNKKHLKEIEDKILEVLSMSKGNILEDETAIKVLSSSKVLSEEISEKQKVASMTETQIDETRMGYKPVAVHSATIFFCISDLANIEPMYQYSLTWFINLYMHSLTHSTKSEELNLRIKYIIDHFTLSIYNNVCRSLFEKDKLLFSLLLTIGIMKQKKEITEEVWYFLLTGGIALDNPYPNPAPQWLSEKAWAEIVRASALPKLHGLMEHLEQNLGEWKLIYDSAWPHEEQLPGSW--KFSQGLEKMVILRCLRPDKMVPAVREFIAEHMGKLYIEAPTFDLQGSYNDSSCCAPLIFVLSPSADPMAGLLKFADDLGMGGTRTQTISLGQGQGPIAAKMINNAIKDGTWVVLQNCHLAASWMPTLEKICEEVIVPESTNARFRLWLTSYPSEKFPVSILQNGIKMTNEPPKGLRANLLRSYLNDPISDPVFFQSCAKAVMWQKMLFGLCFFHAVVQERRNFGPLGWNIPYEFNESDLRISMWQIQMFLNDYKEVPFDALTYLTGECNYGGRVTDDKDRRLLLSLLSMFYCKEIEED-YYSLAPGDTYYIPPHGSYQSYIDYLRNLPITAHPEVFGLHENADITKDNQETNQLFEGVLLTLPRQSGGSGKSPQEVVEELAQDILSKLPRDFDLEEVMKLYPVVYEESMNTVLRQELIRFNRLTKVVRRSLINLGRAIKGQVLMSSELEEVFNSMLVGKVPAMWAAKSYPSLKPLGGYVADLLARLTFFQEWIDKGPPVVFWISGFYFTQSFLTGVSQNYARKYTIPIDHIGFEFEVTPQETVMENNPEDGAYIKGLFLEGARWDRKTMQIGESLPKILYDPLPIIWLKPGESAMFLHQDIYVCPVYKTSARRGTLSTTGHSTNYVLSIELPTDMPQKHWINRGVASLCQLDN 4116          
BLAST of Dynein heavy chain 7 axonemal vs. UniProt/SwissProt
Match: sp|Q8BW94|DYH3_MOUSE (Dynein heavy chain 3, axonemal OS=Mus musculus OX=10090 GN=Dnah3 PE=1 SV=2)

HSP 1 Score: 3897.05 bits (10105), Expect = 0.000e+0
Identity = 2067/3944 (52.41%), Postives = 2727/3944 (69.14%), Query Frame = 3
Query:  423 TEKDILRYYYYIHNGIDTEHVA--KMEXXXXXXXXXXXXXXXXAEHPXXXXXXXXXXXXXXXXSVKKAIVDFVLKEPREKET-DDTPIPE---HRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKK--KLVPS--VQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMK-------------------------VISSVTRIESRLYSDWAGDKTKI-YLNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRR-SIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHS-HNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFND----EAKISQ-MDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELV-KGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSA-WLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEE-LNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEIL-DDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD 12113
            +E D+ RYYYY+ NGI  + +A    E                     L   L  E + DY  S+ K+IVD++L +P EK+      IP    HR  +   P PW   + +  K+ ++HL+  NP M ++ ELW   F+NLR V   +    K  +   +++    +H   A+  L+ KW+     ++    +      P        N+E +F   ++ M+  L++L + S+ D              +S  M  K    F  P +++         +++L + D +I F P+ +D   L+ N + +++K                          ++SV ++ES L+ D  G    +  +NP     ++         V     VGP +++  + KY  L++   ++ I   L E   +H  E+F   +       +K E  S   ++ L MF L    L   L +RAQN+ + L+   ++ +R++N  +  +Y  I  K   +PANT +++ LI+++  +  +T+ +L ++L  ++ERL FLMDYA+  +  +     VF S  N + S  D+ + ++ ++  EF++ L    E + +EL+ +RK+      +    E+   ++K   L   L+ A+   E  NKEEE    + +++P+ Q +     PY +L+ TA EF+ K ++WM G +  +  +Q+  ++GN +RT +KL K   + P PK++A  VK K+E+FK+H+P++     PG++DRHWQQISDIVGY ++  E  CL+ +++     F+ K E I  AA KE++LEK +EKMK +W  M F  + YR+T T IL +VDDIQL+LDDH++KTQTM GS FIKP EAE + WE KL+ VQ+ LD WLK Q TWLYLEPIFSS DI+AQMPEEG+KFT+VD  WK +M Q + D RV+      +M +KL+++N LLE I +GLN YLEKKRL+FPRFFFLSNDELLEILSETKDP RVQPHLKKCFEGIA L FT+ L+I  M SSE E V     I   KA+G VEKWL ++E  M+AS+R  I  G+  Y   PR  WV +W GQ V+ +S  +WT  V +A+ E  + L  +LK +N QI +IV LVRG+LS   R TL AL V+DVHARDV+  L  + + + NDF W+ QLRYYW E N+  +MI +   YGYEYLGN+ RLVITPLTDRCYRTL GAL L+LGGAPEGPAGTGKTETTKDLAKA+AKQCVVFNCSDGLDY A+GKFFKGLA  GAW+CFDEFNRI++EVLSVVAQQIL+IQ+AI  +    +FEGTEL L+PTCAVFITMNPGYAGR+ELPDNLKALFR+VAMMVPDYALI EISLYS GF+++R LA KIVATYRLCSEQLSSQ HYDYGMRAVKSVLTAAGNLKLKYP+E+E +L+LR+++DVNL KFL  D+PLF GI SDLFPGV  P PDY++  + +  N  KM L+   +F+ KI QIYEMM+VRHG+MIVG+P GGKTSAYKVLAAALGD+     MEE  V++ I+NPKAITMGQLYG FD VSHEW+DGVLA ++R  A+S T DRKW+IFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQ+S   +LIFEP DLE ASPATVSRCGM+YME   LGW+P+ +S++  LP  +T  H ++  D+F   +   +    +   K +  TS I++  S++ L    +D   D    E +I + +  + I  WL+G+F F+  W++  T N E RK FD   R L+ G  M++   +   V+           ++P +G+IYD+ F+ +    G G W  W+E + K +++I  +AK +++I+PT +T + ++ +   L H+ P LFVGPTGTGKS    DFLL+ + K++Y+PN INFSA+TSANQTQ+IIMSKLDRRRKG+FGPP+GKK +VFVDDLNMP +E YGAQPPIELLRQW+DH  W+D KDT  + ++D+  + AMGPPGGGRN IT RF RHLN I+IN F DE +  IFSSI +WH   + F   F      L+QAT  +Y++A+ N LPTP+KSHY+FNLRDFSRVIQGVLL     +++     RLW HE++RV+YDRL+ + DR+ FFN ++E ++    +  + +  HL     GK+T+D+IRSL + D+   +S  K Y E+ DL  L   +E YLDE+N +SK PM+LV+F+FAIEH+SRI R+LKQ + H LLVG+GGSGRQS T+L+  M  Y+L+Q+EI+K+YT+++WREDLK+I+ +S       VFLFSDNQIK ESF+EDIN LLN G+VPN++P DEK ++ EKM+   R   +    + +P+++YNFF++R  ++ +  LAMSPIGDAFR RLR FPSL+NCCTIDWFQ+WP DAL  VA +FLEDVELD +++   + +CK F  S + LS  Y   L R+NYVTPTSYLELI TFK LL+ KR EV   + RY  GL+KL+ A+S ++VMQ EL   QP+L++ S++    M+ +E ++ EA  ++ +V+ +E  AN  A  ++AIKNEC+ DLAEA+P LE+AL AL+TL P+DIT+V++M +PP  V+LVME++CV+KG+KP+R  DPSGSGK IED+WG S+++LG++KFLE LK +DKDNIP  IMK IRE+++ + DF+P  I   S+ACEGLCKWV A+E YD+VAKVVAPK+  L +A  +    M  LN+KRA LK V+D+L+ L +E E   R+K  LE  +++CS+KLVRAE+LI GLGGEKDRW +AA  LG+R+ NLTGD+LL+SG VAYLGAFT  +RA+   +WL    +K IP S  FSL  TLGDP++IR+W I GLP D FS++NGII+SNSRRWPLMIDPQGQANKW+KNMEK N L VIK +D ++VR LEN +QFGTPVLLEN+GEELD  +EP+LLK TFKQ G   ++LG++IIEYS +F+FYITT+LRNPHYLPE +VKV LLNFMITP GLQDQLLGIV ++E+PELEE+KNKLI +SA NKK+LKE+ED+IL VLS  EGNILEDE+AIK+L+SSK LS EI+EKQ     TE +IDE R+GY P+A+HS  +FF I+DLA+I+PMYQYSLTWFINL+  S+ NS KS+ L  R++ +  +FT S+Y NVCRSLFEKDKLLFS +L   +LK    I E+ W FLLTGGV LDNP  NP+  WL  KSW E+ R   L    G+ +  ++    WK IYDS  PH + LP  W      +  K+ +LRCLRPDKIV AIQNF+ E +GK +IE P FDL GS+ DS+C  PL+FILSPGADPMA LLKFADD   GG K +++SLGQGQGPIA  MI + I EGTWV+LQNCHLA SWM  LEK  EE + PE T+ +FRLWLTSYPS  FPV+ILQNG+KMTNEPPKGLR N+ RSYL+DPISD  FF +      W+KLLFGLCFFHAIVQERR +G +GWNI YEFNE+DLRIS++Q+ MF++ Y+ V ++AL YLTGECNYGGRVTDD DRR L+++L  FYC ++  D +Y       Y  PP   Y+ YIEY++TLP+   P VFG+H+NADITKDNQET  LF  +LLT  R S G GKS  ++V+E++ D+L++LP +F+ E VM+KYP  Y++SMNTVL QE++RFN L   +R SL ++ +AIKG V+MSS+LEEV  SML  K+P MW  KSYPSLKPLG YV D LARL F  +W D GPP +FWISGFYFTQ+FLTGV QNYARKYTIPID + F++E+   +   +  PEDGAY+KGLFL+GARWDR    I ES PK+L DP+P+IWLKP + +   ++  Y+ P+YKTS RRG LSTTGHSTN+V+++ LPTD P++HWI RGVA LCQLD+
Sbjct:  199 SELDLERYYYYLTNGIRKDMIAPENEEVMMRIYKLIPKTLLTTPALEPLQVSLRSEKESDYYYSLMKSIVDYILMDPMEKKRLFIKSIPRLFPHR--VIRAPVPWHNIYQSTKKWNEEHLHTVNPMMYKLKELWFAEFQNLRFVRTADLLAGKLPLLPHEYKEVVQKHCREARHILLTKWIPTCAQLFVTQKEHWVHFAPKNDYDSSRNIEEYFASVASFMSLQLRDLVIKSLRDL-------------VSFFMIHKDGNDFKEPYQEMDFFIPQL-IMIKLEVRDPIIVFNPTFDDCWQLIKNSFLEIIKNSDGIPKVYLCWKPLASYICVSPHLRMTSVLQVESILFPDLKGYNMILGTVNP--EESLVSDFLDQTLEVFKKNQVGPYKYLNVYKKYDDLLDNMAEKGISEFLKE---KHEIEDFVTSINSIKK--RKNEIASMHITVPLAMFCLDAVFLNYDLCERAQNLKDNLILYQVDVNRETNTSICNQYSTIADKVSEIPANTAELVALIEYLKKSSDVTVFKLRRQLRDASERLEFLMDYADLPSESIE---DVFESSRNLLMSKRDQAEMDLIKRCSEFESRL----EGYSKELEMFRKR-----EVMTTEEMKNNVEKLHDLSKNLDLALTEFELINKEEELLEKEKSSFPLLQTLMINKIPYEQLWVTAYEFSTKSEEWMNGPLYLMNAEQIAEEIGNMWRTTYKLTKTLIDVPAPKRLAENVKLKIEKFKQHIPILNIACNPGMKDRHWQQISDIVGYEIKPTETTCLANMLEYGFGKFVDKLEPIGAAASKEYSLEKNLEKMKADWVNMCFSFVKYRDTDTSILCAVDDIQLILDDHVIKTQTMCGSVFIKPIEAECRKWEEKLVRVQENLDAWLKCQVTWLYLEPIFSSEDIIAQMPEEGKKFTTVDTYWKSLMAQAVNDTRVMVAADQPRMTEKLQEANVLLEDIQRGLNDYLEKKRLFFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIAKLEFTDNLEIKGMISSEKETVPFIQTIYPVKAKGMVEKWLQQVEQVMLASMRQVIENGIEAYVQVPRNAWVLEWPGQVVICVSSIFWTREVSEALVE--DTLTDFLKKSNDQIAQIVELVRGKLSSGARLTLGALTVIDVHARDVVAKLRHDHINSLNDFQWISQLRYYWTEKNVHVQMITTEALYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIEVEVLSVVAQQILSIQQAIIRKLKRFIFEGTELSLNPTCAVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYALIGEISLYSMGFLDSRSLAQKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPEENESVLLLRALLDVNLAKFLAQDVPLFQGIISDLFPGVVLPKPDYEVFLEALNNNIRKMKLQPVPWFIGKIIQIYEMMLVRHGYMIVGDPMGGKTSAYKVLAAALGDLHAANQMEEFAVEFKIINPKAITMGQLYGCFDAVSHEWTDGVLANAFREQASSITDDRKWIIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSSKMSLIFEPADLEQASPATVSRCGMIYMEAHQLGWKPLKDSYMDTLPRCLTKEHTELVEDMFTWLVQPCLD-FSRLHCKFVVQTSPIHLAFSMMRLYSSLLDEIRDIQEEEMEIYEGLSSQQIFLWLQGLFLFSLVWTLAGTINAESRKKFDVFFRNLIMG--MDDRNPRPKSVKLTK------NNIFPERGSIYDFYFLKQ----GGGHWNAWTEYITKEEETIPANAKVSDLIIPTMETARQSFFLKTYLDHEIPILFVGPTGTGKSAITNDFLLH-LPKNVYQPNFINFSARTSANQTQDIIMSKLDRRRKGLFGPPIGKKAVVFVDDLNMPAKEVYGAQPPIELLRQWIDHGYWFDKKDTNRLDIVDVLLVTAMGPPGGGRNDITGRFTRHLNIISINAFEDEILTKIFSSIADWHF-GKGFDVMFLRYGKMLVQATQTIYRAAVENFLPTPSKSHYVFNLRDFSRVIQGVLLCPHTHLQDLEKFIRLWIHEVYRVFYDRLIDNDDRQTFFNLVKETTSNCFKQTMEKVLIHLS--PTGKITDDNIRSLFFGDYLKPESDQKIYDEIIDLRGLTVVMEYYLDEFNSVSKAPMSLVMFKFAIEHISRICRVLKQKKGHLLLVGIGGSGRQSATKLSTFMNSYELYQIEITKNYTNSDWREDLKKIMLQSGVATKSTVFLFSDNQIKHESFVEDINMLLNTGDVPNIFPADEKADLVEKMQTAARTEGEK--VEATPLSMYNFFIERGTNRAYFSLAMSPIGDAFRTRLRMFPSLINCCTIDWFQSWPTDALELVANKFLEDVELDDNIRAEVVSMCKYFQESVKKLSVDYYNTLLRHNYVTPTSYLELILTFKTLLNSKRQEVDTIRNRYLAGLQKLEFASSQVAVMQVELTALQPQLIQTSEDTAMMMVKIELETKEADAKKLLVQADEKEANAAAAISQAIKNECEGDLAEAMPALEAALAALDTLNPSDITLVKSMQNPPGPVKLVMESICVMKGLKPERKPDPSGSGKMIEDYWGVSRKILGDLKFLESLKTYDKDNIPSVIMKRIRERFIDHPDFQPAVIKNVSSACEGLCKWVRAMEVYDRVAKVVAPKRERLREAEGKLEIQMQKLNQKRAELKLVEDRLQDLNDEFELMNRKKNSLEKNIEICSQKLVRAEKLISGLGGEKDRWTEAARQLGIRYDNLTGDVLLASGTVAYLGAFTVDYRAQCQNEWLVSCKDKVIPGSVDFSLSNTLGDPIKIRAWQIAGLPVDSFSVDNGIIVSNSRRWPLMIDPQGQANKWVKNMEKTNKLSVIKFSDTNYVRTLENALQFGTPVLLENVGEELDAFIEPILLKATFKQQGVEYMRLGENIIEYSREFKFYITTRLRNPHYLPEVAVKVCLLNFMITPLGLQDQLLGIVAAKEKPELEEKKNKLILESAQNKKQLKEIEDKILEVLSLCEGNILEDETAIKILSSSKVLSEEISEKQEIASVTETQIDETRMGYKPVAVHSAAIFFCISDLAHIEPMYQYSLTWFINLYVQSLANSNKSDELDLRIEYIIEHFTLSIYNNVCRSLFEKDKLLFSLLLTVGLLKERKAIDEEVWYFLLTGGVALDNPFPNPAPEWLSEKSWGEIVRASSLQKLKGLMEDVMQNIKVWKDIYDSAWPHEESLPSPWF--FLQTLEKIAILRCLRPDKIVPAIQNFICETMGKIFIEAPTFDLQGSYGDSSCCVPLIFILSPGADPMAGLLKFADDVSMGGTKTQTISLGQGQGPIAANMINKAIHEGTWVVLQNCHLATSWMPALEKICEEVIVPENTNSEFRLWLTSYPSEKFPVSILQNGIKMTNEPPKGLRANLLRSYLNDPISDPLFFQSCTKPVIWQKLLFGLCFFHAIVQERRNYGALGWNIPYEFNESDLRISMRQIQMFLNDYEEVPFEALTYLTGECNYGGRVTDDKDRRLLLSLLSMFYCKEIETD-NYHIAPGDAYVIPPYGSYQSYIEYLRTLPITAHPEVFGLHENADITKDNQETNQLFQGVLLTLPRQSGGSGKSPQEVVEELAQDILSKLPNDFNLEEVMKKYPVVYKESMNTVLRQELIRFNRLTKVVRRSLIDLGRAIKGQVLMSSELEEVFNSMLVGKVPAMWAAKSYPSLKPLGGYVADLLARLTFFQEWIDKGPPVVFWISGFYFTQSFLTGVSQNYARKYTIPIDHIGFEFEVTPKETTMENIPEDGAYIKGLFLEGARWDRSTSQIGESLPKILYDPLPIIWLKPGESASFLHQDIYVCPVYKTSARRGILSTTGHSTNYVLSIELPTDMPQKHWINRGVASLCQLDN 4083          
BLAST of Dynein heavy chain 7 axonemal vs. UniProt/SwissProt
Match: sp|E9Q8T7|DYH1_MOUSE (Dynein heavy chain 1, axonemal OS=Mus musculus OX=10090 GN=Dnah1 PE=1 SV=1)

HSP 1 Score: 3085.05 bits (7997), Expect = 0.000e+0
Identity = 1678/3687 (45.51%), Postives = 2382/3687 (64.61%), Query Frame = 3
Query: 1212 EHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDW--AGDKTKIYLNPIILPE-IIEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFEEFA-KYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMD--------YANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQ---NLGDMNEINKYLK--KSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAAL----GDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAF---NDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRF-----------IAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIK-LIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILN-WH---IITQNF------SPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDV---ELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGE-MKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSA-WLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYA-PPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYD--EAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLD 12110
            ++P F++ L+L+++ + +   +E FE +LLN++D+ +    +V ++E  +  D   +GD     L  + L E ++E+ ++ + N +    +    + KE+ KY  L N ++   +    ++        E    +LK+   L   +      SI +G F +  D + ++LSK+ + +   +LD + +   +    + +E+  I RK    P + E++ EL        R  M  + +KL    ER++ +M         + N  T D N   +  +  +++    D  ++   + +E+F+      +  F E+L+  +  V  F     +   +EI   ++  K Q+ D +  A +     +N  E  FG  +T Y     +    +PYL L+ TA ++    + WM   +  ++ +Q++ +V   ++T+ K  KQF++ P  +++A  ++T++EEFK ++PLIQ L  PG+R+RHW+ +S+ +   +R +  +  ++ ++MNL+  I     ++E AGKE+ +E+A++KM+ EWS + F V+ Y+ET T+IL S D+   +LDDHIV TQ+M  SP+ KPFE  I  WE+KL L Q++L+EWL  Q  WLYLEPIFSS DI  Q+P E +++ ++++ W++IMK    ++ V+ V   +++LD L+  N+LL+ + KGL++YLE KR  FPRF+FLS+DELLEILS+TKDPT VQPHL+KCFE IA L+F E L+ITHM S+E E V L   I  S     VE WLLE+E  M ASV   I   +  Y    R EWV  W GQ  +A    YWT+ V +A++ G  +   + +++  Q+ ++VALVRG+LS+  R  L ALIV++VHA+DV+  LI E V + +DF W+ QLRYYW ++++  + +N+   YGYEYLGN+ RLVITPLTDRCY TL GALHL  GGAP GPAGTGKTETTKDL KA+A Q VVFNCSD LD++A+GKFFKGLAS GAW+CFDEFNRID+EVLSVVAQQI TIQ+A   + +  MFEG E+ L P+CAVFITMNPGYAGR+ELPDNLKALFR VAMMVPDYA+IAEISLYS GF  A  LA KI  T++L SEQLSSQ HYD+GMRAVK+V++AAGNLK + P  +E+++ LR+I DVN+PKFL  DL LF+GI SDLFP +     DY IL++ I+ +C K NL+    F+ K  Q+YE  +VRHG M+VG    GK++ Y+VLAAA+    G     G + E  V Y +LNPK+ITMGQLYG+FD ++HEW+DG+ +   RA A ++  ++KW +FDGPVDA+WIENMNTVLDDNKKLCL SGEII+L+ +  ++FE  DL VASPATVSRCGMVY+EP+ LG  P    WLK L PAI   +++ +  +F ++++  I  + +   KE+  +++ N+  SLL L+DC    F       KI       I   +E  F F+  WS+GAT +   R +F +  R  M    +E+ ++                  +P  G +YDYR              E+ EN    W  W +      ++  D  +  IIVPT DTV+ +YL+ +LLT+ KP L +GPTGTGK+  + + LL  +  + Y  + + FSA+TSANQTQ++I SKLD+RRKGVFGPP+G+  I F+DDLNMP  ETYGAQPPIELLRQW+DH  WYD K   A K L+D+ F+ AMGPPGGGRN ITPR  RH N ++  E  + +   IFS IL  W    +  +++      +P+       L+ AT++VY    + LLPTPAKSHY FNLRD S+V QG+L++ P+ +E+   + RLW HE  RV+ DRLV ++DR WF     E+    + E+F + F         KV     + ++Y DF    S  K Y  +T    + + +E Y+++YNQ++   + LVLF  A+ H+ RISR L+Q   +ALL+GVGGSGR SLTRLA+ MA+Y+ FQ+E+SK+Y  +EWRED+K++L K+   +    FLFSD QIK ESFLEDINN+LN+G++PN+Y  DE+ ++   M +   Q   ++ T  + +A Y     RVR  +H+VL MSPIG+ FR RLR+FPSLVNCCTIDWF  WP +AL +VAT FL ++   E  + +  G I +C   H S      +YL EL+R+NYVTP SYLEL++ F  L+ +K+ E++  K R + GL+KL   + D++ MQ+EL   +P L EA+K+   TM  ++  +  A +  K V+ EE  AN++A  A+AI ++   DL EA+P L++AL +L  L   D+T VR M  PP GV+LV+EAVC++KGIKP +V      G K++D+W P K LL +  +FLE L  FDKDNI   ++K I + Y+ N++F+P  IA  S AC  +C+WV A+ KY  VAK V PK+ AL +A ++       L + +  L EV+D +  +  +      +K +LE K + C ++L RA++LI GL  EK RW +   +L     N+ GD+L+++G VAYLG FT  +R    + W++ +    +P + K +LITTLG+PV+IRSW I GLP D  S+ENG+I   S+RW   IDPQGQANKWIKNME+++ L V KL+D DF+R +EN I+FG P LLEN+GEELDP LEP+LLKQT+KQ G+I +KLGD++I Y  DFR YITTKL NPHY PE S K+TL+NF ++P GL+DQLLG VV+ ERP+LEE KN+LI  +A  +++LK++ED+IL  LS+SEGN ++D   IKVL +SK  + EI  K    E+TE+ ID  R+ Y+P+A+ + ILFF ++DLAN+DPMYQYSL WF+N+F   I NSE+++NL++R+ N+  Y T+SLY NVCRSLFEK KL+F+F+LC  I+ ++  I + EWR+LL+GG  +    ENP+  WL  ++W ++  L +L  F      F+     ++ I+DS EPH + LP  W   L D F K+ +LRCLR DK+ +A+Q+FV   +  ++IEP   +L   F +SN T+PL+F+LSPG DP A L KFA++  F   KF ++SLGQGQGP A  M++  I+ G WV  QNCHLAPSWM  LE+ +E +NP+  H DFRLWLTS PS+ FPV+ILQNG KMT EPP+G++ N+ +SY S  +SD +F  + + +  +K LL  LC FH    ERRKFGP+G+NI YEF + DLRI + QL MF+D+Y+ + Y  L+Y  GE NYGGRVTDDWDRR ++ IL+ FY   V    ++ + +SG Y+  PP  D  GY+ YIK+LPLN  P +FG+H NA+IT    ET  LF++IL  Q + SS GG+S +++V++V+ ++L ++P   + + V +K+P  YE+SMNTVLVQE++R+N LL  I  +L ++ KAIKGLVVMS +LE + IS+  + +P +W  K+YPSLKPL S++ D L RL F+  W ++G PP+FWISGF+F QAFLTG  QN+ARK+ I ID + FD+++L + + +  E P+ G Y+ GLFL+GARWD     + ES PK L   M VIWL P    ++ N+  YL P+YKT  R GTLSTTGHSTN+VIA+ +P+++P+ HWI RGVAL+C LD
Sbjct:  640 KNPLFIVDLVLDNSGVHYSTPLEHFEMILLNLFDKGILATHAVPQLEKLVMEDIFISGDP---LLESVGLHEPLVEELRANITNAMHKAMMPLQAYAKEYRKYLELNNNDISTFLKTYQTQCPSAEEVREVVITHLKEKEILDNSLP----SSIIIGPFYINVDNVKQSLSKKRKALATSMLDILAKNLHKEVDSICEEFRSISRKIYEKPNSIEELAEL--------RDWMKGIPEKLVFLEERIVKVMSDYEVMDEFFYNLTTDDFNDKWAANNWPSKILGQIDMVRQQHVEDEEKFRKIQLMDQNNFQEKLEGLQLVVAGFSIHVEIARAHEIANEVRRVKKQLKDCQQLAML-----YNNRERIFGLPITNYDKLSRMVKEFQPYLDLWTTASDWLRWSESWMNDPLSAIDAEQLEKNVIESFKTMHKCVKQFKDIPACQEVALDIRTRIEEFKPYIPLIQGLRNPGMRNRHWEVLSNEININVRPKANLTFARCLEMNLQDHIESISKVAEVAGKEYAIEQALDKMEKEWSSILFNVLPYKETDTYILKSPDEASQLLDDHIVMTQSMSFSPYKKPFEQRINSWETKLKLTQEVLEEWLNCQRAWLYLEPIFSSEDITRQLPVESKRYQTMERIWRKIMKNAYENREVINVCSDQRLLDSLRDCNKLLDLVQKGLSEYLETKRTAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIARLLFQEDLEITHMYSAEGEEVKLSFSIYPS---SNVEDWLLEVERSMKASVHDIIEMAIKAYPTMLRTEWVLNWPGQVTIAGCQTYWTMEVAEALEAGNISSKLFPQLSK-QLSDLVALVRGKLSRMQRMVLSALIVIEVHAKDVVSKLIDENVVSVHDFEWISQLRYYWTKDDLYIRAVNAEFIYGYEYLGNSGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRVERFMFEGVEIPLVPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYAMIAEISLYSFGFNEANVLAKKITTTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENPTMNEELICLRAIRDVNVPKFLQEDLKLFSGIVSDLFPTIKEEETDYGILDQAIRRSCEKNNLKDVEGFLIKCIQLYETTVVRHGLMLVGPTGSGKSNCYRVLAAAMTLLKGKPSISGGVYE-AVNYYVLNPKSITMGQLYGEFDLLTHEWTDGIFSSLIRAGAIASDTNKKWYMFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLTEAMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLMPFVECWLKRL-PAIIKPYEEQFKSLFTKYLENSINFV-RNTVKEVIASTNSNLTMSLLKLLDCFFRPFLPREGLKKIPSEKLSHIPELIEPWFIFSLVWSVGATGDHTSRISFSQWLRLKMR---LEQVKLG-----------------FPEDGLVYDYRLDDAGISSTEDDDEEEDENKQVSWVKWMD-YSAPFTMMPDTNYCNIIVPTMDTVQMSYLLGMLLTNHKPVLCIGPTGTGKTLTVSNKLLKYLPLE-YISHFLTFSARTSANQTQDLIDSKLDKRRKGVFGPPLGRNFIFFIDDLNMPALETYGAQPPIELLRQWMDHGGWYDRKVIGAFKNLVDINFVCAMGPPGGGRNAITPRLTRHFNYLSFIEMDEVSKKRIFSIILECWMDGLLGEKSYREPVPGAPNIDDLTEPLVDATINVYGIITSQLLPTPAKSHYTFNLRDLSKVFQGMLMAEPSKVEDKVQLLRLWYHENCRVFRDRLVNEEDRSWF----DELLEAQM-EEFGVAF--------NKVCP--FQPILYGDFMSPGSDVKSYELITSESKMMQVIEEYMEDYNQINTAKLRLVLFVDAMSHICRISRTLRQALGNALLLGVGGSGRSSLTRLASHMAEYECFQIELSKNYGMSEWREDVKKVLLKAGLQNLPITFLFSDTQIKNESFLEDINNVLNSGDIPNIYSADEQDQIINTM-RPYIQEQGLQPTKANLMAAY---TGRVRSNIHMVLCMSPIGEVFRARLRQFPSLVNCCTIDWFNEWPAEALKSVATTFLSEIPELECSEEVIQGLIQVCVFIHQSVASKCVEYLAELARHNYVTPKSYLELLNIFSILIGQKKMELKTAKNRMKSGLDKLLRTSEDVAKMQEELEIMRPLLEEAAKDTMLTMEQIKVDTAIAEETRKSVQAEEIKANEKANKAQAIADDAQKDLDEALPALDAALASLRNLNKNDVTEVRAMQRPPPGVKLVIEAVCIMKGIKPKKVPG-EKPGSKVDDYWEPGKGLLQDPGRFLESLFKFDKDNIGEAVIKAI-QPYIDNEEFQPAAIAKVSKACTSICQWVRAMHKYHFVAKAVEPKRQALREAQDDLEVTQRILEEAKHHLHEVEDGIATMQAKYRECVAKKEELEMKCEQCEQRLGRADKLINGLADEKVRWQETVENLENMLDNIFGDVLVAAGFVAYLGPFTGQYRTTLYEYWVNQLTVHHVPHTSKPTLITTLGNPVKIRSWQIAGLPNDTLSVENGVINQFSQRWTHFIDPQGQANKWIKNMERESGLDVFKLSDRDFLRSMENAIRFGKPCLLENVGEELDPALEPVLLKQTYKQQGNIVLKLGDTVIPYHEDFRMYITTKLPNPHYSPEISTKLTLINFTLSPSGLEDQLLGQVVAEERPDLEEAKNQLIVSNAKMRQELKDIEDQILYRLSSSEGNPVDDMELIKVLEASKMKAAEIQAKVRIAEQTEKDIDLTRMEYIPVAVRTQILFFCVSDLANVDPMYQYSLEWFLNIFLSGIANSERADNLKKRIVNINRYLTFSLYSNVCRSLFEKHKLMFAFLLCVRIMMNEGKINQAEWRYLLSGG-SIQTMFENPAPQWLSDRAWRDILALSNLPTFATFSNDFVMYLSEFQAIFDSAEPHRELLPGIWNAYL-DEFQKLLILRCLRGDKVTNAMQDFVATHLEPRFIEPQTANLSAVFKESNSTTPLIFVLSPGTDPAADLYKFAEEMKF-SKKFSAISLGQGQGPRAEAMMRNSIERGKWVFFQNCHLAPSWMPALERLIEHINPDKVHRDFRLWLTSLPSNKFPVSILQNGSKMTIEPPRGVKANLLKSYNS--LSD-DFLHSCQKVVEFKSLLLSLCLFHGNALERRKFGPLGFNIPYEFTDGDLRICISQLKMFLDEYEDIPYKVLKYTAGEINYGGRVTDDWDRRCVMNILEDFYNPAVLSS-EHSYSNSGIYHQIPPTYDLNGYLSYIKSLPLNDMPEIFGLHDNANITFAQNETFALFNAILQLQPKSSSMGGQSREELVEDVAENILLQVPGPIELQEVTKKFPVLYEESMNTVLVQEVIRYNKLLEVITQTLSDMLKAIKGLVVMSLELELMSISLYNNTVPELWKSKAYPSLKPLASWIMDLLLRLDFMHSWINDGIPPVFWISGFFFPQAFLTGTLQNFARKFVISIDTITFDFKVLPEASSEIKERPQTGCYIHGLFLEGARWDSMNFQLAESRPKELYTEMAVIWLLPEANRKVQNQDFYLCPIYKTLTRAGTLSTTGHSTNYVIAVEIPSNQPQRHWIKRGVALICALD 4249          
BLAST of Dynein heavy chain 7 axonemal vs. TrEMBL
Match: A0A4E0RCL6 (Dynein heavy chain 7 axonemal OS=Fasciola hepatica OX=6192 GN=D915_005250 PE=4 SV=1)

HSP 1 Score: 5845.77 bits (15164), Expect = 0.000e+0
Identity = 2895/4096 (70.68%), Postives = 3402/4096 (83.06%), Query Frame = 3
Query:   63 RGRKGPDLTKLLPTIPMKRVKPEWAQNPPSFTLDGKQKINEDAGIELIYELTAKPPTKPRKLKGEDLAFERSQLRKDREKFRKALVDMILQGEDRPIKESIETVRLPPLTQEKTPV--GMSATEKDILRYYYYIHNGIDTEHVAKMEXX-XXXXXXXXXXXXXXAEHPXXXXXXXXXXXXXXXXSVKKAIVDFVLKE-------PREKET------DDTPIPEHRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESM-------SHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKT-KIYLNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLL----------------SEGE--------------DRH----------SFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIA---------------EKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD 12113
            R + G     +LP     R +PEW    P+F  + +  +  +  +++I EL  +  +  R    + +  E  +  K +E FR+ LV++ L+GED P+ E    V  P   QE   +  G+++ EKDILRYYYYI+NGID +H+A ME+    +    +  N  ++    L+E LEDEI+EDY+ SVKKAIVDFVL+E       P EK+       D+   PEHRKEL +VPKPW  SF+ A++FCQ+HL+VTN CM QVL+LW  SF NLRLVD+EE   K +AIEL  FQ  C +HIEAAKE+L+KKWLN+VQNI+YQGNKKKL+PS      LE ++ CA+TLMT +LQNLGL SM+DY NL+  P RLIE +        H+M +KR         D +   E PGF+LRLIL+++ IKF+PSIE+FE +LL+++D M+KVI S+ RIE+RLYS+W         L+P+IL EI++ +K++VR +L  E+ GP  H +E+DKY+ L++R+ +++I+ LL                SEG                +H          +FE+ A+ L  Y  L K+I+Y+SRR+I+LG+FE+ CD+LIRAL+KR + + ++LLDR++E HR +NR L+KEYE I  KAL +P +   +M+L +FV+ TE++TM +LE+KLDKS +RL+FLMD+A  N SDM +N  VF  H RM  +F+EN++    K+EEF+  L+++RERF+EEL++YR+QV+EFQ LGD+NEIN+YLKK+Q LD KLE A+ +IE FN EEEA  WD T YP+R EVQN LRP+LKLYET VEFN KY++WM+G MEKV+P+QVD +V N YRTL++LEK F++ P P+KIA+KV+ KVEEFKEH+PLI+TLF PGLRDRHW QIS++VGYTLRNEEGMCL+KL+DMNLEP I KF+ ISEAA KE +LEKA++KM+ EW+P+EF +I YR++GT ILSSVDDIQ++LDDHIVKTQTMRGSPFIKPFEA+I+DWE KLIL QDILDEW+KVQATWLYLEPIFSSPDIMAQMP+E RKFT+VDKTWKE+MK    D++V+ VI I+KMLDK KKSN+LLE+ILKGLN YLEKKRL+FPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASL FT+ LDITHMKSSENEIV LK+VISTSKARG VEKWLLELE +M  SV L IS  L DY  +PR+EWVK W GQ VLA SM++WT+  + AI  G  A+  YLKVNN QI+EIVA+VRG+LSKQNRTTLQALIVLDVHARDVL  LI  +  ++NDF+WL QLRYYW E  ++T+MINS L YGYEYLGNT RLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAI A+Q  L+FEGT++KLDPTCAVFITMNPGYAGRSELPDNLKALFR+VAMMVPDYA+IAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQ HYDYGMRAVKSVLTAAGNLKLKYP+EDED+LMLRSIIDVNLPKFLNHDLPLFNGI SDLFPGV RP PDY++LN  IK  C + NL+++ FF+EKIQQIYEMMIVRHGFMIVG+PFGGKT AY+ LA AL +ICE+GLMEENKVQYT++NPKAITMGQLYGQFDPVSHEWSDG+LAVSYRAFATSTTPDRKWLIFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQL+P+TNLIFEPMDLE ASPATVSRCGM+Y+EPASLGWRP+F SWL  LP  I   HK +W D+FERF+DAGIA ++KGGGKELSPT +IN+VKSL+NLIDC +  F +E  + Q D +   T +E +FFF+Y WSIGATT+E GR+ FDKL RELMNGGMME+TR +LALVE VPPPLQDY   +P K +++DY+ +                 +++N   KW  W + ++    I KD  F+EIIVPT +TV+  +L+ L + H KPCLFVGPTGTGKSCYI+DFLLN++ KD+YKPN +NFSAQTSANQTQNII SKLDRRRKGVFGPP+GKK+IVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLK   +IKLIDL FIGAMGPPGGGRNP+TPRFLRHLNT+TINEF D+TM TIF+ I+ WHI T+ F PDF     Q + ATL VYK AM NLLPTPAKSHYLFNLRDFSRVIQGVLLS P  I+  A  +RLW HE+FRVYYDRLV   DR+WFF ++ +     L+  F++LF HL  ++D KVTED +RSL++CDFSD +   K+Y+EV D+E LR   E YLDEYNQ+SKKPMNLVLFRFAIEHV RI+RILKQPRSHALLVG+GGSGRQSLTRLAA M+D+DLFQVEISKSY + EW+EDLKRILRKS+ET+NHAVFLF+D QIKQESFLEDINNLLNAGEVPNLYP DEK EVCEKMRQ+DR R++ +QTDGSPVAL+N+FVQRVR+QLHIVLA+SPIGD+FRNRLRKFPSLVNCCTIDWFQ WPEDALTAVATR L++VE+   +++GCI+LCK FHTSTR LS++YL+EL R+NYVTPTSYLELI+TF  LL+KKRTEV  QK RYEVGLEKL SAA +ISVM KEL+  QPKLV+ASKEVD  M++VEQQS EA+KQEK+V+ +EA+A +QA+ AEAIK ECD DLAEAIPILE ALKALETLTPADITIV+TM SPP GVRLVMEAVCVLKGIKPDRVNDP GSGKK+ED+WGPSKRLLG+MKFLE LK FDKDNIP  IMK IRE+Y+ N DFKPER+AVASTACEGLCKWV A+++YD VAK+VAPKK AL +AMNEY TAM++LN KRAALKEVQD+L++LT++LE NKR+KIDLENKVD+C+KKL RAEQLIGGLGGEK RW +AA +LG ++INLTGD+L+SSGVVAYLGAFTSSFR ++TKQWL +VME +IPCS+ FSL++TLG+PVEIR+WNI GLPTD+FS+ENGIII+N+RRWPLMIDP  QANKW+KNMEKKNNLQVIKLT+ DFVR LENCIQFGTPVLLE IGEELDP+LEPLLLKQTFKQGG++CIKLGDS+IEYS +FRFY+TTKLRNPHYLPET+VKVTL+NFMIT EGLQDQLLGIVV+RERPELE+EKNKLI Q A NKKKLKELED+IL VLS+SEGNILEDESAI+VLNSSKELSNEIAEKQAYFEETEQKID ARLGYVPIA+HSTILFFSIADLANIDPMYQYSLTWFINLFN+ IDNSEKS++L QRL+NL+SY TYSLYCNVCRSLFEKDKLLFSF+L  N+ +H+  + E EWRFLLTGGVGLDNPH NP+ W P KSWDELCRLDD++VF GIR+ F  +  +WK IYDS  PH Q LP E  + L+    +MCVLR LRPDKIV AIQN+V E++GK+YIEPPPFDLPG+F DS+CT PLLF+LSPGADPM ALLKFA+D GFGG KFESLSLGQGQGPIA++MI+RG+KEGTWVLLQNCHLAPSWMG+LEKTVEELNP+TTHPDFRLWLTSYPS  FPVAILQNGVKMTNEPPKGLRFN+WRSYLSDPISD EFF +  +  AWKKLLFGL FFHAIVQERRKFGP+GWN  YEFNETDLRISVQQLH+F++QY  VQY+AL+YLTGECNYGGRVTD+WDRRTL T+L +FYC  V E+  Y  D+SG YY P D  YEGYI+YIK+LPLNP P VFGMH+NADITKD QET L+F +ILLTQ++G+S  GKS D+ VDEV+ADVL+RLP N++TE+V+RKYPT+YEQSMNTVLVQEMVRFN LLS IRSSL +IR AIKGLVVMS+DLE VV ++L SKIPGMWM KSYPSLKPLGSYVNDFLARLKFL DW+D   PP+FW+SGF+FTQAFLTGVQQNYARK+TIPIDLL F++E+L+D+ Y   PE+GAY+ GLFLDGARWDRK K + ES PKVLQDPMP IWL+P++KS+I  +PSY +P+YKTSERRG LSTTGHSTNFV+ M L +DKPE HWIMRGVALLCQLDD
Sbjct:    8 RTKTGNAAHLVLPVFDDLRHQPEWKIASPNFAPNTRIVLGNEPKVDIIKELNTRNDSIQRSHPHKHV--ESWKNLKTKENFRRGLVELALRGEDAPVFE----VLPPSYGQEDKEISSGIASREKDILRYYYYIYNGIDMDHIAPMEETWMEHMQSMIRQNVRESADASLMEKLEDEIREDYMFSVKKAIVDFVLRESADKLPSPAEKQKICDMTDDECKPPEHRKELEIVPKPWHSSFVAAHRFCQRHLFVTNACMLQVLDLWHTSFANLRLVDIEELYSKSSAIELTGFQQICTKHIEAAKERLLKKWLNEVQNIFYQGNKKKLIPSNDGSGKLEAYYRCAATLMTENLQNLGLASMLDYKNLVCRPPRLIERIHPEKQYQGHIMFNKRF--------DTSFSYELPGFILRLILDESSIKFDPSIEEFENVLLSMFDNMLKVIQSIPRIETRLYSEWQTTSADNAALHPVILDEILQDYKNSVREMLRIEAKGPESHTREYDKYQFLVSRQAERDIEELLNPKEPENVPEKPKRTSSEGSETETNEPEDEEEDAGQHKKTPEVSKGPNFEDLARELIKYIRLSKRIQYESRRTIKLGLFEIHCDDLIRALAKRVEGIVDRLLDRILEDHRTTNRALIKEYESIASKALTVPTDIAHLMQLTEFVNQTEKVTMHDLERKLDKSKDRLLFLMDHAQLNPSDMRINSQVFEWHMRMTDVFEENRRTAVVKREEFEIGLRYRRERFLEELEAYRRQVDEFQGLGDLNEINRYLKKAQALDNKLELAVAKIEQFNSEEEALKWDTTVYPLRGEVQNTLRPFLKLYETTVEFNNKYREWMDGPMEKVDPEQVDNEVSNQYRTLYRLEKSFDSLPAPRKIASKVRVKVEEFKEHLPLIRTLFNPGLRDRHWVQISEVVGYTLRNEEGMCLAKLVDMNLEPHIAKFDMISEAATKEHSLEKALDKMRKEWAPIEFNLIPYRDSGTLILSSVDDIQVLLDDHIVKTQTMRGSPFIKPFEADIRDWEQKLILTQDILDEWMKVQATWLYLEPIFSSPDIMAQMPDESRKFTTVDKTWKELMKNANVDRKVMVVITIDKMLDKFKKSNDLLEAILKGLNAYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLTFTKNLDITHMKSSENEIVELKEVISTSKARGAVEKWLLELEDNMTTSVHLAISNALEDYLQSPRREWVKTWCGQAVLAGSMFFWTLETEKAISSGASAMGDYLKVNNQQIEEIVAMVRGKLSKQNRTTLQALIVLDVHARDVLAELISVKCGSKNDFSWLSQLRYYWEEKQLVTRMINSQLNYGYEYLGNTGRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAINAKQARLVFEGTDIKLDPTCAVFITMNPGYAGRSELPDNLKALFRAVAMMVPDYAMIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQAHYDYGMRAVKSVLTAAGNLKLKYPNEDEDVLMLRSIIDVNLPKFLNHDLPLFNGITSDLFPGVERPSPDYEVLNSAIKNACDRTNLQNTDFFVEKIQQIYEMMIVRHGFMIVGDPFGGKTKAYQTLALALAEICEKGLMEENKVQYTVINPKAITMGQLYGQFDPVSHEWSDGILAVSYRAFATSTTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQLAPTTNLIFEPMDLEAASPATVSRCGMIYLEPASLGWRPLFRSWLNTLPAGIKTQHKDVWEDMFERFVDAGIAMVRKGGGKELSPTGNINLVKSLMNLIDCHVSDFKEENILDQFDPQVANTIVECIFFFSYVWSIGATTDENGRRLFDKLTRELMNGGMMEDTRQRLALVELVPPPLQDYGKPFPIKRSVFDYQLVVNIPKPGAPPPPPSEDNEEDNSPVKWALWKDTIRLAPPIPKDTTFHEIIVPTVETVRCYHLLELFILHCKPCLFVGPTGTGKSCYILDFLLNKLPKDVYKPNNLNFSAQTSANQTQNIIFSKLDRRRKGVFGPPMGKKMIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKTNESIKLIDLIFIGAMGPPGGGRNPVTPRFLRHLNTVTINEFEDDTMRTIFTRIMEWHITTRGFGPDFNKVPAQFVAATLAVYKGAMQNLLPTPAKSHYLFNLRDFSRVIQGVLLSTPENIDSVA-ARRLWVHEVFRVYYDRLVDSNDRKWFFEFVAQCVQSQLDTSFEVLFAHLTGNDD-KVTEDHLRSLMFCDFSDPQKG-KQYVEVRDVERLRNVTESYLDEYNQLSKKPMNLVLFRFAIEHVCRIARILKQPRSHALLVGIGGSGRQSLTRLAAHMSDFDLFQVEISKSYGTNEWKEDLKRILRKSSETENHAVFLFTDTQIKQESFLEDINNLLNAGEVPNLYPPDEKMEVCEKMRQLDRSRERSKQTDGSPVALFNYFVQRVREQLHIVLALSPIGDSFRNRLRKFPSLVNCCTIDWFQAWPEDALTAVATRSLKEVEMTDDVREGCINLCKYFHTSTRELSQRYLIELERHNYVTPTSYLELITTFMTLLEKKRTEVLLQKSRYEVGLEKLSSAAEEISVMSKELQSLQPKLVQASKEVDAVMVVVEQQSAEAAKQEKVVRVDEAVAGEQARNAEAIKEECDADLAEAIPILEMALKALETLTPADITIVKTMKSPPAGVRLVMEAVCVLKGIKPDRVNDPGGSGKKVEDYWGPSKRLLGDMKFLENLKGFDKDNIPNSIMKTIRERYIPNPDFKPERVAVASTACEGLCKWVIAIDRYDAVAKIVAPKKEALARAMNEYTTAMNALNLKRAALKEVQDRLRLLTDDLEMNKRKKIDLENKVDICTKKLERAEQLIGGLGGEKSRWTEAAQNLGEQYINLTGDVLISSGVVAYLGAFTSSFRQDQTKQWLIEVMESAIPCSEDFSLVSTLGNPVEIRAWNIAGLPTDDFSVENGIIIANARRWPLMIDPTSQANKWVKNMEKKNNLQVIKLTNTDFVRTLENCIQFGTPVLLEGIGEELDPMLEPLLLKQTFKQGGALCIKLGDSVIEYSPEFRFYMTTKLRNPHYLPETAVKVTLMNFMITEEGLQDQLLGIVVARERPELEDEKNKLILQGAANKKKLKELEDQILGVLSSSEGNILEDESAIQVLNSSKELSNEIAEKQAYFEETEQKIDAARLGYVPIAVHSTILFFSIADLANIDPMYQYSLTWFINLFNMGIDNSEKSDDLNQRLENLRSYLTYSLYCNVCRSLFEKDKLLFSFLLAINMTRHEGQLNEQEWRFLLTGGVGLDNPHTNPTDWFPAKSWDELCRLDDVTVFPGIREHFCSKTGAWKNIYDSGNPHEQPLPVE-LKHLRTRIQQMCVLRVLRPDKIVPAIQNYVLEQMGKEYIEPPPFDLPGTFADSSCTVPLLFVLSPGADPMVALLKFAEDMGFGGSKFESLSLGQGQGPIALRMIERGVKEGTWVLLQNCHLAPSWMGMLEKTVEELNPDTTHPDFRLWLTSYPSRDFPVAILQNGVKMTNEPPKGLRFNLWRSYLSDPISDQEFFQSCPNEHAWKKLLFGLVFFHAIVQERRKFGPLGWNTPYEFNETDLRISVQQLHIFLEQYSDVQYEALRYLTGECNYGGRVTDEWDRRTLKTVLMRFYCPPVVEEATYMLDESGTYYVPEDTHYEGYIDYIKSLPLNPAPSVFGMHENADITKDQQETNLMFTNILLTQSKGTSSAGKSVDETVDEVAADVLSRLPQNYNTELVLRKYPTRYEQSMNTVLVQEMVRFNVLLSVIRSSLSDIRLAIKGLVVMSADLEAVVAAILASKIPGMWMSKSYPSLKPLGSYVNDFLARLKFLQDWYDQEAPPVFWMSGFFFTQAFLTGVQQNYARKHTIPIDLLSFEFEVLEDQKYTAPPEEGAYISGLFLDGARWDRKTKQLAESMPKVLQDPMPPIWLQPIRKSDIKPRPSYTAPVYKTSERRGVLSTTGHSTNFVLPMLLTSDKPESHWIMRGVALLCQLDD 4085          
BLAST of Dynein heavy chain 7 axonemal vs. TrEMBL
Match: A0A267ES38 (EF-hand domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029056g3 PE=4 SV=1)

HSP 1 Score: 5800.71 bits (15047), Expect = 0.000e+0
Identity = 2862/4000 (71.55%), Postives = 3363/4000 (84.08%), Query Frame = 3
Query:  165 GKQKINEDAGIELIYELTAKPPTKPRKLKGEDLAFERSQLRKDREKFRKALVDMILQGEDRPIKESIETVRLPPLTQEKTPVGMSATEKDILRYYYYIHNGIDTEHVAKMEXXXXXXXXXXXXXXXXAEHPXXXXXXXXXXXXXXXXSVKKAIVDFVLKEPREKETDDTPIPEHRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWL-----------------KVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD 12113
            G     E+   +L++ELT K   K +K+  +    +R++++KDREKFRKALVD+ILQGED+P  ES+E  ++  L Q++   G++  EKD+LRYYYYIH+GIDTEHVA MED WM N+ + +    +  H ELLEDLEDEI+EDYLLSVKKAIVDFVLKEPREKE +   +PEHR+EL+VVPKPW +SF    +   + L++TNPCMNQVLELW  +F  LRLVD+ EF+ K   +EL++FQ  CM+HI+AA++KL+K+WL+++Q+I+Y+G+K+K +PS  +   L  F+NCA+ LMTS LQ+LGL SM DYT+LL  P           T  R+              EH GF+LR +L+D  IKFEP+ +DFET+ LN+YD M+KVI ++ RIE++LYS + G+     L P ILPEI+  HKS V  V+  E  GP +H+K+FDKY+ +++++ D +ID  L E    H+F+E+A+ L+ +    ++I++ S RS+RLGMF++ CD+LIRAL+KR + +CE++L R+++ HR  N+EL+ +Y+ I  KAL LP+NTEQ+MEL  FV   E  TM+ L  +L++S +RL+FL++  +F   DM LN  VF    RM +IF+E++ N  +K+++FQ NLKFKR++F+ EL+ Y K+VEEFQ  GDM E+ +YL K+Q L   LEAA  ++E  N EEEAFGW  T YP RQ++   LRPY +LYE  V+F+ KYK+WM+G M  V PD V  DV   +R L+KLEK F++ P  KKIA+K+K KVEEFKEH+PLI  LF PGLR+RHW QISDIVGY L+ +E MCLSKLIDMNLEP++ KFESISEAA KE NLEK M KMKNEW  +EF +I YRE+GT ILSS+DDIQL+LDDHIVKTQTMRGSPFIKPFE EIKDWE  LIL+QD+LDEWLKVQATWLYLEPIFSSPDIMAQMPEEGR+FT+VDK W+EIMK  I DKRV+ VI I+K+L+KL+KSNELLE I KGLN YLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASL FT+ LDITHMKSSE E+V LK+VIST+KARGQVEKWLLELE DMI SVR+     + DY  TPR +WV+ W GQ VLAI   +WT  V  A++EGP+++D YLK +NSQIDEIV LVRG+LSKQNRTTLQALIVLDVHARDVL NLI+ +V  ENDF WL QLRYYW ++N++T+MINSML+YGYEYLGN+ RLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDY+ALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQ+A+ A  DTL FEGT+LKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALI+EISLYSCGF+NARPL+VKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYP+EDEDILMLRSIIDVNLPKFLNHDLPLF GIASDLFPGV RP PDYD+ N  +KENC KMNL+ + FF+EKIQQIYEMMIVRHGFMIVGEPFGGKTSAY+VLA ALGD+ ++  MEEN+ QYT+LNPKAITMGQLYGQFDPVSHEWSDG+LAVSYRAFATSTTPDRKWLIFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQL+P+TNLIFEPMDLEVASPATVSRCGM+YMEPASLGWRPI  SWL                 +     +    K+   ++FERFIDAGIA ++KGGG+ELS TSDIN+V+SL+NLIDCQ+D F DEAK++QM+ R +  WLEG+F F++ WS+GA+T+E GR+ FDKL REL+NGGM+EETR ++ALVE VPPPLQDY   +P+KG++YDYRF+ E    G GKWE W+  ++    I KDA+FN+IIVPT DTV+YT+LM LLLTH+K CLFVGPTGTGKS YI +FL + ++KD YKPN +NFSAQTSAN TQNIIMSKLDRRRKGVFGPP+GKK+I+FVDDLNMPI+ETYGAQPPIELLRQWLDHWNWYD+KDT+ I L+DL FIGAMGPPGGGR+ ITPRFLRHLNTITINEFHDETMITIFSSI+ WH+ T+ F+ DF+P + Q++  TL VYKSAM NLLPTPAKSHYLFNLRDFSRV+QGVLLS P+T EEP ++KRLW HE+ RVYYDRLV D+DR+W F+Y++EV  K   EDF+ LF HLDFDEDG+VTEDD+RSLIYCDFSD KS+   Y+EV D+E LR  VEG+L+E+N MSKKPMNLVLFRFAIEHVSRISRILK PRSHALLVGVGGSGRQSLTRLAA MADYDLFQVEISKSYTS EWREDLKRILRK+TE++NH VFLFSD QIKQESFLEDINNLLNAGEVPNLY TDEK E+ EKMRQIDRQRDK +QTDGS VAL+N F+QR ++QLH+VLAMSPIG AFRNRLRKFPSLVNCCTIDWFQ WPEDALTAVATRFLEDVEL   L+ GCI  CK FH ST  LS ++  EL RYNYVTPTSYLELI+T+K LLD+KRTE+ +QKRRYEVGL+KLQSAA +I VMQ+ L   QP+LV+ASKEVD+TMIIVE++S E +KQEK+VK +EA+AN+Q +AA+AIK+ECD+DLAEAIPIL +AL AL+TLT  DITIV+TM SPP GVRLVME+VCVLKGIKPDR+ DPSGSGKKIED+WGPSK++LG+MKFLE L+ FDKDNIP PIMKVIRE+++ N +F PERIAVASTACEGLCKWV A+++YDKVAK+VAPKK AL KA  E   A  +L KK+A LK VQD+L+ L  +LE NK+RKI+LEN+VDLC+KKL RAEQLIGGLGGEKDRW +AAH+LG+ + NLTGDIL+SSGVVAYLGAFTS+FR ++T  W+++V E+ IP S++FSL+ TLG+PVEIRSWNI GLPTD+FS+ENGIII N+RRWPLMIDPQGQANKW+K+ EK NNL+V KL+D+DFVR LEN IQFGTPVLLEN+GEELDPLLEPLLLKQTFKQGG+ICIKLGDSIIEYS DFR +ITTKLRNPHYLPE +VKVTLLNFMITPEGLQDQLLGIVV+RE+PELEEEKN+LI Q A NK++LKE+ED+IL VLS+SEGNILEDESAIKVLNSSK LSNEI EKQ   E TE+KIDEAR GYVPIA+HSTILFF++ADL NIDPMYQYSLTWFINLF +SIDNS+KS+ L QRL+NLK +FTYSLYCNVCRSLFEKDKLLFSF+LC N+ KH+ L+ ++EWRFLLTGGVGLDNP+ NP+AWLPPKSWDE+CRLDDL  F  IRQ+F+ QKD WK IYDS  P ++  P EWAE+L + F ++CVLRCLRPDKIV A+Q+FVE+++GKKYIEPP FDLPGSFNDSNC SPLLF+LSPGADPMA+LLKFADD GFGG KF+ LSLGQGQGPIA+  I+RGIK+G W+LLQNCHLAPSWM  LEK VE+  PE THPDFRLWLTSYPS +FPV+ILQNGVKMTNEPPKGLRFNI RSY +DPIS+ EFF  S +  AWKK+LFGLCFFHAIVQERRKFGP+GWNI YEFNETDLRISVQQLHMF+D+Y+ VQYDAL+YLTGECNYGGRVT++WDRRTL TIL KFYC ++  D +YKFD++G Y+APPD +Y+ Y+EYIK LPLNP+P VFGMH NADITKD QET LLF+SILLTQ+R    GGK  DDI+D V+AD+L+RLP +FD EI +RKYPT Y+QSMNTVLVQEMVRFNALLS IRSSL+NIRKAIKGLVVMS DLEEV  S+LKSKIP MWMKKSYPSLKP+GSYVNDFLARLKFL DWFDNGPPP+FW+SGFYFTQAFLTGVQQN+ARKYTIPIDLL FD+EI+DD+ YD  PEDGAYV+GLF+ GARWDR+ K + ES PKVL D +P +WLKP K+S+I    SY  P+YKTSERRG LSTTGHSTN+V+AMT+PTDKP+ HWIMRGVAL+CQLD+
Sbjct:    8 GAAAKEEEDNFDLVFELTGKDNKKTKKV--DQATTQRTKIKKDREKFRKALVDIILQGEDKPFNESLEGDKVVGLEQQQKNFGLTGAEKDVLRYYYYIHHGIDTEHVAPMEDSWMGNIMSFVGKAQRGNHTELLEDLEDEIREDYLLSVKKAIVDFVLKEPREKEDEPEELPEHRQELAVVPKPWEKSFYACRRQIDRSLHITNPCMNQVLELWHKTFTQLRLVDIHEFQTKLEPLELKEFQTCCMKHIDAARDKLIKRWLSEIQHIFYKGHKQKQIPSEHEADQLAAFYNCAANLMTSQLQSLGLLSMDDYTDLLVQPP----------TSARAY-------------EHSGFILRFVLDDDRIKFEPNFDDFETVFLNIYDVMLKVICAIPRIETKLYSAYEGE---TLLKPCILPEILAAHKSKVSEVVKQEGDGPLKHLKQFDKYKFIVSKQADNDIDTFLQE---EHTFDEYARELRKFKQFAEQIQFKSVRSLRLGMFQVHCDDLIRALTKRTEAICERILTRMMDNHRLGNQELINDYKNIAEKALTLPSNTEQLMELRAFVEKVENETMVTLRSRLEQSRDRLVFLVEQTSFTNHDMELNAEVFTWETRMPNIFEEHRHNFNEKRDQFQENLKFKRDQFVLELEGYAKRVEEFQQFGDMAEVPRYLSKAQKLHNNLEAAADKVEALNNEEEAFGWPTTPYPQRQQILTTLRPYKQLYEQTVDFHRKYKEWMDGPMGNVVPDVVVEDVNGLWRLLYKLEKTFDDVPAAKKIASKIKEKVEEFKEHLPLITCLFNPGLRERHWTQISDIVGYPLQPDEEMCLSKLIDMNLEPYVQKFESISEAATKEHNLEKTMNKMKNEWESIEFNIIPYRESGTHILSSIDDIQLLLDDHIVKTQTMRGSPFIKPFENEIKDWEQNLILLQDVLDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRRFTTVDKNWREIMKAAITDKRVMQVIMIDKLLEKLRKSNELLELIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLEFTDVLDITHMKSSEGEVVQLKEVISTAKARGQVEKWLLELEGDMIQSVRMATKLAMEDYDKTPRAQWVRAWPGQAVLAIDCLFWTTNVHRALREGPDSMDKYLKESNSQIDEIVTLVRGKLSKQNRTTLQALIVLDVHARDVLTNLIELKVREENDFNWLSQLRYYWTDDNLLTRMINSMLRYGYEYLGNSGRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQKAVNAAADTLEFEGTQLKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALISEISLYSCGFINARPLSVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPEEDEDILMLRSIIDVNLPKFLNHDLPLFEGIASDLFPGVQRPTPDYDLFNIAVKENCEKMNLQCTPFFLEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYRVLAKALGDLHDREQMEENRAQYTVLNPKAITMGQLYGQFDPVSHEWSDGILAVSYRAFATSTTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQLAPTTNLIFEPMDLEVASPATVSRCGMIYMEPASLGWRPIVRSWLYNSTDGPDDPMKDPNYVRNTTKFLKKEQKEGLDEMFERFIDAGIAMVRKGGGRELSKTSDINLVRSLMNLIDCQLDEFQDEAKVNQMEPRQVRAWLEGIFLFSFVWSVGASTDENGRRRFDKLTRELVNGGMLEETRSRIALVELVPPPLQDYSCPFPNKGSVYDYRFVKE----GMGKWEPWAAALQEMPPIPKDAEFNQIIVPTVDTVRYTHLMKLLLTHEKACLFVGPTGTGKSSYIAEFLYSGLDKDTYKPNTLNFSAQTSANMTQNIIMSKLDRRRKGVFGPPMGKKVIIFVDDLNMPIKETYGAQPPIELLRQWLDHWNWYDIKDTSTINLVDLIFIGAMGPPGGGRSAITPRFLRHLNTITINEFHDETMITIFSSIVKWHMDTRGFAHDFQPCIEQIVNGTLAVYKSAMENLLPTPAKSHYLFNLRDFSRVVQGVLLSTPDTTEEPGYLKRLWLHEVMRVYYDRLVDDEDRKWLFDYLKEVLQKEFKEDFNQLFGHLDFDEDGQVTEDDLRSLIYCDFSDPKSAKGNYVEVNDMEKLRVVVEGHLEEFNNMSKKPMNLVLFRFAIEHVSRISRILKHPRSHALLVGVGGSGRQSLTRLAAHMADYDLFQVEISKSYTSNEWREDLKRILRKATESENHGVFLFSDTQIKQESFLEDINNLLNAGEVPNLYATDEKAEITEKMRQIDRQRDKTKQTDGSLVALFNLFIQRCQEQLHVVLAMSPIGSAFRNRLRKFPSLVNCCTIDWFQAWPEDALTAVATRFLEDVELTDELRAGCIKFCKHFHQSTINLSARFGSELGRYNYVTPTSYLELINTYKQLLDEKRTEIHRQKRRYEVGLDKLQSAAEEIGVMQQNLTALQPQLVQASKEVDETMIIVEKESQEVAKQEKVVKADEAVANEQKQAAQAIKDECDSDLAEAIPILNAALAALKTLTQQDITIVKTMKSPPAGVRLVMESVCVLKGIKPDRIPDPSGSGKKIEDYWGPSKKILGDMKFLESLQNFDKDNIPAPIMKVIRERFIVNPEFVPERIAVASTACEGLCKWVRAMDQYDKVAKIVAPKKEALRKAEGELAVAQEALAKKQATLKAVQDRLEKLRSDLEMNKKRKIELENEVDLCTKKLDRAEQLIGGLGGEKDRWREAAHNLGITYTNLTGDILISSGVVAYLGAFTSAFRQDQTLLWVNEVREQQIPVSERFSLVQTLGNPVEIRSWNINGLPTDDFSVENGIIIKNARRWPLMIDPQGQANKWVKSNEKANNLKVCKLSDSDFVRNLENAIQFGTPVLLENVGEELDPLLEPLLLKQTFKQGGAICIKLGDSIIEYSNDFRLFITTKLRNPHYLPEVAVKVTLLNFMITPEGLQDQLLGIVVAREKPELEEEKNQLIVQGAENKRQLKEIEDKILYVLSSSEGNILEDESAIKVLNSSKTLSNEITEKQEIAEITEKKIDEARAGYVPIAVHSTILFFTVADLGNIDPMYQYSLTWFINLFVMSIDNSQKSDVLDQRLENLKLHFTYSLYCNVCRSLFEKDKLLFSFLLCINLQKHEKLVNDEEWRFLLTGGVGLDNPNPNPTAWLPPKSWDEICRLDDLPRFKTIRQKFMAQKDQWKVIYDSATPQSETPPGEWAEKLAEEFPRLCVLRCLRPDKIVPAVQDFVEKKLGKKYIEPPSFDLPGSFNDSNCCSPLLFVLSPGADPMASLLKFADDMGFGGSKFDFLSLGQGQGPIAIAKIERGIKDGMWILLQNCHLAPSWMPTLEKIVEDFTPEKTHPDFRLWLTSYPSDSFPVSILQNGVKMTNEPPKGLRFNIARSYRTDPISNPEFFNESHNPRAWKKMLFGLCFFHAIVQERRKFGPMGWNIPYEFNETDLRISVQQLHMFLDEYEEVQYDALRYLTGECNYGGRVTEEWDRRTLKTILNKFYCKEIISDDNYKFDETGLYFAPPDGEYDSYLEYIKNLPLNPQPQVFGMHPNADITKDQQETNLLFNSILLTQSRSGGDGGKGADDIIDSVAADILDRLPKDFDIEISLRKYPTSYKQSMNTVLVQEMVRFNALLSVIRSSLENIRKAIKGLVVMSPDLEEVTSSLLKSKIPSMWMKKSYPSLKPVGSYVNDFLARLKFLQDWFDNGPPPVFWVSGFYFTQAFLTGVQQNFARKYTIPIDLLAFDFEIMDDKQYDTEPEDGAYVQGLFVVGARWDRQRKQLAESTPKVLHDTVPTVWLKPAKRSDIDPGSSYHCPIYKTSERRGVLSTTGHSTNYVMAMTIPTDKPQSHWIMRGVALICQLDE 3972          
BLAST of Dynein heavy chain 7 axonemal vs. TrEMBL
Match: A0A4Z2D8W9 (Dynein heavy chain 7, axonemal OS=Schistosoma japonicum OX=6182 GN=EWB00_003293 PE=4 SV=1)

HSP 1 Score: 5784.53 bits (15005), Expect = 0.000e+0
Identity = 2882/4070 (70.81%), Postives = 3386/4070 (83.19%), Query Frame = 3
Query:   93 LLPTIPMKRVKPEWAQNPPSFTLDGKQKINEDAGIELIYELTAKPPTKPRKLKGEDLAFERSQLRKDR--EKFRKALVDMILQGEDRPIKESIETVRLPPLTQ-EKTPV-GMSATEKDILRYYYYIHNGIDTEHVAKM-EXXXXXXXXXXXXXXXXAEHPXXXXXXXXXXXXXXXXSVKKAIVDFVLKEPR-------------EKETDDTPIPEHRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLS------------------EG-----------------EDRH---SFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGK-------WEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD 12113
            +LP    K+  P W    P+F    +  +     +++  E+  K  T+ RK    DL       RK +  E FR  LVD+IL+GE+      ++  ++PP+T  E + V G+S  EK ILRYYYYI+NGIDT+ VA M E      + ++  + LKA    LLE LEDEI+EDYL SVKKAIV+FV+ +P              EK T++  + E RKEL VVPKPW  SF++AYK+CQ++L++TN C++Q+LELW   + NLRL+DV+EF  K +A+EL  FQ+ C++HIE AKEKL++ WLN++Q+I+Y  NK+ LVPS  +   LE F+ CA+TLMT +LQNLGL SM+DY N     S         +TDK                +HPGF++RL+L++ ++KFEPS EDFE++LLNV+D M KVI S+ RIE+RLYSDW  D T   L PIIL +II ++KS V+ +L  E  GP  H++E+DKY+ LIN++ +Q ++LLL+                  EG                 E++    SFEE  + L  +N LVKKI+Y+SRR+IRLG+FE+ CDELIR+L+KRA+N+  ++L+R++E HR  NR L+KEYE I  KAL +P +   MM++ +FV+ TE+ITM +LE+KLD S +RL+FLMD+A  N SDM +N  VF  H RM  +F+E+++  + K+EEF+ +LK+KRE+FIEE++SYRKQV++FQ+ GD+NEIN YLKK+Q L++KLE A+ +I++FN +EEA  W+ T+YP+R EVQN+L+P+L LYE  VEFN KY +WMEGSM KVEP+QV+ DV NYYR+LFKLEK F+  P P+ IAT+V+ K+EEFKEH+PLI+TLF PGLR+RHWQ+IS+IVG+TL NEEGMCL+KLIDMNLE  IPKF+SISEAA KE +LEK ++KM  EW PMEF +I YR++GT ILSSVDDIQ++LDDHIVKTQTMRGSP+IKPFEAEIKDWE KLIL QDILDEWLKVQATWLYLEPIFSSPDIMAQMP+E RKFT+VDK WKE+MK    D+ +LTVI I+KMLDKL+KSNELLE+ILKGLN YLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFT+TLDITHMKSSENEIV L DVISTSKARG VEKWL ELE DM+ SV LNI+  L DY  T RK+WVK W GQ +LA SMYYWT+ V++A++ G +++  YLKVNN QIDEIVA+VRGQLSKQNRTTLQALIVLDVHARDVL  LI  +  +  +F+WL QLRYYW+E  ++T+MINS L YGYEYLGNT RLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAI A Q +L+FEGTE+KLD TCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYA+IAEISLYSCGFVNARPLA+KIVATYRLCSEQLSSQ HYDYGMRAVKSVLTAAGNLKLKYP+EDED+LMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGV RP PDYD+LN  IK  C +MNL+ + FF+EKI Q+YEMMIVRHGFMIVGEPFGGKTS+Y+VLAAALG+ICE+GLMEENKVQYT++NPKAITMGQLYGQFD VSHEWSDG+LAVSYRAFATSTTPDRKWLIFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQL+P+TNLIFEPMDLE ASPATVSRCGM+Y+EPASLGWRP+  SW+  LP  I  +HK +W D+F+RF+DAGIA I+KGG KELSPTSDIN+VKSL+NLIDCQI  F  E  + + D       +E +FFFAY WSIGATT+++GR+ FDKL RELMNGGMMEETR +L LVE VPPP+QDY+  +P K T+YDY+ +  K  N  GK       WE W+E V+    I KDA FNEII+PT +T +  YL+NL +++ KP LF+GPTGTGKSCYI+DFL+N++ KDIYKP+ +NFSAQTSANQTQNII+SKLDRRRKGVFGPP+GKK++VFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLK   +I+LIDL FIG+MGPPGGGRN ITPRFLRHLN +TINEF D TM TIF+ I++WHI  + F+P+FK    Q++ ATL+VYK A+ NLLPTPAKSHYLFNLRDF RVIQGVLLS P + E    MKRLW HE+FRVYYDRLV D DREW FN+IR+    HL  +FD+LF+HL  D+  ++TED +RSL++CDF+D K   + Y EV D+E LRK  E YL+EYNQ+SKKPMNLVLFRFAIEHV RI+RILKQPRSHALLVG+GGSGRQSLTRLAA M+D+D+FQVEISKSY   EW+EDLK ILRKS+ETDNHAVFLF+D QIKQESFLEDINNLLNAGEVPNLY TDEK EVCEKMRQ+DR RD+ +QTDGSP AL+N+F+QRVR+QLHIVLA+SPIGD+FRNRLRKFPSLVNCCTIDWFQ WPEDALTAVATR L+D+++   +++GCIDLCK FHTST  LS ++LLEL R+NYVTPTSYLELI+TF  LL KKR EV  QK RYEVGLEKL SAA +IS+M  EL+  QPKLV+ASKEVD+ M++VEQQS EASKQEK+V+ +EA+A +QAKAAEA+K ECDNDLAEAIPILESALKALETLTPADITIV+TM SPP GVRLVMEAVCVLKGIKPDR+NDP+GSGKK+EDFWGPSK+LLG+MKFLE LK FDKDNIP+ IMK IRE+Y+ N DFKPER+AVASTACEGLCKWV A+E+YD VAK+VAPKK AL KAM EY TAM++LN KRAALKEVQD+LK+LT++LE NKR+KI+LE+KVDLC+KKL RAEQLIGGLGGEK RW +AA  L +++ NLTGD+L+SSG+VAYLGAFTS+FR  + K WL+++M  SIPCS+ FSL+ TLG+PV+IR+WNI GLPTD+FS+ENGIII+N+RRWPLMIDP  QANKWIKNMEKKNNLQ+IKLTD+DFVR LENCIQFGTPVLLENIGEELDPLLE LLLKQTFKQGG++CIK+GDSI+EYS +FRFY+TTK RNPHYLPET+VKVTL+NFMIT EGLQDQLLGIVV+RERPELEEEKNKLI Q A NKKKLKELED+IL VLS+SEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKID ARLGYVPIA+H+ ILFFSI+DLANIDPMYQYSLTWFINLF + IDNSEKS++L+QRL NL++Y TYSLYCNVCRSLFEKDKLLFSF+L  N+++HD  + E EWRFLLTGGVGLDNPH NPS WL  KSWDELCRLD++SVF GIR+ F    D+WK+IYDS+EPHN++LP++  + +K     +C+LR LRPDKIV AIQNFV   +GKKYIEPPPFDLPG+F DS+CT PLLF+LSPGADPM ALLKFA+D GFGG KFESLSLGQGQGPIA+KMI+RGIK+GTW+LLQNCHLAPSWMG+LEK VEELNP+TTHPDFRLWLTSYPS  FPV+ILQNGVKMTNEPPKGLRFN+WRSYLSDPISD EFF +  +   WKKLLFGL FFHAIVQERRKFGP+GWN  YEFNETDLRISVQQLHMF+ QY  VQY+AL+YLTGECNYGGRVTD+WDRRTL TIL +FYC  V    +YKFD SG YY P D DY+GYI+YIKTLPLNP+P +FGMHQNADITKD QET L+F SILLTQ++G+S  GKS DD+VDEV+AD+L RLPPNFDTE+V+RKYPT YEQSMNTVLVQEMVRFN LLS I SSL+NIR AIKGLVVMSSDLE+VV ++L SKIP +WMKKSYPSLKPLGSYVNDFLARLKFL  W++ GPPP FWISGF+FTQAFLTGVQQNYAR++TIPIDLL F++++L+D+ Y E P +GAYV GLF+DGARWDRK   + E+ PKVL DPMP IWL PMK+S+I  +PSY +P+YKTSERRG LSTTGHSTNFV+++ L +DKPE HWIMRGVALLCQLDD
Sbjct:   19 MLPVFDDKQCPPSWKSEVPNFLASAENGLVVGPKVDIFKEINKKN-TRKRK---HDLINSSETDRKPKTGESFRLGLVDLILRGEEC----GMDINKIPPVTNPEISSVKGISDREKKILRYYYYIYNGIDTDQVAPMDEKWIRRMLSSVNPDVLKAADMALLEKLEDEIREDYLFSVKKAIVNFVINDPSDKQQKPTESDGSFEKNTEEYKVLERRKELDVVPKPWHLSFLSAYKYCQRNLFITNVCIHQLLELWHTKYSNLRLIDVQEFHSKLSALELPVFQNICVKHIEVAKEKLLRNWLNEIQSIFYHANKRNLVPSNDEPVKLEAFYRCAATLMTENLQNLGLISMLDYKNFTCQSSI-------NLTDK----------------QHPGFIIRLVLDENMVKFEPSTEDFESILLNVFDDMHKVIQSIPRIETRLYSDWQTDNTT--LRPIILDDIIREYKSEVKKMLSMEIKGPESHVREYDKYQFLINKQAEQNVELLLNPPVQELTIQDVVTNNDDLEGNLGANEELEEISSKDVIENKSIGPSFEELTRELLKFNRLVKKIQYESRRTIRLGLFEVHCDELIRSLTKRAENLLNRILERILEDHRIMNRNLIKEYELISAKALTVPVDISHMMQINEFVNRTEKITMNDLERKLDSSKDRLLFLMDHAQLNPSDMRINSQVFEWHTRMNEVFNESRRIAQMKREEFEISLKYKREKFIEEIESYRKQVDKFQHYGDINEINHYLKKAQSLNSKLEIALTKIDEFNADEEALKWETTSYPLRNEVQNILKPFLNLYEMTVEFNNKYHEWMEGSMNKVEPEQVEMDVSNYYRSLFKLEKAFDTLPEPRNIATQVRGKIEEFKEHLPLIRTLFNPGLRERHWQKISEIVGFTLNNEEGMCLAKLIDMNLESHIPKFDSISEAASKENSLEKTLDKMHKEWEPMEFNLIPYRDSGTLILSSVDDIQVILDDHIVKTQTMRGSPYIKPFEAEIKDWEQKLILTQDILDEWLKVQATWLYLEPIFSSPDIMAQMPDESRKFTTVDKIWKELMKIANTDRHILTVILIDKMLDKLRKSNELLETILKGLNAYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTKTLDITHMKSSENEIVELCDVISTSKARGAVEKWLSELENDMVNSVHLNINNALNDYLKTSRKDWVKVWCGQAILAGSMYYWTMNVEEALQNGIDSMMDYLKVNNQQIDEIVAMVRGQLSKQNRTTLQALIVLDVHARDVLAELISLKCQSNTEFSWLSQLRYYWIEQKLVTRMINSHLNYGYEYLGNTGRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIIANQTSLIFEGTEIKLDQTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYAMIAEISLYSCGFVNARPLAIKIVATYRLCSEQLSSQSHYDYGMRAVKSVLTAAGNLKLKYPNEDEDVLMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVERPTPDYDVLNNAIKNACNRMNLQYTKFFVEKILQVYEMMIVRHGFMIVGEPFGGKTSSYRVLAAALGEICEKGLMEENKVQYTVINPKAITMGQLYGQFDLVSHEWSDGILAVSYRAFATSTTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQLAPTTNLIFEPMDLEAASPATVSRCGMIYLEPASLGWRPLLRSWMNKLPSCIKQLHKDIWTDMFDRFVDAGIALIRKGGAKELSPTSDINLVKSLMNLIDCQISEFKVETTLPEFDDHISCAIVECIFFFAYVWSIGATTDKDGRQKFDKLMRELMNGGMMEETRQRLTLVELVPPPVQDYKCPFPIKRTVYDYKLVM-KANNNEGKEGEIPISWELWTESVRLLPPIPKDATFNEIIIPTVETARCNYLLNLFISNGKPSLFIGPTGTGKSCYIMDFLMNKVEKDIYKPHTLNFSAQTSANQTQNIILSKLDRRRKGVFGPPMGKKMVVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKTNESIRLIDLLFIGSMGPPGGGRNIITPRFLRHLNIVTINEFDDHTMKTIFTRIMDWHIAVKGFNPNFKILSEQIVDATLEVYKGALQNLLPTPAKSHYLFNLRDFGRVIQGVLLSAPESTETLDAMKRLWVHEVFRVYYDRLVDDADREWLFNFIRQCVKTHLEIEFDLLFQHLTSDDKTEITEDHLRSLMFCDFADPKGK-RNYTEVQDVEQLRKVTEAYLEEYNQLSKKPMNLVLFRFAIEHVCRIARILKQPRSHALLVGIGGSGRQSLTRLAAHMSDFDIFQVEISKSYGVNEWKEDLKHILRKSSETDNHAVFLFTDAQIKQESFLEDINNLLNAGEVPNLYATDEKMEVCEKMRQLDRARDRNKQTDGSPAALFNYFIQRVREQLHIVLALSPIGDSFRNRLRKFPSLVNCCTIDWFQIWPEDALTAVATRSLKDIDMSDEIRNGCIDLCKYFHTSTCQLSTRFLLELDRHNYVTPTSYLELITTFITLLSKKRQEVLIQKSRYEVGLEKLSSAADEISIMSVELQSLQPKLVQASKEVDEVMVVVEQQSAEASKQEKLVRVDEAVAGEQAKAAEAMKEECDNDLAEAIPILESALKALETLTPADITIVKTMKSPPAGVRLVMEAVCVLKGIKPDRINDPAGSGKKVEDFWGPSKKLLGDMKFLENLKNFDKDNIPLSIMKTIRERYIPNPDFKPERVAVASTACEGLCKWVIAIERYDVVAKIVAPKKEALAKAMLEYTTAMNALNIKRAALKEVQDRLKLLTDDLEMNKRKKIELEDKVDLCTKKLERAEQLIGGLGGEKSRWTEAAKSLSIQYTNLTGDVLISSGLVAYLGAFTSTFRQIQVKTWLNEIMNHSIPCSESFSLVNTLGNPVDIRAWNIAGLPTDDFSVENGIIIANARRWPLMIDPTSQANKWIKNMEKKNNLQIIKLTDSDFVRTLENCIQFGTPVLLENIGEELDPLLESLLLKQTFKQGGALCIKIGDSIVEYSPEFRFYMTTKFRNPHYLPETAVKVTLVNFMITEEGLQDQLLGIVVARERPELEEEKNKLILQGAANKKKLKELEDQILGVLSSSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDIARLGYVPIAVHTAILFFSISDLANIDPMYQYSLTWFINLFVMGIDNSEKSDDLEQRLTNLRNYLTYSLYCNVCRSLFEKDKLLFSFLLSVNMIRHDGFLNEQEWRFLLTGGVGLDNPHVNPSDWLQTKSWDELCRLDEISVFTGIRKHFECNLDTWKRIYDSLEPHNEKLPNDLTQ-IKTQLQFLCILRVLRPDKIVPAIQNFVLVNLGKKYIEPPPFDLPGAFADSSCTVPLLFVLSPGADPMVALLKFAEDMGFGGTKFESLSLGQGQGPIALKMIERGIKDGTWILLQNCHLAPSWMGILEKRVEELNPDTTHPDFRLWLTSYPSKDFPVSILQNGVKMTNEPPKGLRFNLWRSYLSDPISDQEFFQSCPNQHVWKKLLFGLVFFHAIVQERRKFGPLGWNTPYEFNETDLRISVQQLHMFLGQYSDVQYEALRYLTGECNYGGRVTDEWDRRTLKTILMRFYCPAVVNQVEYKFDASGIYYVPEDTDYDGYIDYIKTLPLNPDPEIFGMHQNADITKDQQETNLIFTSILLTQSKGTSSSGKSLDDVVDEVAADILTRLPPNFDTELVLRKYPTCYEQSMNTVLVQEMVRFNVLLSIIHSSLKNIRLAIKGLVVMSSDLEDVVAAILASKIPKLWMKKSYPSLKPLGSYVNDFLARLKFLQVWYEQGPPPEFWISGFFFTQAFLTGVQQNYARQHTIPIDLLSFEFKVLEDKKYVEPPSEGAYVSGLFVDGARWDRKTNKLAEALPKVLHDPMPPIWLIPMKRSDIEPRPSYTAPVYKTSERRGVLSTTGHSTNFVLSILLTSDKPESHWIMRGVALLCQLDD 4052          
BLAST of Dynein heavy chain 7 axonemal vs. TrEMBL
Match: A0A1I8JFF0 (EF-hand domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 5772.2 bits (14973), Expect = 0.000e+0
Identity = 2840/3944 (72.01%), Postives = 3328/3944 (84.38%), Query Frame = 3
Query:  333 QGEDRPIKESIETVRLPPLTQEKTPVGMSATEKDILRYYYYIHNGIDTEHVAKMEXXXXXXXXXXXXXXXXAEHPXXXXXXXXXXXXXXXXSVKKAIVDFVLKEPREKETDDTPIPEHRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWL-----------------KVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD 12113
            QGED+P  ES+E  ++  L Q++   G++  EKD+LRYYYYIH+GIDTEHVA MED WM N+ + +    +  H ELLEDLEDEI+EDYLLSVKKAIVDFVLKEPREKE +   +PEHR+EL+VVPKPW +SF    +   + L++TNPCMNQVLELW  +F  LRLVD+ EF+ K   +EL++FQ  CM+HI+AA++KL+K+WL+++Q+I+Y+G+K+K +PS  +   L  F+NCA+ LMTS LQ+LGL SM DYT+LL  P           T  R+              EH GF+LR +L+D  IKFEP+ +DFET+ LN+YD M+KVI ++ RIE++LYS + G+     L P ILPEI+  HKS V  V+  E  GP +H+K+FDKY+ +++++ D +ID  L E    H+F+E+A+ L+ +    ++I++ S RS+RLGMF++ CD+LIRAL+KR + +CE++L R+++ HR  N+EL+ +Y+ I  KAL LP+NTEQ+MEL  FV   E  TM+ L  +L++S +RL+FL++  +F   DM LN  VF    RM +IF+E++ N  +K+++FQ NLKFKR++F+ EL+ Y K+VEEFQ  GDM E+ +YL K+Q L   LEAA  ++E  N EEEAFGW  T YP RQ++   LRPY +LYE  V+F+ KYK+WM+G M  V PD V  DV   +R L+KLEK F++ P  KKIA+K+K KVEEFKEH+PLI  LF PGLR+RHW QISDIVGY L+ +E MCLSKLIDMNLEP++ KFESISEAA KE NLEK M KMKNEW  +EF +I YRE+GT ILSS+DDIQL+LDDHIVKTQTMRGSPFIKPFE EIKDWE  LIL+QD+LDEWLKVQATWLYLEPIFSSPDIMAQMPEEGR+FT+VDK W+EIMK  I DKRV+ VI I+K+L+KL+KSNELLE I KGLN YLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASL FT+ LDITHMKSSE E+V LK+VIST+KARGQVEKWLLELE DMI SVR+     + DY  TPR +WV+ W GQ VLAI   +WT  V  A++EGP+++D YLK +NSQIDEIV LVRG+LSKQNRTTLQALIVLDVHARDVL NLI+ +V  ENDF WL QLRYYW ++N++T+MINSML+YGYEYLGN+ RLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDY+ALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQ+A+ A  DTL FEGT+LKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALI+EISLYSCGF+NARPL+VKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYP+EDEDILMLRSIIDVNLPKFLNHDLPLF GIASDLFPGV RP PDYD+ N  +KENC KMNL+ + FF+EKIQQIYEMMIVRHGFMIVGEPFGGKTSAY+VLA ALGD+ ++  MEEN+ QYT+LNPKAITMGQLYGQFDPVSHEWSDG+LAVSYRAFATSTTPDRKWLIFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQL+P+TNLIFEPMDLEVASPATVSRCGM+YMEPASLGWRPI  SWL                 +     +    K+   ++FERFIDAGIA ++KGGG+ELS TSDIN+V+SL+NLIDCQ+D F DEAK++QM+ R +  WLEG+F F++ WS+GA+T+E GR+ FDKL REL+NGGM+EETR ++ALVE VPPPLQDY   +P+KG++YDYRF+ E    G GKWE W+  ++    I KDA+FN+IIVPT DTV+YT+LM LLLTH+K CLFVGPTGTGKS YI +FL + ++KD YKPN +NFSAQTSAN TQNIIMSKLDRRRKGVFGPP+GKK+I+FVDDLNMPI+ETYGAQPPIELLRQWLDHWNWYD+KDT+ I L+DL FIGAMGPPGGGR+ ITPRFLRHLNTITINEFHDETMITIFSSI+ WH+ T+ F+ DF+P + Q++  TL VYKSAM NLLPTPAKSHYLFNLRDFSRV+QGVLLS P+T EEP ++KRLW HE+ RVYYDRLV D+DR+W F+Y++EV  K   EDF+ LF HLDFDEDG+VTEDD+RSLIYCDFSD KS+   Y+EV D+E LR  VEG+L+E+N MSKKPMNLVLFRFAIEHVSRISRILK PRSHALLVGVGGSGRQSLTRLAA MADYDLFQVEISKSYTS EWREDLKRILRK+TE++NH VFLFSD QIKQESFLEDINNLLNAGEVPNLY TDEK E+ EKMRQIDRQRDK +QTDGS VAL+N F+QR ++QLH+VLAMSPIG AFRNRLRKFPSLVNCCTIDWFQ WPEDALTAVATRFLEDVEL   L+ GCI  CK FH ST  LS ++  EL RYNYVTPTSYLELI+T+K LLD+KRTE+ +QKRRYEVGL+KLQSAA +I VMQ+ L   QP+LV+ASKEVD+TMIIVE++S E +KQEK+VK +EA+AN+Q +AA+AIK+ECD+DLAEAIPIL +AL AL+TLT  DITIV+TM SPP GVRLVME+VCVLKGIKPDR+ DPSGSGKKIED+WGPSK++LG+MKFLE L+ FDKDNIP PIMKVIRE+++ N +F PERIAVASTACEGLCKWV A+++YDKVAK+VAPKK AL KA  E   A  +L KK+A LK VQD+L+ L  +LE NK+RKI+LEN+VDLC+KKL RAEQLIGGLGGEKDRW +AAH+LG+ + NLTGDIL+SSGVVAYLGAFTS+FR ++T  W+++V E+ IP S++FSL+ TLG+PVEIRSWNI GLPTD+FS+ENGIII N+RRWPLMIDPQGQANKW+K+ EK NNL+V KL+D+DFVR LEN IQFGTPVLLEN+GEELDPLLEPLLLKQTFKQGG+ICIKLGDSIIEYS DFR +ITTKLRNPHYLPE +VKVTLLNFMITPEGLQDQLLGIVV+RE+PELEEEKN+LI Q A NK++LKE+ED+IL VLS+SEGNILEDESAIKVLNSSK LSNEI EKQ   E TE+KIDEAR GYVPIA+HSTILFF++ADL NIDPMYQYSLTWFINLF +SIDNS+KS+ L QRL+NLK +FTYSLYCNVCRSLFEKDKLLFSF+LC N+ KH+ L+ ++EWRFLLTGGVGLDNP+ NP+AWLPPKSWDE+CRLDDL  F  IRQ+F+ QKD WK IYDS  P ++  P EWAE+L + F ++CVLRCLRPDKIV A+Q+FVE+++GKKYIEPP FDLPGSFNDSNC SPLLF+LSPGADPMA+LLKFADD GFGG KF+ LSLGQGQGPIA+  I+RGIK+G W+LLQNCHLAPSWM  LEK VE+  PE THPDFRLWLTSYPS +FPV+ILQNGVKMTNEPPKGLRFNI RSY +DPIS+ EFF  S +  AWKK+LFGLCFFHAIVQERRKFGP+GWNI YEFNETDLRISVQQLHMF+D+Y+ VQYDAL+YLTGECNYGGRVT++WDRRTL TIL KFYC ++  D +YKFD++G Y+APPD +Y+ Y+EYIK LPLNP+P VFGMH NADITKD QET LLF+SILLTQ+R S  GGK  DDI+D V+AD+L+RLP +FD EI +RKYPT Y+QSMNTVLVQEMVRFNALLS IRSSL+NIRKAIKGLVVMS DLEEV  S+LKSKIPGMWMKKSYPSLKP+GSYVNDFLARLKFL DWFDNGPPP+FW+SGFYFTQAFLTGVQQN+ARKYTIPIDLL FD+EI+DD+ YD  PEDGAYV+GLF+ GARWDR+ K + ES PKVL D +P +WLKP K+S+I    SY  P+YKTSERRG LSTTGHSTN+V+AMT+PTDKP+ HWIMRGVAL+CQLD+
Sbjct:    1 QGEDKPFNESLEGDKVVGLEQQQKNFGLTGAEKDVLRYYYYIHHGIDTEHVAPMEDSWMGNIMSFVGKAQRGNHTELLEDLEDEIREDYLLSVKKAIVDFVLKEPREKEDEPEELPEHRQELAVVPKPWEKSFYACRRQIDRSLHITNPCMNQVLELWHKTFTQLRLVDIHEFQTKLEPLELKEFQTCCMKHIDAARDKLIKRWLSEIQHIFYKGHKQKQIPSEHEADQLAAFYNCAANLMTSQLQSLGLLSMDDYTDLLVQPP----------TSARAY-------------EHSGFILRFVLDDDRIKFEPNFDDFETVFLNIYDVMLKVICAIPRIETKLYSAYEGE---TLLKPCILPEILAAHKSKVSEVVKQEGDGPLKHLKQFDKYKFIVSKQADNDIDTFLQE---EHTFDEYARELRKFKQFAEQIQFKSVRSLRLGMFQVHCDDLIRALTKRTEAICERILTRMMDNHRLGNQELINDYKNIAEKALTLPSNTEQLMELRAFVEKVENETMVTLRSRLEQSRDRLVFLVEQTSFTNHDMELNAEVFTWETRMPNIFEEHRHNFNEKRDQFQENLKFKRDQFVLELEGYAKRVEEFQQFGDMAEVPRYLSKAQKLHNNLEAAADKVEALNNEEEAFGWPTTPYPQRQQILTTLRPYKQLYEQTVDFHRKYKEWMDGPMGNVVPDVVVEDVNGLWRLLYKLEKTFDDVPAAKKIASKIKEKVEEFKEHLPLITCLFNPGLRERHWTQISDIVGYPLQPDEEMCLSKLIDMNLEPYVQKFESISEAATKEHNLEKTMNKMKNEWESIEFNIIPYRESGTHILSSIDDIQLLLDDHIVKTQTMRGSPFIKPFENEIKDWEQNLILLQDVLDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRRFTTVDKNWREIMKAAITDKRVMQVIMIDKLLEKLRKSNELLELIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLEFTDVLDITHMKSSEGEVVQLKEVISTAKARGQVEKWLLELEGDMIQSVRMATKLAMEDYDKTPRAQWVRAWPGQAVLAIDCLFWTTNVHRALREGPDSMDKYLKESNSQIDEIVTLVRGKLSKQNRTTLQALIVLDVHARDVLTNLIELKVREENDFNWLSQLRYYWTDDNLLTRMINSMLRYGYEYLGNSGRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQKAVNAAADTLEFEGTQLKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALISEISLYSCGFINARPLSVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPEEDEDILMLRSIIDVNLPKFLNHDLPLFEGIASDLFPGVQRPTPDYDLFNIAVKENCEKMNLQCTPFFLEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYRVLAKALGDLHDREQMEENRAQYTVLNPKAITMGQLYGQFDPVSHEWSDGILAVSYRAFATSTTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQLAPTTNLIFEPMDLEVASPATVSRCGMIYMEPASLGWRPIVRSWLYNSTDGPDDPMKDPNYVRNTTKFLKKEQKEGLDEMFERFIDAGIAMVRKGGGRELSKTSDINLVRSLMNLIDCQLDEFQDEAKVNQMEPRQVRAWLEGIFLFSFVWSVGASTDENGRRRFDKLTRELVNGGMLEETRSRIALVELVPPPLQDYSCPFPNKGSVYDYRFVKE----GMGKWEPWAAALQEMPPIPKDAEFNQIIVPTVDTVRYTHLMKLLLTHEKACLFVGPTGTGKSSYIAEFLYSGLDKDTYKPNTLNFSAQTSANMTQNIIMSKLDRRRKGVFGPPMGKKVIIFVDDLNMPIKETYGAQPPIELLRQWLDHWNWYDIKDTSTINLVDLIFIGAMGPPGGGRSAITPRFLRHLNTITINEFHDETMITIFSSIVKWHMDTRGFAHDFQPCIEQIVNGTLAVYKSAMENLLPTPAKSHYLFNLRDFSRVVQGVLLSTPDTTEEPGYLKRLWLHEVMRVYYDRLVDDEDRKWLFDYLKEVLQKEFKEDFNQLFGHLDFDEDGQVTEDDLRSLIYCDFSDPKSAKGNYVEVNDMEKLRVVVEGHLEEFNNMSKKPMNLVLFRFAIEHVSRISRILKHPRSHALLVGVGGSGRQSLTRLAAHMADYDLFQVEISKSYTSNEWREDLKRILRKATESENHGVFLFSDTQIKQESFLEDINNLLNAGEVPNLYATDEKAEITEKMRQIDRQRDKTKQTDGSLVALFNLFIQRCQEQLHVVLAMSPIGSAFRNRLRKFPSLVNCCTIDWFQAWPEDALTAVATRFLEDVELTDELRAGCIKFCKHFHQSTINLSARFGSELGRYNYVTPTSYLELINTYKQLLDEKRTEIHRQKRRYEVGLDKLQSAAEEIGVMQQNLTALQPQLVQASKEVDETMIIVEKESQEVAKQEKVVKADEAVANEQKQAAQAIKDECDSDLAEAIPILNAALAALKTLTQQDITIVKTMKSPPAGVRLVMESVCVLKGIKPDRIPDPSGSGKKIEDYWGPSKKILGDMKFLESLQNFDKDNIPAPIMKVIRERFIVNPEFVPERIAVASTACEGLCKWVRAMDQYDKVAKIVAPKKEALRKAEGELAVAQEALAKKQATLKAVQDRLEKLRSDLEMNKKRKIELENEVDLCTKKLDRAEQLIGGLGGEKDRWREAAHNLGITYTNLTGDILISSGVVAYLGAFTSAFRQDQTLLWVNEVREQQIPVSERFSLVQTLGNPVEIRSWNINGLPTDDFSVENGIIIKNARRWPLMIDPQGQANKWVKSNEKANNLKVCKLSDSDFVRNLENAIQFGTPVLLENVGEELDPLLEPLLLKQTFKQGGAICIKLGDSIIEYSNDFRLFITTKLRNPHYLPEVAVKVTLLNFMITPEGLQDQLLGIVVAREKPELEEEKNQLIVQGAENKRQLKEIEDKILYVLSSSEGNILEDESAIKVLNSSKTLSNEITEKQEIAEITEKKIDEARAGYVPIAVHSTILFFTVADLGNIDPMYQYSLTWFINLFVMSIDNSQKSDVLDQRLENLKLHFTYSLYCNVCRSLFEKDKLLFSFLLCINLQKHEKLVNDEEWRFLLTGGVGLDNPNPNPTAWLPPKSWDEICRLDDLPRFKTIRQKFMAQKDQWKVIYDSATPQSETPPGEWAEKLAEEFPRLCVLRCLRPDKIVPAVQDFVEKKLGKKYIEPPSFDLPGSFNDSNCCSPLLFVLSPGADPMASLLKFADDMGFGGSKFDFLSLGQGQGPIAIAKIERGIKDGMWILLQNCHLAPSWMPTLEKIVEDFTPEKTHPDFRLWLTSYPSDSFPVSILQNGVKMTNEPPKGLRFNIARSYRTDPISNPEFFNESHNPRAWKKMLFGLCFFHAIVQERRKFGPMGWNIPYEFNETDLRISVQQLHMFLDEYEEVQYDALRYLTGECNYGGRVTEEWDRRTLKTILNKFYCKEIISDDNYKFDETGLYFAPPDGEYDSYLEYIKNLPLNPQPQVFGMHPNADITKDQQETNLLFNSILLTQSRSSGDGGKGADDIIDSVAADILDRLPKDFDIEISLRKYPTSYKQSMNTVLVQEMVRFNALLSVIRSSLENIRKAIKGLVVMSPDLEEVTSSLLKSKIPGMWMKKSYPSLKPVGSYVNDFLARLKFLQDWFDNGPPPVFWVSGFYFTQAFLTGVQQNFARKYTIPIDLLAFDFEIMDDKQYDTEPEDGAYVQGLFVVGARWDRQRKQLAESTPKVLHDTVPTVWLKPAKRSDIDPGSSYHCPIYKTSERRGVLSTTGHSTNYVMAMTIPTDKPQSHWIMRGVALICQLDE 3911          
BLAST of Dynein heavy chain 7 axonemal vs. TrEMBL
Match: K1QK11 (Dynein heavy chain 7, axonemal OS=Crassostrea gigas OX=29159 GN=CGI_10014961 PE=4 SV=1)

HSP 1 Score: 5758.72 bits (14938), Expect = 0.000e+0
Identity = 2845/4050 (70.25%), Postives = 3356/4050 (82.86%), Query Frame = 3
Query:   12 LYDYKMTSNSCETTSQKRGRKGPDLTKLLPTIPMKRVKPEWAQNPPSFTLDGKQKINEDAGIELIYELTAKPPT--KPRKLK------GEDLAFER-SQLRKDREKFRKALVDMILQGEDRPIKESIETV----RLPPLTQEKTPVGMSATEKDILRYYYYIHNGIDTEHVAKMEXXXXXXXXXXXXXXXXAEHPXXXXXXXXXXXXXXXXSVKKAIVDFVLKEPREKETD-DTPIPEHRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLS--AWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD 12113
            + D  +T       S+ +G   P   + LP +P KR KP W QN P+F L GK   ++  GI+L+ ELTA+ P   KP +LK      G D    +  Q +KDRE FRKALVD+I+Q +  P   +  +V     LPPL++  TP   +A +KDILRYYYYIHNGIDTEHVA MED W+ N+  L+  +LK  H E +E+L DE++EDYLLSVKKAIVDFVLK+ REKE D +   P HR+E+ VVPKPW + ++   +   + L++T PCM QVL+ W   F  LR +D+ EF  +  ++EL  FQ+ CMRHIE AK++LMKKW  +VQ ++Y+GNK+K VPS QD   LE FFNCA+TLMT +LQ L L+S+ DY++LL  P           T  R+              EHPGF+LRLIL+ T IKFEP+ ++FE ++LNVYD M+K    V R+E++LY DW+G+K K  L P++L EI+E HK  V+ ++  ESVGP EH K +DKY  LI+++ D ++D+ L E    HSF+E+AK +  Y  LV ++ Y+  + +RLGMFE+ CD+LIR+L+KRA+ +C+KLL ++ E H+++N++L  +YE+I  KAL  P+NTE +MEL  ++   E   +  +EK+L +S +RL FL D+A F+ ++M LN SVF  H RM +IF+E+K  +  ++ +++  LK +RERF+EEL+SY+KQVEEF   GDMNEI KYL+KSQ L+TKL AA  +IE FN EEEAFGW  T YP RQ +QN L+PYL LYE  VEFN KY DWM G M  V PD+V+ +VGN++R L+KLEKQF++ P  KKIA+KVK KVEEF+E+MPL+QT+F PGLRDRHW+QIS++V Y L+ +E   L K+++ +L  ++P+FE ISEAA KEF+LEKAMEKMKNEW+P+EFV+I YR+TGT ILSSVDDIQL LDDHIVKTQTMRGSPFIKPFE EIKDWESKL+L+QDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGR+FT+VDK WK+IMKQ + DK+VL+VI IEKML+KLKKSNELLE I KGLN YLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIA L FT+TLDITHMKSSE EIV L+DVISTSKARGQVEKWLLELEADMI+S+   I E L  Y    RKEWVK+W GQ VL ++  YWT +++DA K+G  AL  YL +N  QID+IVA+VRG LSKQNR TLQALIVLDVHA+DVL  L++   +++ DF WL QLRYYW E+ M+T+MINSMLKYGYEYLGNT RLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQR I +  DTL+FEGTE++LDPTC+VFITMNPGYAGRSELPDNLKALFR+VAMMVPDYALIAEISLYSCGFV ARPL+VKIVA YRLCSEQLSSQ HYDYGMRAVKSVLTAAGNLKLKYP+EDE+ILMLRSIIDVNLPKFLNHDLPLF+GI SDLFPGV  P PDY +LN+ ++ENC+KMNL+ ++FF+EKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDI E+GLMEENKVQ T++NPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQL+ +TNL+FEPMDLEVASPATVSRCGM+YMEP+SLGWRP+  SW+  +P A+T++H+    D+FERF D  I  ++KGG KELSPTSD  +VKSL+NL+D  ++ F DEAKI+QM+ R+I++WLE +FFFA TWSIGA+ N+EGR  FDKL REL++GGM EETRIKL+L E V PP + Y   +P KG  YDY+F+ E    G G+W  W+E +K    I K+A+FNEIIVPT DTV+YT LM+LL+ + KPCLFVGPTGTGKS YI DFLLN+++K+ YKPN+INFSAQT+A QTQNIIMSKLD+RRKGVFGPP+GKK IVFVDDLNMP+ E +GAQPPIELLRQWLDHWNWYDLK+TT +KLID+Q + AMGPPGGGRNP+TPRFLRH N ITINEF D++MITIF  I++WHI ++ FS +FKP ++QL+Q TL  YK AM NLLPTPAKSHYLFNLRDFSRVI GVLLS P T+EEPA MKRLW HE+FRV+YDRLV D DR W FNY+REV    L EDFD LF HLDFD DGKV EDD+RSL+YCDF+D KS  K Y+EV DLE LR TVEGYLDE+N MSKKPMNLVLFRFAIEHVSRI+R++KQ RSHALLVGVGGSGRQSLTRLAA MADYDLFQVEISKSYTS EWREDLKRILRK+TETDNHAVFLFSD QIKQESFLEDINNLLNAGEVPNL+P DEKQE+CEKMRQ+DRQRDK +QTDG+PV+L+NFF+QRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQ+WPEDAL AVA RFLEDVELD   + GC D+CK FHT+TR LS+++ LEL R+NYVTPTSYLELI+TFKNLL KKR EV KQK+RYE GLEKL SA+S + +MQKEL D QP+L  ASKEVD+ M+++E+ S E +K EK+VK +EA+AN+QAK A+AIK+ECD DLAEAIP L SAL AL+TLT  DITIV+ M  PP  ++LV+EAVCV+KGIKP+RV DPSGSGKKIED+WGP+K++LG+MKFLE L  FDKDNIP+  MK IR KY+TN DF+PE++ VASTACEGLCKWV A++ YD+VAKVVAPKK  L+KA  E   AMS L KKRA+L+EVQDKL  L E LE+NK++K DLE +VDLCSKKL RAEQLI GLGGE+DRW Q A +LGV++ NLTGDIL+SSG VAYLGAFTS+FR ++   W+  V ++ I CSD FSLI TLG+PV+IR+WNI GLPTD FS+ENGII++N+RRWPLMIDPQGQANKWIKNMEK NN+ VIKL+D+DFVR LENCIQFGTPVLLENI EE+DPLLEPLLLKQ FKQ G++CI+LGDS IEYS DF+FYITTKLRNPHYLPET+VK              DQLLGIVV+RERPELEEEKN LI QSA+NK++LKE+ED+IL VLS+SEGNILEDE+AIKVL+SSK L+NEI+EKQA  EETE+KID AR+GY PIA+HSTILFFSIADLANI+PMYQYSLTWFINLF LSIDN+EKSE+L  RL+NL ++FTYSLYCN+CRSLFEKDKLLFSF+LC NILKHD  I E+EWRFLLTGG+GLDNPH NP+ WLP KSWDE+CRL+DL  F G++ +F+ QKD WK++YDSV+P +Q++P +W ++L+ +F K+ VLRCLRPDKI  A+Q FV E++GKK+IEPPPFDLP S+NDSN TSPLLF+LSPGADPM+ALLKFADDQGFGG KF+SLSLGQGQGPIAM M+++GIKEGTWV+LQNCHLAPSWM  LEK  EE NPE  HPDFRLWLTSYPS+ FPV+ILQNGVKMTNEPPKGLRFNI RSYLSDPISDM+FF   KDL+   +KKLLFGLCFFH IVQERRKFGP+GWNI YEFNETDLRISV+QLHMF++QYD VQYDAL+YLTGECNYGGRVTDDWDRR L + L +FYC  + +  DY FD+S  Y+APPD +YE Y+EYIK+LP NP+PG+FGMH NADITKD  ET+LLFD+ILLTQA+ SSGGGKSTD++VD+V+ D+L+++PPNFDT+  +RKYPT Y+QSMNTVLVQEMVRFN LLS +RSSLQNIRKAIKGLVVMS+DLEEVV+S+LK KIPGMWMK+SYPSLKPLGSYVNDF+ARLKFL DW+D+G PP FWISGFYFTQAFLTG QQN+ARKYTIPIDLL FDYEILDD + D  PEDG YV GLF+DGARWDR    + ES PKVL D MP +W+KP KKS+IP K  Y+SP+YKTSERRG LSTTGHSTNFVIA++LP+DKP++HWI RGVALLCQLDD
Sbjct:    1 MADLDLTPGRANGRSKGKGTDDP--IRFLPVLPSKRSKPVWQQNQPNFELSGKILGDDKNGIDLVGELTAREPKRRKPNQLKPIEKQNGADTDVTQFQQPKKDRENFRKALVDIIMQEDGVPPHSASGSVNGNGELPPLSRTGTP---TAADKDILRYYYYIHNGIDTEHVAPMEDSWLENVLGLVSEELKKGHSETIENLSDEMREDYLLSVKKAIVDFVLKDQREKEKDVEEKRPPHREEMDVVPKPWHKDYVAGLEAMSQKLHITTPCMLQVLDFWHTKFGGLRFIDINEFHNRVDSMELGTFQNLCMRHIENAKDQLMKKWFPEVQVMFYEGNKRKQVPSNQDPEKLESFFNCAATLMTDNLQQLTLNSLDDYSDLLCQPP----------TSTRAY-------------EHPGFILRLILDGTAIKFEPTFKEFEVIILNVYDVMIKASQQVPRVETKLYLDWSGNKAKSNLQPVVLKEILEAHKEKVKELIKKESVGPVEHCKIYDKYNFLISKQADADVDVFLGE---THSFDEYAKEITKYKKLVDEVTYNLDKVMRLGMFEVHCDDLIRSLAKRAEALCQKLLGKMSEDHKEANKKLCDDYEQIAEKALTTPSNTEHLMELKAYIEKVESDIIFTMEKRLMESKDRLTFLSDFAQFSPAEMRLNASVFKWHGRMPTIFEEHKMIVSDRRTQYEEALKVRRERFVEELESYQKQVEEFATYGDMNEIQKYLRKSQNLETKLTAAAEKIEAFNNEEEAFGWQTTAYPQRQTIQNTLKPYLSLYELTVEFNNKYNDWMHGPMSNVNPDEVENEVGNFWRNLYKLEKQFDSVPQAKKIASKVKAKVEEFREYMPLVQTVFNPGLRDRHWEQISEVVKYPLKPDETYTLDKMLEFDLMKYVPQFEGISEAASKEFSLEKAMEKMKNEWAPIEFVMIPYRDTGTSILSSVDDIQLTLDDHIVKTQTMRGSPFIKPFEEEIKDWESKLMLLQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRRFTTVDKNWKDIMKQALQDKKVLSVIAIEKMLEKLKKSNELLELIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIAKLEFTDTLDITHMKSSEGEIVELRDVISTSKARGQVEKWLLELEADMISSLHKVIGESLDAYPKEDRKEWVKRWPGQAVLCVTAKYWTDFIEDAFKKGGTALKEYLDLNIKQIDDIVAMVRGTLSKQNRVTLQALIVLDVHAKDVLFKLVENDCSSDLDFQWLSQLRYYWEESQMVTRMINSMLKYGYEYLGNTGRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRGINSGSDTLLFEGTEIRLDPTCSVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYALIAEISLYSCGFVQARPLSVKIVAVYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPEEDENILMLRSIIDVNLPKFLNHDLPLFHGITSDLFPGVKLPEPDYKVLNEAVQENCIKMNLQCTNFFLEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDIHEKGLMEENKVQITVINPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLANTTNLMFEPMDLEVASPATVSRCGMIYMEPSSLGWRPVVKSWMNEMPAAVTEMHRSTINDMFERFCDPCIQLVRKGGVKELSPTSDTALVKSLMNLMDSLMEEFQDEAKITQMEDREIMSWLECIFFFACTWSIGASVNDEGRVHFDKLLRELISGGMTEETRIKLSLPELVEPPEKPYLNPFPPKGRCYDYKFVKE----GAGRWVQWAEEIKDSPPIPKEAEFNEIIVPTVDTVRYTALMSLLIRNQKPCLFVGPTGTGKSVYICDFLLNKLDKEKYKPNIINFSAQTTAQQTQNIIMSKLDKRRKGVFGPPLGKKAIVFVDDLNMPMLEQFGAQPPIELLRQWLDHWNWYDLKETTPMKLIDIQVMAAMGPPGGGRNPVTPRFLRHFNMITINEFDDDSMITIFRKIMDWHISSRGFSNEFKPCVDQLVQGTLTTYKEAMKNLLPTPAKSHYLFNLRDFSRVINGVLLSTPETMEEPASMKRLWVHEVFRVFYDRLVDDSDRNWLFNYVREVCKTCLREDFDQLFIHLDFDNDGKVMEDDLRSLVYCDFADPKSDAKHYVEVRDLEQLRVTVEGYLDEFNNMSKKPMNLVLFRFAIEHVSRIARVIKQKRSHALLVGVGGSGRQSLTRLAAHMADYDLFQVEISKSYTSNEWREDLKRILRKATETDNHAVFLFSDTQIKQESFLEDINNLLNAGEVPNLFPLDEKQEICEKMRQLDRQRDKTKQTDGTPVSLFNFFIQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQSWPEDALEAVANRFLEDVELDDEERLGCTDICKTFHTTTRELSQRFFLELERHNYVTPTSYLELINTFKNLLSKKRDEVMKQKKRYEKGLEKLDSASSQVGLMQKELTDLQPQLKIASKEVDEIMVVIEKDSIEVAKVEKVVKADEAVANEQAKGAKAIKDECDADLAEAIPALNSALAALDTLTQQDITIVKAMKQPPYMIKLVLEAVCVIKGIKPERVPDPSGSGKKIEDYWGPAKKMLGDMKFLESLHNFDKDNIPVANMKQIRAKYITNPDFEPEKVKVASTACEGLCKWVKAMDVYDRVAKVVAPKKEQLKKAEAELAVAMSLLEKKRASLREVQDKLAKLQETLENNKKKKADLETQVDLCSKKLERAEQLISGLGGERDRWSQNARELGVKYNNLTGDILISSGTVAYLGAFTSAFRQDQVDMWIKRVKDRGILCSDDFSLINTLGEPVKIRAWNISGLPTDNFSLENGIILANARRWPLMIDPQGQANKWIKNMEKANNIHVIKLSDSDFVRTLENCIQFGTPVLLENIAEEMDPLLEPLLLKQVFKQAGAMCIRLGDSTIEYSQDFKFYITTKLRNPHYLPETAVK--------------DQLLGIVVARERPELEEEKNALIIQSADNKRQLKEIEDKILEVLSSSEGNILEDETAIKVLSSSKVLANEISEKQAIAEETEKKIDTARMGYTPIAVHSTILFFSIADLANIEPMYQYSLTWFINLFILSIDNAEKSEDLDARLKNLHNHFTYSLYCNICRSLFEKDKLLFSFLLCVNILKHDKQINEEEWRFLLTGGIGLDNPHPNPATWLPVKSWDEICRLEDLEHFKGLKNKFVSQKDGWKEVYDSVDPFHQKMPGDWGDKLQ-TFQKLLVLRCLRPDKITPAVQEFVTEKLGKKFIEPPPFDLPKSYNDSNPTSPLLFVLSPGADPMSALLKFADDQGFGGAKFDSLSLGQGQGPIAMAMMEKGIKEGTWVMLQNCHLAPSWMPTLEKICEEFNPEQIHPDFRLWLTSYPSNQFPVSILQNGVKMTNEPPKGLRFNILRSYLSDPISDMDFFNGVKDLNKKPFKKLLFGLCFFHGIVQERRKFGPLGWNIPYEFNETDLRISVRQLHMFLNQYDDVQYDALRYLTGECNYGGRVTDDWDRRMLHSTLDRFYCKDIIQKTDYYFDESKHYFAPPDGEYESYLEYIKSLPHNPKPGIFGMHDNADITKDQGETKLLFDNILLTQAKASSGGGKSTDEVVDDVAQDILSKIPPNFDTDAALRKYPTSYKQSMNTVLVQEMVRFNRLLSIVRSSLQNIRKAIKGLVVMSADLEEVVLSILKGKIPGMWMKRSYPSLKPLGSYVNDFIARLKFLQDWYDDGAPPQFWISGFYFTQAFLTGAQQNFARKYTIPIDLLGFDYEILDDADKDTPPEDGVYVFGLFVDGARWDRPTNCLAESKPKVLFDSMPKVWMKPCKKSDIPEKQIYVSPIYKTSERRGVLSTTGHSTNFVIAISLPSDKPQDHWIRRGVALLCQLDD 4000          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Cavefish
Match: dnah12 (dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:ZDB-GENE-090311-9])

HSP 1 Score: 4013.38 bits (10407), Expect = 0.000e+0
Identity = 2060/3844 (53.59%), Postives = 2708/3844 (70.45%), Query Frame = 3
Query:  711 KPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEF-DKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSI-RLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKK---------------------------IAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLP-PAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHD--KPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDF--SDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXT-DGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSA-WLPPKSWDELCRLDDLSVFHGIRQ----RFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFG--TSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQ-ARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD 12113
            +PW  SFI + K  +K+L++ +P M  +L++  ++F +L LVD+   R     +     ++      E  + KLM  W   V ++      K  V  +  +  L+ F+NCASTL+++ L+ +   S++ + NL                            D  +  + P F + L  E+  + F PS +D E  +L ++  +   +  V  ++S     W  +     ++  ++  +    ++T++N +      P +H + + + Y  L+NR     ++  + E    HSF+++ + ++ +  L ++I   S  S+    M  L C+EL + L+K+A+   + LL+++I   RQ   E+ +E+E I +KA+  P  TE M+E+I ++S      + EL  K+ ++++R  +L+    F+  D+ LN  +      +  IFD N + +EQ K++ +  L+ KRE+ + +L+   +++EEF    +++ + +Y+ + + +   L+     I   NKEE  + WD T YP    ++  + PY K++   +++    K WM+GS   +  + ++A++  ++R ++K+ K F+ K    +                           +  KV  +++EFKEH+P++  L  PG+R RHW+Q+S+IV + L    G  L K++  NL  ++  FE+IS AA KEF+LEKA++ M   W  + F   A+RE+G  IL++VD+IQ MLDD IVKTQTMRGSPFIKPFE EIK WE +LI +QD +DEWLKVQA WLYLEPIFSS DIM QMPEEG+ F +VDK W+E+M+  + D +VL    +  +L+KL++SN LLE I+KGLN YLEKKRL+FPRFFFLSNDE+LEILSETKDP RVQPHLKKCFEGIA L F   LDI  M SSE E V L  +ISTS+ARG VEKWL+++E  M++S+R  I+   + Y  T R +WV++W GQ VL  S  YWT  V +AI+ G   L  Y     SQ+ +IV LVRG+L KQ RTTL AL+ +DVHARDV++ +I++ V++E DF WL QLRYYW  +N+   +IN  +KY YEYLGN+ RLVITPLTDRCYRTL GA +L+LGGAPEGPAGTGKTETTKDLAKA+A QCVVFNCSDGLDY+A+GKFFKGLAS GAW+CFDEFNRI+LEVLSVVAQQIL IQRAI  + +   FEGTEL+L+P C V ITMNPGYAGRSELPDNLK LFR+VAMMVP+YALIAEISLYS GF+NA+PL+VKIV TYRLCSEQLSSQ HYDYGMRAVK+VL AAGNLKLK+PDE+EDIL+LRSI DVN PKFL+HD+PLFNGI SDLFPG++ P  DY +     +E C K N++    F++K+ Q YEMMIVRHGFM+VGEPF GKT    VLA  L  + E+G  +E KVQY  +NPK+ITMGQL+GQFDPVSHEW+DG++A ++R +A++ TPDRKW++FDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQ+S   +LIFE MDL  ASPATVSRCGM+YMEP+ LGW P+  SWL  LP P  T  +  +  ++F   I   +  + +   +E+  T++ N V SL  L +  +     E    +   ++I TW+   F F+  WSIG + + + R+ FD+  RE+++G + E           +P  +  ++  +  KG +YDY +    +  G G W HW+E +K      K+ K  +IIVPT DT+  T    L++     +P LFVGPTGTGKS Y+ + L+N +NK+ Y P  INFSA+TSANQ+QNIIM++LD+RRKGVFGPP+GKK I+FVDD+NMP  E +GAQPPIELLRQ+ DH NWYDLKDT+ I L+D+Q I AMGPPGGGRN +TPRFLRH N  ++N F D+TM  IFS+++ +++   +F  D     NQ++ ATL+VYK AM NLLPTPAKSHY FNLRDFSRV+QG LL    ++E    M RL+ HE+FRV+YDRLV DQDR+W +  ++ +  +H  E FD +F+HL      K+ E+D+RSL++ D+   D ++S + Y EV  +E   + VE YL EYNQ  K  MNLV+FR+ +EH+SRISR+LKQP  +ALLVGVGGSGRQS+TRLA  MAD  LFQ EISK+Y   EWREDLK +L+K+       VFL +D QIK+E+FLED++++LN GEVPNL+  DEKQE+ E M  +        ++ + SP+AL+ FFV R R+ LH+V+A SPIGDAFRNRLR+FPSL+NCCTI+WFQ WPE+AL  VA +FLE +E+    +   + +CK FHTS   LSEK+L EL R+NYVTPTSYLELI+ F+ LL  KR  V   K+RY  GL+KL  A S +  M+KEL D QPKL +A  +  K + ++E +S +   + K+V+ EE  A+ +A  A+A+KNEC++DLAEAIP LE+AL AL+TL P+D+TIV++M +PP GV+LVM AVCV+K IKP+++NDP+G+G+KI D+WGPSK+LLG+M FL  LK +DKDNIP P+M  IR +Y+TN DF P ++A AS+A EGLCKW+ A+E YD+VAKVVAPKK  L  A       M+ LN+KRA LKEV+D+L  L + LE     +  L+ +VDLC++KL RAE+LIGGLGGEK RW +AA DL   + NLTGD+L+S+GV+AYLGAFT+ FR   TK+W      K+IP SD FSL  TLGDP++IR+WNI GLPTD FSI+NG+I+SNSRRWPLMIDPQGQANKW+KN E++NNL VIKLTDAD++R LENCIQFGTP+LLEN+GEELDP LEPLLLKQ FKQGG  CI+LG+S+IE+S DFRFYITTKLRNPHYLPE + KV+LLNFMITPEGL+DQLLGIVV++ERPELEEE+N LI QSA NKK+LKE+ED+IL  L +SEGNILEDESAI++L+S+K +SNEI++KQ   E+TE KI E+R GY PIA HS+ILFFSIADLANIDPMYQYSL WF+NL+  SI +S KS+ L++RL+ L ++FTY+LYCNVCRSLFEKDKLLFSF+LCSN+L     I+  E+ FLLTGGVGL N   NP   WL  KSWDE+CR  DL    G+R      F+        IYDS EP+N  LP  W ++L D F KM + RCLRPDKI  AI N++  ++GKK++EPPPFDL  S+NDSN T PL+F+LSPGADPMA+LLKFA+D+  GG  F+S+SLGQGQGPIA+KMIQ  +KEGTWV LQNCHLA SWM  LEK  E+ +PET HPDFRLWLTSYPS  FPV ILQNGVKMTNEPP GLR N+ +SYLSDP+SD +FF   ++K+L  W+KLL+G+CFFHA+VQER+KFGP+GWNI Y FNE+DLRIS++QL +F++ Y+ V ++A+ YLTGECNYGGRVTDDWDRR L+TIL  FY   + E+P Y F  SG YY+PP   YE Y+E+I+ LP    P VFGMH+N DI+KD Q+T+LLFDS++LTQ      G     D  + +++ D+  +LP NF+ +  + K+P  YE+SMNTVLVQEM R+N L +TIR SLQN+ KAIKGLVVM ++LE +  S+L  K+P  W K+SYPSLKPLGSY+ DFL RLKFL DW+D   P +FW+SGF+FTQAFLTG  QNYARKY+IPIDLL FDYE+L       +PEDG YV GLFLDGARWD+K  ++ E HPKVL D +P+IW+KP          ++L  +  TSER+GTLSTTGHSTNFVI++ LPT K  +HWI RGVA+LCQLD+
Sbjct:  134 RPWHDSFIRSRKLIKKNLHILHPVMKIILDICYVTFSDLLLVDLSACRSS-GPVSCGSLKNKVALECERIETKLMNTWFPKVIHLL---TSKDTVQGITTE-KLDAFYNCASTLLSNQLKAVVERSVVAFVNLF---------------------------DPLSTHKLPLFRMNLTFEEEKMDFYPSFQDMEEAVLEIFTSISNTMQKVQTVQS-----WLSETNNSVIDAKLVDHVRAWAETTLKNAVWKNLEAPNQHFQNYSNNYDWLVNRTAQDLVEKFIQE---EHSFDQYTQVIEKFQALSREI--SSLPSVAHFDMIRLDCEELKQGLAKKAETFAQILLEQLINTQRQQCLEICEEFETIQKKAMKKPETTEDMIEMIAYISHARTKGLEELHSKIMETHQRFTYLLHVHTFSAEDLELNSKMVLWPQNINPIFDLNNELLEQAKQKGEQELQGKREKLMLKLEKLGRRMEEFAECSELDMMQQYVTEIKTVQKWLQEVEDSISFINKEEALYKWDQTVYPEIDVMKENIEPYQKVFGLVLKWQRTEKRWMDGSFLDLNGESMEAELDEFFREIYKMLKSFQQKQKKAEQGRERQVAMKRRPGEGDDDHLESPTALMCIKVIEQIKEFKEHIPMVSILCNPGIRARHWEQMSEIVNHDLTPNSGTTLRKVLKQNLSAYMEHFETISAAASKEFSLEKALQNMVETWDIISFSHHAHRESGVSILTAVDEIQTMLDDQIVKTQTMRGSPFIKPFEKEIKAWEERLIRIQDTIDEWLKVQAQWLYLEPIFSSQDIMQQMPEEGQLFQTVDKHWREVMRHCVKDPKVLPATSLTGLLEKLQESNNLLEQIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLDFLPNLDIQAMYSSEGERVELIQLISTSEARGAVEKWLVQVEDVMLSSIRDVINRSRLAYPETKRSQWVREWPGQVVLCTSQMYWTQEVHEAIRSGVGGLKNYYNQLQSQLKDIVELVRGKLPKQTRTTLGALVTIDVHARDVVMEMIEKGVSHETDFQWLAQLRYYWNNDNVRVCIINCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIEMKLEFFDFEGTELRLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKFPDENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGISLPAADYQLFLDCAQECCKKHNVQPVKVFLDKMIQTYEMMIVRHGFMLVGEPFAGKTKVLHVLADTLTLMNERGYNDEEKVQYRTVNPKSITMGQLFGQFDPVSHEWTDGIVANTFREYASAETPDRKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSNQMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWLPLVTSWLNTLPQPLQTQENSTLLLELFNWLIPPALRML-RKNCREVVSTTNSNTVVSLTRLFEMLL----TEPVTEEPGNKNIRTWIMAAFAFSLVWSIGGSCDRDSRERFDQFLREILSGKLEE---------HPIPAAVSKWECPFNDKGLVYDYSY----EFKGKGCWIHWNESIKNVTLGDKNTKVQDIIVPTIDTIFCTLFTTLIIFFSPFRPLLFVGPTGTGKSVYVKEKLMNNLNKERYLPFFINFSARTSANQSQNIIMARLDKRRKGVFGPPMGKKCIIFVDDMNMPAMEVFGAQPPIELLRQYFDHGNWYDLKDTSKITLVDVQLISAMGPPGGGRNAVTPRFLRHFNICSMNAFSDDTMSRIFSNVVAFYLRNNDFPNDCFSIGNQIVAATLEVYKKAMENLLPTPAKSHYTFNLRDFSRVVQGCLLLKKESLENKRTMIRLFVHEVFRVFYDRLVDDQDRDWLYKLMKNIVKEHFKESFDTVFEHL------KLCEEDMRSLLFGDYMTPDVEASERLYAEVPSMESFSQVVESYLTEYNQTHKNRMNLVIFRYVLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATFMADMTLFQPEISKNYGMNEWREDLKLLLKKAGVKGQKTVFLLTDAQIKEEAFLEDVDSVLNTGEVPNLFAVDEKQEIMEVMHAVRPIAQAGNKSLEFSPLALFAFFVNRCRENLHVVVAFSPIGDAFRNRLRQFPSLINCCTINWFQPWPEEALERVANKFLETLEMSDHERQEVMLICKTFHTSAIHLSEKFLSELGRHNYVTPTSYLELIAAFRLLLTNKRDTVMNAKKRYTNGLDKLAFAESQVGEMKKELVDLQPKLEQAKIDNIKMVQVIEVESVQVEAKSKVVRVEEEAASQKAAEAQALKNECESDLAEAIPALEAALSALDTLKPSDVTIVKSMKNPPSGVKLVMAAVCVMKDIKPEKINDPAGTGQKILDYWGPSKKLLGDMNFLRDLKVYDKDNIPAPVMHKIRSEYMTNPDFDPTKVAKASSAAEGLCKWITAMEVYDRVAKVVAPKKANLIVAQQSLAATMALLNQKRAELKEVEDRLAALKKTLEEKTEEQAQLQFQVDLCARKLERAEKLIGGLGGEKTRWSKAADDLQNTYDNLTGDVLISAGVIAYLGAFTAGFRQNCTKEWTKLCKSKNIPSSDDFSLSKTLGDPIKIRAWNISGLPTDSFSIDNGVIVSNSRRWPLMIDPQGQANKWVKNSERENNLNVIKLTDADYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQIFKQGGMDCIRLGESVIEFSSDFRFYITTKLRNPHYLPELATKVSLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKEIEDKILETLQSSEGNILEDESAIQILDSAKIMSNEISKKQQIAEKTELKIAESREGYRPIAKHSSILFFSIADLANIDPMYQYSLNWFVNLYINSIQDSNKSKILEKRLRYLINHFTYNLYCNVCRSLFEKDKLLFSFLLCSNLLLAKKEIEYAEFMFLLTGGVGLQNNVPNPDPNWLQDKSWDEICRASDLPGLQGLRYPPFCHFL-------PIYDSKEPYNTPLPKPWCDKLSD-FQKMIIYRCLRPDKIEPAISNYITGKLGKKFVEPPPFDLSKSYNDSNSTIPLVFVLSPGADPMASLLKFANDKNMGGANFKSISLGQGQGPIAVKMIQSAMKEGTWVCLQNCHLAVSWMSTLEKICEDFSPETCHPDFRLWLTSYPSPMFPVTILQNGVKMTNEPPTGLRLNLLQSYLSDPVSDPQFFSACSNKEL-VWEKLLYGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISIRQLQLFVNSYEEVPFEAITYLTGECNYGGRVTDDWDRRLLLTILADFYNKDIIENPRYMFSPSGKYYSPPKSIYEDYVEFIRNLPATQHPEVFGMHENVDISKDLQQTKLLFDSLILTQGGGSKGGASSGGDSTLMDIANDIRTKLPENFNIDSALNKFPVLYEESMNTVLVQEMERYNNLCNTIRVSLQNLLKAIKGLVVMDAELEAIAGSLLVGKVPEKWAKRSYPSLKPLGSYITDFLTRLKFLQDWYDTTKPNVFWLSGFFFTQAFLTGAMQNYARKYSIPIDLLSFDYEVLPFDTSATSPEDGVYVHGLFLDGARWDKKSGVLAEQHPKVLFDSVPIIWIKPKHCC------TFLL-LSCTSERKGTLSTTGHSTNFVISIMLPTSKRPQHWIKRGVAMLCQLDN 3895          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Cavefish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 2446 bits (6338), Expect = 0.000e+0
Identity = 1385/3393 (40.82%), Postives = 2013/3393 (59.33%), Query Frame = 3
Query: 2070 FQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEA---FGWDV--TTYPVRQEVQNVLRP---YLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTL-RNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASL----VFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYK--ATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPE-----ALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVEN--NMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWAD----IFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQM-SKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELD--QSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGE-EAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAE-KTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHE--NP-SAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSS----GGGKSTDDIVDEVSADVLNRLPPNFD---TEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPI-FWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEI--LDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPE-EHWIMRGVALLCQLDD 12113
            F++ L F  E F +++ +  +        G        L++  VL  +LE+         KEEE     G  +  T  P  +++QN+ +     L+++E + +++  + +W  G    ++ + +++     Y+ L KL ++ ++K    +I    K ++E+FK  +P+I  L  P +RDRHW QI   +  +   N     L K++ + LE    +   IS AA KE ++E+++E +   W      +  Y++ GT      +++   L+D+ V   TM+ S F++ FE E+  WE  L LV ++++  L VQ  W+YLE IF   DI  Q+P E  +F  ++ +WK IM ++  D   L       +L+KL + N  LE I K L+ YLE KR  FPRF+FLSND+LLEIL ++++P  VQPHLKKCF+ I SL    V     +   M S++ E V     +      G VE WL ++E  M  +++  +       K     R +WVK W GQ ++  S   WT  V   +  G E     AL +  K   S +      +RG LSK  R  + AL+ ++VHARDV+  L +    + N F WLCQLR YW ++  + I +  N+  +YGYEYLGN+ RLVITPLTDRCY TL  ALHLH GG+P+GPAGTGKTET KDL K +    +V NCSDGLDY ++G+ + GLA  GAW CFDEFNRI++EVLSVVAQQIL+I  A+ A     +FEG ++ L  +C +FITMNPGYAGR+ELPDNLK++FR ++M+VPD  LIAEI+L+  GF N + LA K+   Y L  +QLS Q HYD+G+RA+ S+L  AG  +   PD  ++ ++L S+ D+N+ K  + DLPLFNGI  DLFP V  P  DY  L + I+E   +  L+ + F + K+ Q+YE    RH  MIVG+    K+  +++L  AL  +  +G    N V    LNPKA+++G+LYG++D  ++EW+DGVL+   R       PD KW++FDGPVD +WIE+MN+V+DDNK L L++GE I +    +L+FE  DL VASPATVSRCGMVY + + LGW+P   SW+        D  +KM  D    +F+R+I   I+  K+   KEL P +++N V SL  L D      + E  ++  D  +    +E  F F+  WSI A+ +E+GRK  D   RE+                          +G +P+K TIY+Y ++  K +     W  + + +        +A F +I+VPT DTV+Y +L+N L+    P L  GP GTGK+  +   +L  ++   +    IN S+QT++N  Q II S++++R KG + P  GKK++ F+DDLNMP  + +G+QPP+ELLR W+D+  WYD +       +D+  + +MGPPGGGR  I+ R     N I +    +  +  IF +++N  +  Q F  + KP  + L QATL++Y +     LPTPAK HYLFNLRD S+V QG+L S  +  +    + RLW HE FRV+ DRLV   D E F   + E     L   FD+ + ++  ++   +            F D       Y ++ D + L+  +E  L++YN      PM+LVLFR AIEHV+R+ R++ QPR + LLVG+GGSGRQSL+RLAA + +Y +FQVE++K Y   E+RED+K++ R +   +   VFLF+D QI  ESFLEDINN+L++GEVPNLY +DE +EV   +    R+ + +   D    A++N+ ++RVR+ LHIVL MSP+G+ FRNR+R++P+LVNC T+DWF  WP+DAL  VA R+L+ + L   + ++     +    H S    S++  LEL R+NYVTPT+YLEL+S +K LL +KR E+ +Q  +   GL K+    S +  M  EL D + K+ E  K+ ++ ++++ QQ  EA +Q+  V    E I  ++ K  +A+      DL EA+P LE A+KALE+L   D+T +++   PP  V  VM+AV +L+G +P                W  +KR LGE  F++ L  FDKDNI   ++K I + Y T  DF+PE I   S A + LC WV A+E Y ++ +VV PK+  L  AM +     ++L +     +EV++KLK L  + +    +K DL  K +    KL RA +L+ GL GE+ RW Q    L      L GD LL++  ++Y+G F S++R E  T  W+    +  +PCS  F+  T L  P  +R WNI GLP+D FS ENG+I++   RWPLM+DPQGQA KWIKNME K  L+VI L   DF+RILEN +QFG+PVLL+N+ EELDP L P+L K     GG + +KLGD  +EY+ DF+FYITTKL NPHY PE S K T++NF +  +GL+ QLLGIVV RERPELEE+K+ L+   A+ K+KL+ELEDEIL +L+ + G++L+D   +  L +SK  + E++++    E+TE KID AR  Y P A  ++ILFF + D+  IDPMYQ+SL  +I+LFNLSI+ S++S  L++R+ NL  Y TY++Y   CR LFE+ KLLFSF +C+ IL+    +  DE+ F L GG+ LD   +  NP ++WL   +WD +  LD L+ FHG+   F +    W + Y S EP N  LP EW E + +   KM ++R LR D++   + +F+   +G +++EPP  D+     DS   +PL+F+LSPG DP  AL++ A+  G G   F +LSLGQGQ PIA +MI+ G+K G WV L NCHL+ SWM  L+K VE+L  E +HPDFRLWL+S P   FP+AILQ G+KMT EPPKG++ N+ R Y    +++ +F   S+ +  ++KLLF LCFFH+I+ ER+KF  +GWNI Y FN++D  +S   + +++D+Y+ + +DAL+YL    NYGG VTDDWDRR L T +  ++C      P +K      YY P D   + Y EYI+ LP    P VFG H NADI     ET+ LFD++L  Q + +S    G G S +D V E+SADV  ++P   D   T+ +++  P+     +N VL+QE+ R+NALL TIR+SL  + K IKGLVVMSS LEE+   +  +++P +W +K+YPSLKPL S+  D   R++  + W +   PP+ FW+SGF F   FLT V Q+ AR++ + +D L +++ +  +DD N    P+DG +++GL+L+GA WD+K   + E+ P  L  PMP I  +P++  +   K  Y  P Y    R G         +FV+ + L +     EHWI RG ALL  LD+
Sbjct: 1136 FKSGLFFSAEEFKKKMQTTMQDFNSTGPFGSNVSSEAALEQISVLRAQLESL--------KEEEGTIRHGLSIFKTEQPTSKDMQNLEKDIDYLLQVWEISQQWDTHWDEWKAGQFASLQTENMESTAQTMYKNLNKLSRELKDKQW--EIVEFSKNRIEQFKRTIPMILDLRDPAMRDRHWNQIKQEMQRSFDHNSAEFTLEKIVALGLEQHAERICEISGAARKELSIEQSLEGIAKTWEETSLDIAPYKDKGT------EEVFQALEDNQVTLSTMKASRFVRAFEKEVDRWERCLSLVLEVIEMILTVQRQWMYLEIIFLGEDIRKQLPHESTEFDDINSSWKTIMDRLNKDNNALRGTHHPGLLEKLSEMNSKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSRNPDAVQPHLKKCFDNIKSLRINKVRNNKSEAAGMFSADGEFVEFTHPVLLE---GPVEAWLCDVERTMRWTLKDTLRNCRTALKKMTGKRDKWVKDWPGQMLITASQIQWTTDVTKCLITGKESADKSALKSMKKKQVSMLHRYSDAIRGNLSKILRLKIVALVTVEVHARDVIDKLAKAGCCDVNAFDWLCQLRLYWEKDVDDCIIRQTNTHFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKGLGMYVIVVNCSDGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGLTNFIFEGRDICLVSSCGIFITMNPGYAGRTELPDNLKSMFRPISMVVPDSTLIAEITLFGEGFNNCKVLAKKVFTLYCLAVQQLSKQDHYDFGLRALTSLLRYAGKKRRVRPDIADEEILLMSMKDMNIAKLTSTDLPLFNGIIQDLFPAVETPTIDYGKLKETIEEELHQSGLQVTPFTVTKVIQLYETKNSRHSSMIVGKTGSSKSVTWQILQKALSAMHRKGEPGFNLVHEYPLNPKAVSLGELYGEYDLSTNEWTDGVLSSLMRIACADEKPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVEDLAVASPATVSRCGMVYNDYSDLGWKPYVQSWI--------DKRQKMEVDHLKRLFDRYIKKTIS-FKRTHCKELVPITELNGVISLCRLYD---SLASPENGVNPADNENYGRMVELWFIFSLIWSICASVDEDGRKKIDNFLREM--------------------------EGTFPNKDTIYEY-YVDTKNKT----WASFEDKLPKGWRYPSNAPFYKIMVPTVDTVRYHFLVNSLVCGQYPVLLTGPVGTGKTS-VAQSVLQGLDPAKWTMLTINMSSQTTSNNVQAIIESRVEKRTKGTYVPVGGKKMLAFLDDLNMPAVDDFGSQPPLELLRLWIDYGFWYDRQMK-----MDMFLLASMGPPGGGRTHISGRLQSRFNLINMTFPAESQIKHIFGTMINQKL--QEFQEEVKPIGSILTQATLELYYAISARFLPTPAKIHYLFNLRDISKVFQGLLRSHRDFHDTKQSITRLWIHECFRVFSDRLVDQADTEAFVALLAE----KLGSLFDLTYHNICPNKQQPI------------FGDFLKEPHVYEDLLDFKALKGFMESQLEDYNLTPGVVPMSLVLFRDAIEHVTRVVRVISQPRGNMLLVGIGGSGRQSLSRLAAYICEYMVFQVEVTKQYRKQEFREDIKKLYRLTGVDNKPTVFLFNDTQIIDESFLEDINNILSSGEVPNLYKSDEFEEVQSALSDSARKENVLETAD----AMFNYLIERVRNNLHIVLCMSPVGEPFRNRIRQYPALVNCTTLDWFSEWPQDALLEVAERYLDGLILGNVEKIQTKVARIFVTMHQSVAQFSQRMKLELKRHNYVTPTNYLELVSGYKKLLAEKRAELGEQVSKLRNGLFKIDDTRSKVEAMSVELEDAKKKVAEIQKQCEEYLVVIVQQKREADEQQMAVSAHSEKIGAEEIK-CKAMAENAQRDLDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMILRGCEPT---------------WAEAKRQLGESNFIKQLVHFDKDNISDRVLKKIGQ-YCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIYRVVEPKRARLHGAMTQLAEKQAALAEAENKRREVEEKLKQLKNQYDEKLNQKEDLRKKSEDMELKLDRAGKLVSGLAGERVRWEQTVESLEKDMGYLVGDCLLAAAFLSYMGPFLSNYREELLTNIWMKQFRDLEVPCSPGFNFATFLSKPTAVRDWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNMESKRGLKVIDLQMPDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSFTHIGGRVLLKLGDKEVEYNPDFQFYITTKLSNPHYTPEISTKTTIVNFAVKEQGLEAQLLGIVVRRERPELEEQKDSLVINIASGKRKLQELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVSDQLETSEQTEIKIDTAREAYRPCAQRASILFFVLNDMGRIDPMYQFSLDAYIDLFNLSIEKSQRSHKLEERIINLNDYHTYAVYRYTCRGLFERHKLLFSFHMCAKILEVAGKLNMDEYSFFLRGGLVLDKEGQMDNPCTSWLADSNWDNITELDKLANFHGLMSSFEKYPKDWHQWYTSSEPENAPLPGEW-ETVCNELQKMLIVRSLRQDRVSFCVNSFIINNLGSRFVEPPVLDMKAVMEDSTTKTPLIFVLSPGVDPTGALVQLAEASGMGPS-FHALSLGQGQAPIATRMIKEGVKNGHWVFLANCHLSLSWMPQLDKLVEQLQVEDSHPDFRLWLSSSPHPEFPIAILQAGIKMTTEPPKGVKSNMKRLY--QLVTESQFSRCSRPV-VYRKLLFSLCFFHSILLERKKFLQLGWNIVYSFNDSDFEVSENLMSLYLDEYEEIPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCEGAVNTPFFKLSSLPTYYIPRDGSQDTYREYIRQLPPVEHPEVFGQHPNADIASQISETRTLFDTLLSLQPQVTSTTATGAGPSREDKVLEISADVRQKVPELVDYESTQKLLQDDPS----PLNVVLLQEIQRYNALLHTIRTSLTELEKGIKGLVVMSSSLEEMFQCIHDARVPPLW-EKAYPSLKPLASWTRDLCQRVEQFAHWAETAHPPVLFWLSGFTFPTGFLTAVLQSSARQHNVSVDTLSWEFIVSTVDDNNLLFPPKDGVFIRGLYLEGAGWDKKNSCLVEAEPMQLVCPMPTIHFRPVENRKKVAKNMYSCPCYYFPVRSG----GAGRPSFVVGVDLKSGAVSYEHWIKRGTALLMSLDN 4407          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Cavefish
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 1959.5 bits (5075), Expect = 0.000e+0
Identity = 1213/3354 (36.17%), Postives = 1876/3354 (55.93%), Query Frame = 3
Query: 2208 TKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAY----RETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLD----ITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDY-KATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKE----GPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVE--NNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDY----DILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATST-TPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXE----LSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDL-KDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDA--KSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFL-EDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQ-WLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLD-NPHENPSAWLPPKSWDELCRLDDL--SVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYD-----SVQYDALQYLTGECNYGGRVTDDWDRRTLITIL------------QKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQAR-GSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEA---PEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLD 12110
             K+EA  GR +D    E+ F   +TTYP    VQ  +R   ++YE    +     +W +     +    +      + ++L KL K     P+    A  ++ +++EFKE +PL+  L    LRDR+      +  +  R      L  L D +L         I    G        ++++ + W  M+F V  Y    +E G +IL SVD+IQ  LDD+ V  Q+M GS FI PF   I+ WE  L L+ ++++ W+ VQ  W+YLE IF   DI +Q+PEE +KF  +DK +K+IM   + D  +     +   L  L+  ++ LE   K LN YL+ KR  FPRFFF+S+DELL IL  + +P  VQ H+ K ++ IASL F    +       + S+E E++ LK  +    A G+VE W+  +  +M  + RL   E +  Y +   R +W+  + G  VLA +  +WT  V+D  ++      +A+  Y K  + QID +V  +   L K +R  L  ++++DVHARD++ + +++ + +  +F W  QLR+YW +  +++  +  ++   YGYEY+G   RLVITPLTDR Y TL  AL ++LGGAP GPAGTGKTE+TKDLAKA+   CVV NC +G+DY+A+GK F GLA CGAW CFDEFNRID  VLSV++ QI TI+ A+  Q     FEG E+ LD    +FITMNPGYAGR+ELP+++KALFR V ++VPD   I EI L+S GF+ A+ LA K+   Y+L  EQLS Q HYD+G+RA+KSVL  AG LK   PD +ED++++R++ D+NLPKF+  D+PLF G+ SDLFPG++ P   Y    D +   ++EN  K +L  +   ++K+ Q+YE M+ RH  M+VG   GGK+     L  A   +   GL+     +   LNPKA+++ +LYG  DPV+ +W+DG+L+  +R     T   +R++++FDG VDA+W+ENMN+V+DDNK L L +GE I+L     L+FE  DL+ ASPATVSRCGMV+++P +L + P +  W+   PP      +K++       I+  +  I  G   E    + P +D+N+V  L       +DA  +   +S  +       LE  F  A   S+GA   E GRK FD L ++L     +++ +  LA    +P       G  P   T++D+ F     +    KW  WS LV  K   + D KF +I+VPT DT +  +L+  ++   +P + VG +GT K+    +F LN +N D      INFS++T++   Q  + + +++R K  +GPP+GK ++VF+DDLNMP  + YG Q PI LL+  LD    YD  K+    +L DL FI AMG  GGGRN +  RF+   +   I    +E +  I+SSIL  H  T+ F    +   ++L   TL++YK+ + +L PTP+K HY+FNLRD SRV  G+ L+        A   R+W +E  RV+YDRL+ + D+     +I+ +  +H   + D   +                 +++ D+  A  +S  + Y ++ D +  +   +  L+EYN+ +K  MNLVLF  A++H++R+ RI++  R HALLVGVGGSG+QSLT+LAA  A  D+F++ +S+ Y+ + +REDLK +  K    +   VFLF+D  + +E FLE INN+L +G VP L+P DEK+ V  ++    R       +  S  +++ +F+ +    LHIVL MSP+GD  R R R FP LVN   IDWF  WP  AL AVA  FL E   +  +  +  I    M H S    S  +  +L R NYVTP +YL+ IST+  LL  K   +  Q +R E GL+KL+ A+  ++ + K+L + +  L E S   +  +  +   +  A +++K+ + +     +Q K     K + ++ LAEA+P LE+A  AL+ L  +D+T +R+   PPK V++V E + V++G K              E  W  +K ++ E  FL  L   D D+I    +K +R  +L N +   E +   S A  G+ K+V A+  Y  VA+ + PK+  + +    +  +   L K ++ L+ +Q +L  L E+  +    K  L+ +  L  ++L+ A++LI GLG E  RW +   +L  + + L GD L+S+  ++Y GAF   FR E   + W  DV+E+ IP S  F + + L D VEI  W    LP DE S++NGI+ + + R+P+ IDPQ QA  WIK  E+KNNL++    D DF++ LE  I++G P L +++ E +DP+++ +L K      G   I LGD  ++Y  +F+ Y+ TKL NP Y P    K  ++N+ +T +GL+DQLL ++V  ER ELEE++ +LIQ+++ NK+ LK+LED +L  L+TS GN+L++   +  L  +K  + E+ EK    E T   ID+ R GY P A    ILFF +A++A ++ MYQYSL  F+ +F+ S+  S  +  L +RL N+ +  T ++Y   C  LFE+ KLLFSF +   I + +    ++E  F L G + L+ +  + P  WLP + W+++ RL++L  + F  + +   +    WK  +D   P     P ++ + L   F K+ +LRC R D++  A+ ++V   +G+KY++PP       F  S   SP++FILSPG +P   L+K A+  GFG  + + L++GQGQ  +A+++++  +  G W++LQNCHL   W+  LEK +E +     HPDFRLWLT+ P   FP+ ILQ  +K+  EPP GL+ N+  +Y    +  +     S    A++ L++ L FFHA+VQERRK+G IGWN+ Y+FNE+D  + ++ L+ ++ +       S+ + +L+YL GE  YGGR  D +DRR L   +            Q F+    N+D DY+         PPD   E Y+E I++LPL   P VFG+H NA+I    Q  + ++  ++  Q + G SGGG S D+ + +V+ D+ N+LP  FD +++ +K       + + VL+QE+ RFN L+  +  SL  +++A+ G V MSS+L+EV  ++   +IP +W K +  +LK LG+++  F  R +  S W + G P + W+SG +  +++LT + Q   R+   P+D       +   R+ DE    P  G YV GL+L+GA WD +   +  S PK L   +P++ + P++   +  + +  +P+Y TS RR  +         V    L T +   HW+++GV L    D
Sbjct: 1130 AKIEA--GR-QDLVGAEKLFDLPITTYPELLNVQREMRALRQIYEV---YKAAKTEWSQTLWVNLNIQLLQEGTEGFIKSLRKLPKDVRAMPV----AFFLEGRMKEFKESLPLLLDLKNEALRDRY------LFLHCYR------LYLLKDWSL---------IGSPQG--------VKEVVDTWEVMKFSVQRYFKGTQERG-YILGSVDEIQQNLDDNAVNLQSMAGSRFIGPFLNVIQQWEKNLSLISEVIEVWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDHIDKMFKKIMSDTVRDPGIKRCCLVPNRLSDLQNLSDGLERCQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SSEPACVQEHMIKMYDNIASLRFDSGTNGETVAGALVSAEGEVMELKQPVP---AEGRVEDWMTAVLLEMRRTNRLITKEAIFYYCQKKSRVDWMLDYQGMVVLAGNQVWWTWEVEDVFQKMSSGEKQAMKQYAKKMHQQIDNLVRRITQPLKKNDRRKLNTVLIIDVHARDIVDSFVRDSITDAGEFEWESQLRFYWDKKPDDLFVRQCSAEFSYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTESTKDLAKALGLLCVVTNCGEGMDYMAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALILQLKRFQFEGQEISLDSRMGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLLAKVLAKKMTVLYKLAREQLSKQSHYDFGLRALKSVLVMAGELKRGSPDLNEDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPNFNDAVETILEEN--KYSLLPNQ--VDKVVQMYETMMTRHTTMVVGPTGGGKSVVINTLCQAQTRL---GLL----TKMYALNPKAMSVIELYGILDPVTRDWTDGILSNIFRDINRPTDKKERRYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVFVDPKNLRYAPYWQKWVNSRPPKEQADLRKLFEKYVPSIIEMVVEGITDGKQGEKLKTIVPQTDLNMVVQL----SMMLDALLEPEDLSSEE-------LECFFIEALYCSLGAALLETGRKKFDDLVKKLSCLVSVQDEKT-LAGPGEIP-------GYLP---TLFDFHF-----DGTTKKWMPWSSLV-AKYIHNPDTKFIDILVPTVDTTRVNWLLEQMVKVKRPVVLVGESGTSKTATTQNF-LNNLNPDFTMVLTINFSSRTTSMDLQRSLEASVEKRTKETYGPPMGKSLLVFMDDLNMPRVDEYGTQQPIALLKLLLDRGGMYDRGKELNCKQLKDLGFIAAMGKAGGGRNEVDSRFISLFSVFNIPFPEEEALHLIYSSILKGH--TRPFEECIRNMCDKLTFCTLELYKTIIKDLPPTPSKFHYIFNLRDLSRVYNGLTLTNAERFLTEAQFVRVWRNECLRVFYDRLINETDKALVQGHIKSLIQEHFGSELDSAMRD---------------PILFGDYRTALSESEPRVYEDIQDYDACKALFQEILEEYNE-NKTRMNLVLFDDALDHLTRVHRIIRMDRGHALLVGVGGSGKQSLTKLAAFTAGCDVFEIVLSRGYSESNFREDLKTLYVKLGIENKRTVFLFTDAHVAEEGFLELINNMLTSGMVPALFPDDEKESVLNQI----RDEAVKMGSGHSKESVWQYFINKSASNLHIVLGMSPVGDVLRTRCRNFPGLVNNTGIDWFLPWPPQALHAVAQSFLGESPMIPAAHSETVIGHVCMVHGSVGEFSTLFQQKLRRSNYVTPKNYLDFISTYSTLLQDKDQFILAQCKRLEGGLDKLEEASVQLADLNKKLAEQKVVLAEKSSACESLLQEISTNTAIAEEKKKLAEEKAKEIEEQNKVILVEKKDAESSLAEALPALEAARIALQDLDKSDVTEIRSFAKPPKQVQVVCECILVMRGHK--------------EINWKTAKGMMSEANFLRSLMEMDCDSISGGQVKTVR-GFLKNLNTSSEEMQAISKAGSGMLKFVEAVMGYCDVAREIKPKREKVARLEKNFFQSKRELEKIQSELEAIQKELGALGEKYSAAMGEKQLLQEEAQLMERRLIAADKLISGLGSENQRWTEDLEELKKKRVRLLGDCLISAAFLSYEGAFNWDFRNEMVYEVWQKDVLERGIPLSQPFRIESLLTDEVEISRWGSESLPPDELSVQNGILTTRASRFPMCIDPQQQALNWIKKKEEKNNLKISSFNDPDFLKQLEMAIKYGFPFLFQDVDEYIDPVIDNVLEKNVKGAEGRQVIVLGDKEVDYDPNFKLYLNTKLANPKYSPAVFGKAMVINYTVTLKGLEDQLLSVIVGFERKELEEQRERLIQETSQNKRLLKDLEDSLLRELATSTGNMLDNVELVHTLEETKSKAGEVFEKLKLAETTSADIDKLRDGYRPAAKRGAILFFVLAEMALVNSMYQYSLASFLEVFDYSLRKSLPNSILPKRLSNIMNTLTLNVYNYGCTGLFERHKLLFSFNMTIKIEQAEGRAPQEELEFFLKGNLSLEKSKRKKPCDWLPDQGWEDIVRLNELFPNEFGALIEDIEKNPKEWKNWFDLDSPEQAPFPMKYRDSLT-VFQKLLLLRCFRVDRVYRAVSDYVTATMGEKYVQPPVISFEAIFEQSTPNSPIVFILSPGCEPANDLMKLAERSGFGTNRLKFLAMGQGQEKVALQLLETAVSRGQWLMLQNCHLLVKWLKDLEKALERIT--KPHPDFRLWLTTDPIRDFPIGILQKSLKVVTEPPNGLKLNMRATYFKIQLETL----MSCPHPAYRSLVYVLAFFHAVVQERRKYGKIGWNVPYDFNESDFLVCMEILNTYLTKAHNQGEGSIPWGSLKYLIGEVMYGGRAIDSFDRRILTVYMDEYLGDFIFDTFQPFHFFH-NKDVDYRI--------PPDGSKEVYVEEIESLPLANTPEVFGLHPNAEIGYYTQAARDMWTHLIELQPQTGDSGGGISRDEYIAQVARDIQNKLPSAFDLDVIRKKLGPDVSPT-SVVLLQELERFNRLVLRMSRSLSELQRALAGEVGMSSELDEVARALFNGQIPAIWRKLAPDTLKSLGNWMIHFRRRHQQYSSWVEVGEPAVMWLSGLHIPESYLTALVQATCRRNGWPLDRSTLYTHVTHYRSEDEVTEKPGQGCYVSGLYLEGADWDVEQGCLVRSKPKELVVQLPILKVIPIEAHRLRLQNTLRTPVYTTSMRRNAM-----GVGLVFEADLFTTEHHSHWVLQGVCLYLNSD 4340          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Cavefish
Match: ENSAMXT00000016172.2 (pep primary_assembly:Astyanax_mexicanus-2.0:4:1379218:1548247:-1 gene:ENSAMXG00000015711.2 transcript:ENSAMXT00000016172.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1896.32 bits (4911), Expect = 0.000e+0
Identity = 1158/3222 (35.94%), Postives = 1776/3222 (55.12%), Query Frame = 3
Query: 2550 IQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIF-SSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMK------SSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDA---IKEGPE-ALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYW--VENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVE-LDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEM-KFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKT----KQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGV--GLDNPHENPSAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQG--FGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSST-----FPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSS---GGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDW-FDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEIL--DDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLK--PMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQL 12107
            I  L  P +R RHWQQ+    G     +E   L+ L+++NL  F  +  +I + A KE  +EK + ++   W+ MEF   ++  T   +L S +D+   L+D+ V+ Q +  S  +  F  E+  W+ +L +   ++  W +VQ TW +LE IF  S DI +Q+PE+ ++F  +D  +KE+         V+       +  +L+     L    K L +YL+ KRL FPRF+F+S+ +LL+ILS   DP +VQ HL K F+  A + F    D    K      S E E V   +    +   GQVE WL  +   M A+VR  ++E +V Y+  PR++W+  +  Q  L  +  +WT  V  A   ++EG E A+  Y K   SQ++ ++ ++ GQLS  +R  +  +  +DVHARDV+  +I ++V N   F WL QLR+ W   E +    + ++   Y YEYLGNT RLVITPLTDRCY TL  +LHL + GAP GPAGTGKTETTKDL +A+     VFNCS+ +DY + G  +KGLA  GAW CFDEFNRI +EVLSVVA Q+ +IQ AI  ++    F G E+ L P+  +FITMNPGYAGR+ELP+NLKALFR  AM+VPD+ LI EI L + GF+ AR LA K +  Y+LC E LS Q HYD+G+RA+KSVL  AG+LK   P+  ED +++R++ D N+PK +  D+P+F G+  DLFP ++ P        K+++E+ L + L++   F+ K+ Q+ E++ VRH   +VG    GK+   K L     ++       + +  +  LNPKA+T  +L+G  +P + EW DG+ +   R  A  +    KW++ DG +D +WIE++NTV+DDNK L L S E I L+P+  L+FE   L  A+PATVSR G++Y+  A LGW P  +SW+           K     +F++++ A +  + +   K++ P  + ++V+ L +L++C +   +      +          E  F FA  W+ G             L ++ +    +E ++  +   +T+          +P +GT++DY    E +     K+E WS++V  +  +  +      +V TT+T++ +Y M  LL   +P + VG  GTGKS  ++   L  ++ D Y    + F+  T++   Q ++   L+++    +GPP  K++I F+DD+NMP  + YG   P  L+RQ +D+ +WYD       ++  +Q++  M P  G    I PR  RH +   ++    + + TI+ SIL  H+  + FS   + S  QL+Q  LD ++      LPT  K HY+FNLRD S + QG+L      ++ P  + +++ HE  RVY D++V D+D   F     E+  K   ED +         E+ KV        +YC F+      + Y+ V   E L KT+   LD YN+++   MNLVLF  A+ H+ RI+RIL+ PR +ALLVGVGGSG+QSLTRLAA ++  ++FQ+ + K Y  T+ + DL  +  K+   +   VFL +D Q+  E FL  +N+LL +GE+P+LYP DE + +   +R   R +  +   +      + FF++RVR QL + L  SP+G   R R RKFP++VNC  IDWF  WP++AL +V+ RFL++VE ++  +KD         H S    S+ YL    RYNY TP S+LE I  ++NLL  KR ++  +  R E GL+KL S ++ +  ++ +L   +  L + +++ D+ + +V  ++ + S+++ +   EE      A      + +C+ DLA+A P L +A +AL TL   ++T +++  SP   V  V  AV VL          P G   K +  W  +K ++ ++  FL+ L  F+K+NI    +K I + YL + +FKPE +A  S A  GLC WV  + K+ +V   V PK+ AL KA  E  +A   L+  +A +  + + L  LT + E     K+  + + +  ++ +  A +L+GGL  E  RW +A ++   +   L GD+LL +  V+YLG FT  +R E      K +L   ++  IP +     ++ L D  ++ +W   GLP D  S EN  I+++  RWPLM+DPQ Q  KWIKN +  +NLQVI++    ++  +E  +  G  VL+EN+ E +DP+L PLL ++T K+G    IK+GD   EY+  FR  + TKL NPHY PE   + TL+NF +T +GL+DQLL  VVS ERP+LEE K+ L +Q    K  LK LED +L+ LS++ GN L D   ++ L  +K  + EI EK    + TE KI+EAR  Y P A  +++L+F + DL  I PMYQ+SL  F  +F  ++  +   E L+QR+ NL    T S++    R LFE DKL ++  L   IL  +  I   E  FLL   V  G+ +P +    +L   SW  +  L  +  F  + +        WKK  +   P  ++ P EW    K S  K+C++R LRPD++  AI++FVEE++G KY+     D   SF +S   +P+ FILSPG DP+  + K     G  F    F ++SLGQGQ  +A + +    +EG WV+LQN HL   W+G LEK +E+ + E +  +FR+++++ PSS+      P  IL+N +K+TNEPP G+  N+ ++  +     +E      +   +K +LF LC+FHA+V ERRKFGP GWN  Y FN  DL ISV  L+ +++    V YD L+YL GE  YGG +TDDWDRR   T L++F   ++ E   Y     GF   P ++DY GY +YI        P ++G+H NA+I    Q ++ LF ++L  Q R +    G G S D+ V  V  + L +LP  F+   +M K   +       V +QE  R N L   I+ SL+ +   +KG + M++D+E +  ++   ++P  W K++YPS+  L  +  D L R++ L  W  D   PP  W++GF+  Q+FLT + Q+ AR+   P+D +    ++L  +  ++   P +GAYV GLF++GARWD +  +I ++  K L   +PVI++K  P+ K E  N   Y  P+YKT +R  T         +V    L T +    W + GVALL Q+
Sbjct: 1212 IAELQNPAIRPRHWQQLMTATGVRFSMDEDTTLTDLLNLNLHHFEDEVRAIVDRAVKEMGMEKVLTELDATWTAMEFGYESHPRTSVPLLKSDEDLVETLEDNQVQLQNLMSSKHVAFFLEEVSSWQKRLSVADSVISIWFEVQRTWSHLESIFIGSEDIRSQLPEDSKRFEGIDTDFKELAYDAHKTPNVVEATNKPGLYSRLEDIQGRLALCEKALAEYLDTKRLAFPRFYFISSADLLDILSNGTDPHQVQRHLSKLFDNTAKMKFETDADGKPSKTGIGMFSKEEEYVPFNEPCDCT---GQVEMWLNRVLDTMRATVRHEMTEAVVAYEDKPREQWLFDYPAQVALTCTQIWWTSDVGLAFSRLEEGYENAMKEYYKKQVSQLNTLITMLIGQLSPGDRQKVMTICTIDVHARDVVAKIIAQKVENSQAFVWLSQLRHRWDEREKHCFANICDAQFLYSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKSIQDAIRDKKKRFNFMGEEINLFPSVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFIEARLLARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPERPEDQVLMRALRDFNVPKIVTDDMPVFMGLIGDLFPALDVPRKRDLDFEKFVRESVLDLKLQAEDNFVLKVVQLEELLAVRHSVFVVGNAGTGKSQVLKSLNKTYQNM-------KRRPVWADLNPKAVTNDELFGIINPATREWKDGLFSNIMRELANVSHAGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLNPTMRLVFEISHLRTATPATVSRAGILYINQADLGWNPPVSSWID---KREIQSEKANLTILFDKYLPACLDTL-RSRFKKIIPIPEQSMVQMLCHLLECLLTPEHTPPDCHK-------ELYELYFVFAAIWAFGGA-----------LFQDQLVDYRVEFSKWWVTEFKTIK---------FPSQGTVFDYYIDPETK-----KFEPWSKMVP-RFEMDPEIPLQACLVHTTETIRVSYFMERLLERRRPIMLVGNAGTGKSV-LVGGKLGSLDPDKYTIKNVPFNYYTTSAMLQAVLEKPLEKKAGRNYGPPGSKRLIYFIDDMNMPEVDAYGTVQPHTLIRQHMDYNHWYDRSKLQLKEIHSVQYVSCMNPTSGSFT-INPRLQRHFSVFALSFPGVDALNTIYCSILGQHLSREGFSAVVQKSGPQLVQLALDFHQRVTATFLPTAIKFHYIFNLRDLSNIFQGMLFCKSECMKTPQDLVKVYLHESNRVYRDKMVEDKDFSTFDKLQSEMVGK-FYEDMEEAL------EEAKVMN------MYCHFALGIGEPR-YMPVQSWESLNKTLLEALDSYNEVN-AAMNLVLFGDAMSHICRINRILESPRGNALLVGVGGSGKQSLTRLAAFISSLEVFQITLKKGYGITDLKSDLGALCIKAGVKNIGTVFLMTDAQVADEKFLVLVNDLLASGEIPDLYPDDEVENIINSVRNEVRGQGLLDSRENC----WKFFIERVRRQLKVALCFSPVGSKLRVRSRKFPAVVNCTVIDWFHEWPQEALESVSLRFLQEVEHIEPEVKDSVSKFMAYVHVSVNKTSKDYLANERRYNYTTPKSFLEQIKLYRNLLALKRKDLTMKMERLENGLQKLNSTSAQVDDLKAKLAAQEVDLKQKNEDADRLIQVVGVETEKVSREKAVADEEEEKVASIAVVVTRKQKDCEEDLAKAEPALIAAQEALNTLNKNNLTELKSFGSPVAAVTNVTAAVMVLMA--------PGGRVPK-DRSWKAAKVMMAKVDAFLDSLMNFNKENIHENCLKAI-QPYLQDPEFKPELVAAKSNAAAGLCSWVINIVKFYEVYCEVEPKRQALNKANAELASAQEKLSVIKAKINHLNENLAKLTAKFEKATADKLKCQQEAETTARTISLANRLVGGLASENVRWAEAVNNFKQQERTLCGDVLLITAFVSYLGYFTKRYRHELMDNTWKPYLSQ-LKVPIPVTPGLDPLSMLMDDADVAAWQNEGLPADRMSTENATILTSCERWPLMVDPQLQGIKWIKN-KYGDNLQVIRIGQRGYLDSIERALSAGEVVLIENLEEAVDPVLGPLLGQETIKKGRY--IKIGDKECEYNPRFRLILHTKLANPHYQPELQAQCTLMNFTVTRDGLEDQLLAAVVSMERPDLEELKSNLTKQQNGFKITLKTLEDNLLSRLSSASGNFLGDTELVENLEITKRTAAEIEEKVKEAKVTEAKINEAREHYRPAAARASLLYFIMNDLNKIHPMYQFSLKAFSVVFQKAVLKAAPDEALKQRVLNLIDSITSSVFQYTTRGLFECDKLTYTAQLAFQILLMNKEINPSELDFLLRYPVQPGVTSPVD----FLSHHSWGGIKALCSMDEFRNLDRDIESSAKRWKKFVECECPEKEKFPQEWKN--KTSLQKLCMMRALRPDRMNYAIRDFVEEKLGSKYVMGRSVDFAVSFEESGAATPMFFILSPGVDPLKDVEKHGRTMGYTFDNQNFHNVSLGQGQEVVAEQALDLAAREGHWVILQNIHLVAKWLGTLEKKLEQ-HGEGSSQNFRVFISAEPSSSPEGHIIPQGILENSIKITNEPPLGMHANLHKALDNFNQDTLEMCARENE---FKSILFSLCYFHAVVAERRKFGPQGWNRSYPFNTGDLTISVNVLYNYLEANSKVPYDDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFIKPEMMEGELYL--APGFPL-PGNMDYNGYHQYIDDALPAESPYLYGLHPNAEIGFLTQTSEKLFRTVLEMQPRDAGSGEGSGTSRDEKVKAVLEETLEKLPEEFNMVELMGKVEER--SPYVVVALQECERMNILTQEIKRSLKELNLGLKGELTMTNDMENLQNAIYLDQVPDSWTKRAYPSMCGLALWFTDLLNRIRELESWSSDFNLPPAVWLAGFFNPQSFLTAIMQSTARRNEWPLDKMSLQCDVLKKNREDFSSPPREGAYVHGLFMEGARWDTQAGVIVDARLKELTPAIPVIFIKAVPVDKQETRN--VYQCPVYKTRQRGPT---------YVWTFNLKTKENPSKWTLAGVALLLQI 4325          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Cavefish
Match: dnah5 (dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:ZDB-GENE-110411-177])

HSP 1 Score: 1751.87 bits (4536), Expect = 0.000e+0
Identity = 1118/3343 (33.44%), Postives = 1767/3343 (52.86%), Query Frame = 3
Query: 2244 FNKEEEAFGWDVTTYPVRQEVQ---NVLRPYLKLYETAVEFNGKYKD--WMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNE-EGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFIL--SSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVL-TVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSE-NEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEG-------PEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVEN--NMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMF-EGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWS----ELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDL-KDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQ-NFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFK------HLDFDEDG-KVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQ-MSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLE--DVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTM--IIVEQQSTEASKQE-KIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKK--IEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLD--NPHENPSAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFES--LSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYD---SVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQAR-GSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYE-QSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYAR-KYTIPIDLLHFDYEIL----DDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQL 12107
            F   EE FG  VT +P   E++    +L+    LY   +E    Y D  W +  +E++  + +D       R L +  K+++     KK                PL++ +    +  RHW++I+++ G+T   E +   L  +++  L  +  + E I  +A KE ++E+ ++++  EW    F    ++  G  +L   S  +I   ++D ++   ++  + +  PF+A+I+ W   L    DI++ W+ VQ  W+YLE +F   DI  Q+P+E ++F+++DK+W +IM +      V+ + +  E M   L    + LE   K L  YLEKKRL FPRFFF+S+  LLEIL +  D   +Q HL   F+ I S+VF       H K+   N ++  K V         + K++      ++A V                          G+L I M  WT   ++A+           +   ++L++ N+ ID    +    L    RT  + LI + VH +D+  +L    + + +DF WL Q R+Y++E+   M+  + +   KY  E+LG T RLVITPLTDRCY TL  AL + +GGAP GPAGTGKTETTKD+ + + K  VVFNCSD +D+  LG+ +KGLA  G+W CFDEFNRIDL VLSV AQQI  +      ++ T  F +G  ++++P   +F+TMNPGYAGR ELP+NLK  FR+VAMMVPD  +I  + L SCGF++   LA K    Y+LC EQLS Q HYD+G+R + SVL   G  K   P + E  +++R + D+NL K ++ D PLF  +  DLFPG+      Y  L   I +   +  L +   +  KI Q++E   VRHG M +G    GK++    L  A+ D C Q   E        +NPKAIT  Q++G+ D  +++W+DG+ +  +R    +   +  W++ DGPVDAIWIEN+N+VLDDN+ L L +G+ I ++P+  ++FEP +++ ASPATVSR GMV+M  + L W PI   WL       +++ + +++  F       I  +            +  V+   +N++   I   +   ++S+         +E ++ FA  WSIGA   ++ RK  +   R            I L L   +PP  QD         T++DY    +      G+W HW+    E +  KD      +++ I+VP  D V+  +L+  +    K  L +G  GT K+  II   L++ N + +    +NFS+ T+    Q  + S +D+R    +GPP GKK+ +F+DD+NMP+   +G Q   E++RQ ++   +++L K      ++D+QF+ AM  PGGGRN I  R  R  +        + ++  IF  I   H  +Q  F  D +  +++L+  T  +++     +LPTPA  HY+FNLRD SR+ QG+L    + I  P  +  LW HE  RV  DR  + +D  WF + +  +  + L E++  + K       +DF +D  + T ++  +    DF   K     Y  +     LR  +  +L  YN+ +    M+LV F  A+ H+ +ISRI++ PR +ALLVGVGGSG+QSLTRLA+ +A Y +FQ+ +++SY +    EDLK + R + +      F+ +DN+IK ESFLE +NN+L++GEV NL+  DE  E+   +  + ++    R        L+ +F+ RVR  LH+VL  SP           FP+L++ CT+DWF  WP+DAL AV+  FL   D++    +K   +     F          Y     R  +VTP SYL  I  +K +  +K  E    K     GL+KL+ A+  ++ + KEL   + +L  A+++ D  +  + V+  + E  K E + VK +     D   A +AI  E    L  A P LE A  AL+T+ P+DI  VRT+  PP  +  +M+ V +L      R+N      +K  I   W  S +L+    FL  L+ F KD I   +++++   Y    D+  E          GLC W  A+  +  + + V P K  L    N    A + L K +A L   Q +L V+  E E     K  L    + C  K+  A  LI GL GEK RW + + +   +   L GD+LL++  ++Y G F   FR      W  ++  + IP     +L   L D   +  WN+ GLP D+ SI+NGII++ + R+PL+IDPQ Q   WI+N E KN LQ+  L    F   LE+ +  G P+L+E++GEELDP L+ +L K   K G +  +K+GD  ++    FR Y+TTKL NP Y PE S + ++++F +T  GL+DQLLG V+  E+ ELE+++  L++    NK+K+KELED +L  L++++G++++DES I VL+++K  S E+ +K     ETE KI+ AR  Y P+A   +IL+F I +++ ++ MYQ SL  F+ LF+LS+  S KS    +R+ N+  + TY ++    R L+E+ K LF+ +L   I    + IK +E+  L+ GG  LD       PS W+P  +W  L  L  L  F  I  +    +  W+  +D   P  + +P+ + + L D F ++ ++R   PD+ ++  + ++ + +G++Y E    DL  ++ +S+  +P++ +LS G+DP   ++     Q     K E+  +S+GQGQ   A K++Q+ +  G W LLQNCHL   ++  L  TV E   ++ H  FRLW+T+     FP+ +LQ  +K TNEPP+GL+  + R+Y      + E    S ++  W+ +L+ + F H+ VQERRK+GP+GW+I YEFN+ D   +VQ +   +D  D    V +  ++Y+ GE  YGGRVTDD+D+R L+    K +  +   + +++F     Y+ P     + Y++YI+ LP    P VFG+H NADIT  ++  + + D+IL  Q +  SSGGG++ +  V  ++ D+L +LPP++    VM++  T    + MN  L QE+ R   +L+ +RS+L +++ AI G +VMS +L + +  M  ++IP  W K S+ S   LG +  + L R +    W   G P  FW++GF+  Q FLT ++Q   R      +D +    E+     DD    + P++G YV GL+L+GA WDR+   + +S PKVL + MPV+ +   + + + +   Y  P+YK   R           N + A+ L T +  E+WI+RGVALLC +
Sbjct:  985 FTGGEELFGLPVTQHPQLLEIRKQLTLLQKLYGLYNNVIETVNGYYDVLWADVHIERINNELLD--FQTRCRKLPRALKEWQAFLDLKKTIDDFSEC-------CPLLELMANRAMMTRHWKRITEVTGHTFEVETDTFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLKQVIAEWDNKTFTFAQFKTRGELLLRGDSTSEIISNMEDSLMVLGSLMSNRYNTPFKAQIQKWVQNLSNTTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQSCVGDETMGQLLPHLLDQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVVF-------HDKTRRVNHVLISKQVKHHCILFKVMFKFVF-----LLAQV--------------------------GLLGIQMI-WTKDSEEALTNARFDRKIMTKTKQSFLELLNTLID----MTTKDLGTMERTKYETLITIHVHQKDIFDDLCHLNIRSPSDFEWLKQCRFYFIEDLDRMMINITDVGFKYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIDLSVLSVAAQQIAVVLTGKKERKKTFTFTDGDIVEMNPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLASCGFIDNVELARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRSNPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPGIQLDKAGYPELEAAIDKQVTEAGLINHPPWRLKIIQLFETQRVRHGMMALGPSGAGKSTCIHTLMKAMTD-CGQPHREMR------MNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLNWSPILEGWLMKRSAQESEVLRHLFSSSFPTLYQFSIQSLDFKMDM-----LEAFVIMQCINMLQGLIQPKDQGGELSREH-------MERLYVFALMWSIGALLEQDDRKKMEHWLRH--------HDSIHLDL-PYIPPDSQD---------TMFDYHVTND------GQWVHWNLRVEEYIYPKDIT---PEYSSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTV-IIKGYLSKSNPESHTAKSLNFSSATTPLMFQRSVESYVDKRMGTTYGPPAGKKMSIFIDDINMPVINEWGDQVTNEIVRQLMEQKGFFNLEKPGEFTNIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGTGHYCSQRGFEEDVRKVVSRLVPLTRRLWQMTKVKMLPTPANFHYIFNLRDLSRIWQGMLNVNADVIHTPKVLLCLWKHECKRVIADRFTSPEDVAWFDSMLANLVEEELGEEYRDVVKPEVDAYFVDFLQDAPEATGEEPEN---ADFDMPKV----YEPIASFPSLRDRLNMFLGLYNESIRGAGMDLVFFTDAMIHLVKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYGIFQITLTRSYNTANLMEDLKNLYRTAGQQGKGISFIITDNEIKDESFLEYMNNVLSSGEVSNLFARDEMDEILSDLIPVMKREFPRRPPTNE--NLHEYFMSRVRQNLHVVLCFSP-----------FPALISGCTMDWFSRWPKDALVAVSEHFLSSYDIDCTPQVKGEVVQCMGSFQDGVAEKCVDYFQRYRRSTHVTPMSYLSFIQGYKAIYKEKHLE--SVKFAMNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAHAAEKVKIEVQKVKDKAQAIVDSISADKAIAKE---KLEAAKPALEEAEAALQTIKPSDIATVRTLARPPHLIMRIMDCVLLLF---QRRLNAVKIDAEKNCITPSWQESLKLMTAGNFLGSLQQFPKDTINEEVVELL-TPYFDMPDYNIETAKRVCGNVAGLCSWTKAMATFFSINREVLPLKANLVVQENRLAIAHADLQKAQAELDAKQAELDVVQAEYEKAVTEKQMLLEDAERCRHKMQTASSLISGLAGEKARWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNLLLSDWQKEMRARCIPFGINLNLTEMLIDAPTVSEWNLQGLPNDDLSIQNGIIVTKAARFPLLIDPQTQGKIWIRNKEAKNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTYKVKVGDKEVDVMKGFRLYVTTKLPNPAYTPEISARTSIIDFTVTMRGLEDQLLGRVILTEKQELEKDRMDLVEDVMANKRKMKELEDSLLYRLTSTKGSLVDDESLIVVLSNTKRTSEEVTQKLQIAAETEVKINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSSKSPITSKRIGNIIEHMTYEVHNYAARGLYEEHKFLFTLLLTLKIDMQSNRIKHEEFLTLIKGGASLDLKACPPKPSKWIPDMTWLNLVELSKLWQFSDILDQIGRHEKQWRSWFDKEAPEEEVIPNAYDQSL-DCFKRLLLIRSWCPDRTIAQARKYIVDSMGERYAEGVILDLERTWEESDPRTPIICLLSMGSDPTDIIIALGKRQ-----KVETAYVSMGQGQEVHARKLLQQFMANGGWALLQNCHLGLDFLDELMDTVTE--TDSIHESFRLWITTETHRNFPITLLQMSIKFTNEPPQGLKAGLKRTYQG---INQELLDVS-NMVQWRPMLYSVAFLHSTVQERRKYGPLGWSIPYEFNQADFNATVQFVQNHLDDMDMKRGVSWTTVRYMIGEIQYGGRVTDDYDKR-LLNTFAKVWFSETMFNHEFQFYKD--YHIPRCTSVDQYLQYIQGLPAYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSSGGGETREAAVGRLADDMLEKLPPDYSPFEVMKRLETMGRLEPMNIFLRQEIDRMQRVLALVRSTLTDLKLAIDGTIVMSENLRDALDCMYDARIPARWKKASWAS-STLGFWFTELLERNQQFQAWIFEGRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDRMVLCNEVTRWMKDD--ITQPPQEGVYVYGLYLEGAGWDRRNCRLVDSKPKVLFEMMPVVRMYA-ENNGVKDSRLYSCPIYKKPART--------DQNIIAAVDLRTSQRPEYWILRGVALLCDV 4172          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001140.1 (pep scaffold:Pmarinus_7.0:GL478666:370:47701:-1 gene:ENSPMAG00000001005.1 transcript:ENSPMAT00000001140.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 3583.11 bits (9290), Expect = 0.000e+0
Identity = 1783/2847 (62.63%), Postives = 2209/2847 (77.59%), Query Frame = 3
Query:  294 REKFRKALVDMILQGEDRPIKESIETVRLPPLTQEKTPVGMS--ATEKDILRYYYYIHNGIDTEHVAKMEXXXXXXXXXXXXXXXXAE--HPXXXXXXXXXXXXXXXXSVKKAIVDFVLKEPREKETDDTP-IPEHRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQ-NFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFR 8816
            RE+FR  LV  IL  +D           LP    + TP   S  + E+D +RY+YYI +GI TE+VA ME++W+ ++  L+   L++   H   +  L  E+++DYL+SVKKAIVDFVL++P+ K+      +P HR+EL+V+PKPW   F    +  Q+ L+  NP M  VL+LW  ++ +LRLV+VEE RG   A+EL  FQ   MRH++ AKE L+ KWL+++Q IYYQ NKKKLVP + +   L  +FNCA+ LMTS LQ L L+S+ DYT+L+ +                               +HPGFVLRLIL    IKFEP  +DF+ +LLNV+D MMK +++V R+E++LYSDW  DK   +L P++L E++E+ +S VR  +I +S+ P EH++ ++ +  L+  + +++++  LSE    H+F E  + +  Y +L   I Y S+  +RLGMFEL CDEL+ AL+KRA+N+  +LL R+ + H++  + L +E+E I  KAL  P NT+ +MEL +++   E   M +L+ KL+++ + L+FL+D+A+ + S+M  N + F    RM  IF E+++ + +K E++Q +LKF+R RF E+L++Y KQ EEF  LGD+ ++NKYLKK+QVL TKLEAA   IE FN EEEAF W  + YP ++++Q+VL PYL+LYE AVEF  K+K WMEG +  V PD V+ DVGNY+R L+KLE+  +  P    I  ++K+ VE F+ H+P+ Q L  PGLR RHW  +S++VG+ L  +E +CL K ++MNLE F+ KF  IS+ A KE++LEKA+EKM  EW  M+F +I YR++GT ILS+VDDIQ++LDDHIVKTQTMRGSPFIKPFE+++K+WE KL+L+Q+ILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGR+FT+VDKTW++++KQ + D  VL V+ I+KML++L+KS ELLE ILKGLN YLEKKRL+FPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGI+ + FTE LDITHMKSSE E+V L + ISTSKARGQVEKWLLELEA MI SV   I E +  Y +TPR EWV+ W GQ VL +S  +WT  V +AI+ G + L+ YL   N QIDE+V LVRGQLS+Q+R TL AL+VLDVHARDVLV L++  +A+++DF WL QLRYYW + ++ T+MIN+ L YGYEYLGNT RLVITPLTDRCYRTLFGAL+LHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGL SCGAW+CFDEFNRIDLEVLSVVAQQILTIQR I    DTLMFEGTELKL+PTCAVFITMNPGYAGRSELPDNLKALFR+VAMMVPDYA+IAEI LYS GFV+ARPL+VKIVATYRLCSEQLSSQ HYDYGMRAVKSVLTAAGNLKLKYP E+EDILMLRSI+DVNLPKFL HDLPLF GI SDLFPGV  P PDY +L + IKENC KMNL+ + FF EKI QIYEMMIVRHGFMIVGEPFGGKT AY+VLAAALGDICE+ LM ENKVQ T+LNPKAITMGQLYGQFD +SHEWSDGVLAVSYRAFATST+PDRKWL+FDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQL+ +TNLIFEPMDLEVASPATVSRCGM+YMEP  LGWRP+  SWL   PP ++  HK +   +FER +   +  + +   KELSPTSD N+V SL+NL+DCQ+D F+DE KI  MD RD+  W+EG+F F+  WS+GA+ +  G+  FD+L RELM+G +  +T  +  L E V PP + +   +P  G++Y+YRFI E    G G+WE W+E +     I +D  FN+IIVPT DT+++T LM +L+TH KP LFVGPTGTGKS YI +FLL  ++K+ YKP  INFSAQT+A QTQNIIM KLDRRRKGV+GP  GK++++FVDD+NMP RE YGAQPP+ELLRQWLDH NWYDLKD + IKL ++Q +GAMGPPGGGRN +T RFLRH NT+TINEF D++M TIFS I+ WH   +  F  DF     QL+Q+T++VYK+A  NLLPTP KSHYLFNLRDFSRVIQGV LSLP T    A ++RLW HE+ RV+YDRLV D DR W   +IR+  + ++ EDF  LF+H D + DG+V +DD+RSL++CDFSD+K   K Y+EV+D+E LR  VEG+L+E+N +SKKPMNLVLFRFAIEHV RISRILKQPRSHALLVGVGGSGRQSLTRLAA MAD +LFQVEISK Y + EWREDLKRILR+ST+ + + VFLF+D QIKQESFLEDINNLLN+GE+PNL+  DEKQE+CEKMRQIDRQRDK +QTDGSP+AL N FV R RDQLH+VLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQ+WP DAL AVATR+LEDVE+ +     CID+CK+FHTST  LS+K+  E  RYNYVTPTSYLELISTFK+LL+KKR EV + KRRYEVGLEKL+SA S ++ MQ EL   QP+L+EA  +V  TM ++E++S E S+ E++VK +EA+AN+QA AA+ IK+ECD DLAEA+PIL SAL AL+TLT  DIT+V+TM SPP GV+LVMEA+ +LKG+KPDRV DPSGSG+ +ED WGP+KRLLG+MKFL+ L  FDKDNIP+ IMK IR KY+TN +F P++I  ASTA EGLCKWV A+E YDKVAKVVAPKK+ L +A  E   AM SL +K+ AL+EVQDKL  L + LE+NK++K DLEN+VD+C+KKL RAEQLIGGLGGE+ RW++AA  LG+R+ +LTGD L+SSG+VAYLGAF SSFR
Sbjct:    1 RERFRTTLVK-ILTNQDNV---------LPGQLGQDTPPSPSPHSAERDAMRYHYYIQHGIHTENVASMEEEWLQHVLALVPQTLRSHPSHLATIHGLSQEMRDDYLVSVKKAIVDFVLQDPKNKDLKKREDLPPHREELAVLPKPWRERFFATRRRLQEELHSINPAMLAVLQLWHNTYCDLRLVNVEEIRGGTAALELSSFQKVVMRHVDLAKETLLSKWLSEIQTIYYQSNKKKLVPKLTNVTRLASYFNCAAALMTSLLQKLALNSIYDYTDLICSTQ-------------------------TGTVKHPGFVLRLILSKDTIKFEPDFKDFQVVLLNVFDVMMKTLATVPRVETKLYSDWPMDKAHTHLQPVVLREVLEELQSHVRAEIIQQSLLPREHLRHYEPFEGLVGGQAERDVERFLSE---EHTFSEHEQLVSHYRELSHSILYSSQLVVRLGMFELHCDELVAALAKRAENLGSRLLGRMSQEHQKFIQRLCEEFESIAEKALSTPINTKALMELKEYIQKVEVQEMSQLQVKLNEAKDHLLFLLDHASLSPSEMRHNNTAFQWCGRMPGIFTEHRRILTEKTEQYQESLKFRRRRFEEDLEAYAKQAEEFSTLGDLADVNKYLKKAQVLHTKLEAATEMIESFNAEEEAFAWPTSQYPQKKKIQDVLMPYLRLYEMAVEFTSKHKAWMEGPLADVNPDVVEQDVGNYWRGLYKLERSLQASPQALLIQQQLKSNVEAFRTHLPMAQVLCNPGLRGRHWDALSEVVGFPLLTQEQVCLEKFLEMNLESFLSKFNDISDTASKEYSLEKALEKMVREWDEMQFTLIVYRDSGTSILSAVDDIQMLLDDHIVKTQTMRGSPFIKPFESDMKEWERKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRRFTTVDKTWRDLIKQTLTDTHVLAVVSIDKMLERLQKSTELLELILKGLNDYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGISRVEFTEALDITHMKSSEGEVVQLIETISTSKARGQVEKWLLELEAVMIRSVHNVIGEAMEAYPSTPRAEWVRAWPGQTVLCVSQAFWTSEVHEAIRGGQQVLERYLAQCNGQIDEVVGLVRGQLSQQSRVTLGALVVLDVHARDVLVALLKGGIAHDSDFQWLSQLRYYWEDGHLQTRMINAGLPYGYEYLGNTPRLVITPLTDRCYRTLFGALNLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINTGSDTLMFEGTELKLNPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIMLYSFGFVSARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPSENEDILMLRSIVDVNLPKFLAHDLPLFEGITSDLFPGVKLPKPDYVVLLEAIKENCEKMNLQMTDFFAEKILQIYEMMIVRHGFMIVGEPFGGKTCAYRVLAAALGDICEKALMAENKVQITVLNPKAITMGQLYGQFDAISHEWSDGVLAVSYRAFATSTSPDRKWLVFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQLASTTNLIFEPMDLEVASPATVSRCGMIYMEPHILGWRPLLTSWLNARPPPLSAPHKALICALFERLVPCCLQFV-RKSTKELSPTSDTNLVCSLMNLMDCQMDDFHDETKIKAMDDRDVSAWIEGIFLFSLVWSVGASCSTHGQVLFDQLLRELMSGPLSADTSKRFHLSENVEPPAEPFSVPFPAAGSVYEYRFIQE----GKGRWELWTEALSLAPPIPRDMNFNDIIVPTLDTIRFTALMEMLVTHQKPVLFVGPTGTGKSVYITNFLLKHLDKNTYKPLTINFSAQTTAAQTQNIIMGKLDRRRKGVYGPAQGKRMVLFVDDVNMPAREEYGAQPPVELLRQWLDHSNWYDLKDCSMIKLENVQILGAMGPPGGGRNAVTARFLRHFNTVTINEFDDKSMFTIFSRIMGWHFTARFAFPTDFSVLTEQLVQSTMEVYKAATQNLLPTPTKSHYLFNLRDFSRVIQGVCLSLPETCPVAASIQRLWVHEVLRVFYDRLVDDADRTWLVAFIRKTIHTYMKEDFTQLFQH-DSNGDGQVEDDDLRSLMFCDFSDSKDDAKRYVEVSDVERLRLVVEGHLEEFNNLSKKPMNLVLFRFAIEHVCRISRILKQPRSHALLVGVGGSGRQSLTRLAAHMADCELFQVEISKGYATNEWREDLKRILRRSTDGEQNGVFLFTDTQIKQESFLEDINNLLNSGEIPNLFAPDEKQEICEKMRQIDRQRDKDKQTDGSPLALLNMFVDRCRDQLHVVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQSWPGDALQAVATRYLEDVEVSEETLASCIDMCKLFHTSTIALSQKFQAEQQRYNYVTPTSYLELISTFKDLLEKKRLEVMRMKRRYEVGLEKLESATSQVAGMQAELAALQPQLLEAGIQVVNTMAVIERESEEVSRTERVVKADEAVANEQAMAAKVIKDECDADLAEALPILRSALAALDTLTQQDITVVKTMKSPPAGVKLVMEAISILKGVKPDRVPDPSGSGRMVEDLWGPAKRLLGDMKFLQSLHDFDKDNIPVAIMKTIRAKYITNLEFDPDKIRNASTAAEGLCKWVIAMESYDKVAKVVAPKKVKLNQAEAELAVAMGSLRRKQEALREVQDKLAGLQQTLEANKQKKADLENQVDMCTKKLDRAEQLIGGLGGERSRWMEAARLLGIRYNDLTGDTLVSSGIVAYLGAFISSFR 2803          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Sea Lamprey
Match: DNAH6 (dynein axonemal heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:2951])

HSP 1 Score: 2624.35 bits (6801), Expect = 0.000e+0
Identity = 1436/3405 (42.17%), Postives = 2080/3405 (61.09%), Query Frame = 3
Query: 2157 GDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEG-MCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRET-GTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVF-----------TETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWF-GQGVLAISMYYWTIYVQDAIKEGP----EALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYW-VE-NNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKM-NLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEEN----KVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDL-QFIGAM----GPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKH--LNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDF--SDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVEL-DQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLD--NPHENPSAWLPPKSWDELCRLDD-LSVFHGIRQRFIE--------------QKDSWKK-----IYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETT--HPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSS-GGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQ----SMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEIL----DDRNYDE------------------APEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD 12113
             D  ++ + LK+  +   + +    +   + K    F  +VT +    EV + L+    ++++  E+    K+W+E   E ++P+Q++++V  Y + + +LEK       P  +   +K KVE  +E +P++  L  P L+ RHW+ + +I+G  LR++E  + L+ LI++ +  +  + + +S  A  E +LE  ++K+++ W   EFVV+ +R++   FIL+  D+IQ++LDD I+   T+  S ++ P ++ + +W+ +L+L    L+EW+  Q  WLYLE IFS+PDI  Q+P E + F  VDK+WK+IM+++      L       +LD  K +N LLE I K L  YLE KR+ FPRF+FLSNDELLEIL++T++P  VQPHL+KCF+ IA L F           T T DI  M S E E V+L   +   KARG VE WL ++E  M  S+R      + +Y++ PR EWV      Q VL ++   W   +   ++ G     +++  + K N  +++ +  LVRG L K +R  + ALI +DVHARD++ +++QE+V   N+F W  QLRYYW +E +N + +M  S   YGYEYLG   RLVITPLTDRCY  L GAL L LGGAP GPAGTGKTETTKDLAKA+A QCVVFNCSDGLDY  +G+FF GLA  GAW CFDEFNRID+EVLSV+AQQ++TI+ A  A+    MFEG E+KL  TCA FITMNPGYAGR+ELPDNLKALFR +AMMVP+YALIAE+ LYS GF ++R LA K+   Y+LCSEQLS Q HYD+GMRAVKSVL  AG+LK + P   ED++++R++ D NLPKFL  D  LF+GI SDLFPGV  P  DY  L   I EN LK   L++    + K+ Q+YE M+VRHG M+VG   GGKT+ Y  L+ ALG + E G  + N    KV  T+LNPK+I+MG+LYG+ + ++ EW DG++A+S R      + D KW++ DGPVDA+WIEN+NTVLDDNK LCL + E I+L+P  ++IFE  DL+VASPATVSRCGMVY++   L W P   +W+  +     +   +    +FE +++ G+  + K   + + P  DI+ V +L  L+  +           +M+   + + +   F F Y W++G    E     FD   +                         +++    P  G ++ Y    + +     + + W  +V      +K+  F E++VPTTDT+++ YLM  LL      LF G TG GKS      L     +  Y P  INFSAQTS+ +TQ II SKL+++RK + G P  K++I+FVDDLNMP  + YG+QPPIELLRQ+ D   +YD +     ++ D  +  GAM     PPGGGRNP+TPRF+RH + + +    + ++  IF +IL   ++  +F    K     +++A +++Y    T LLPTPAKSHY+FNLRD S+ +QG+L     T+ +   + RL+ HE  RV++DRL+ ++D+++F   + E+++K   +  + +   KH                +++ DF     + +++ Y ++TD+E L+  ++ YLD+YN  S K M LV F+ AIEHV+RI+R+++Q R +ALLVGVGG+G+QSLTRLA  M  Y  FQ+E+S+ Y+   + EDL+++   +   D   VFLF+D QI  E FLEDINN+LN+GEVPNL+  DE ++V   +     +  +    +G+   +  FF+ RVR +LHIVL MSP+GDAFR R R FPS+VNCCTIDWF  WP +AL +V+  F   V+L    LK+   ++C   H S   L+E Y  EL R  Y TPTSYLELI+ + ++L +KR+++   + R + GL KL      +  +Q EL   +P L + S++V+  M  +      A +  ++V  +EA+A  +A+  +A+  +   DL EA+P L++A +AL++L  +DI+ VR   +PP+GVR VMEA+C++   KPD               W  +K+LLG+  FL+ L  +DK+NI   +++ ++  Y+ N DF PE++   S AC+ +C WV A++ Y +V K V PK+  L  A  E +  M+ LN K+  LK+V+D++  L ++ + +   K  L   + L   ++ RA +L   LG E+ RW ++     V   N+ G++ ++S  VAY GAFTS +R     +W+    E  IP +  FSLI  LGDP EIR WN  GLP D  S ENGI+++  RRWPLMIDPQ QAN+WI+N E KN L++IKLTD +F+R LEN I+ G PVLLE + E LDP LEP+LLKQTF  GG + I+LGDS ++Y  +FRFY+TTK+ NPHYLPE  +KVT++NF +T  GL+DQLL  VV  E+PELEE++N+LI +   +K +LK +ED IL +L TSEGNIL++E  IK L  SK  S  I  +    E TE+ I+ AR  Y P+A   ++++F IA L+ IDPMYQYSL +F  LFN++I+ SEK  +L +RL+ L      + Y N+ R LFE+ KL+FSF+LC  IL+    + + EW   L G  G+D   P +    WL   +W+  C L+D L  F G+++  +                 ++W+      ++ + E    ++   W ERL   F K+ +++    +K+V A+ +FV E +GK +IE PP DL   + D + ++PL+F+LS G+DPM A  +FA + G+   +  ++SLGQGQGPIA K+I+  +K G WV LQNCHLA SWM  +E+ ++ L+      HP++RL+L+S P+  FPV +LQN VK+TNEPPKGLR NI R++     +   FF  +     W+K++FG+CFFHAI+QER+KFGP+GWNI YEFN++D   ++  L++F  Q   + +DAL Y+TGE  YGGRVTD WD+R L TIL++F+  +  E P Y +  SG YYA  +   + + +YI+ LPLN +P +FGMH+NA++    QET  L  +IL  Q R S  G G S D+IV E++  +L +LP   D E  M    T+ E+    S+ TVL QE+ RFN LL  IRSSL  ++KAI G VVMS ++E++  S L S++P +W   +YPSLKPLG +V D   R  F+  W   GPP  FWISGF+F Q FLTG  QN+ARKY +PID L F Y+ L    D  +  E                  A +DG  V GLF+D +RWD +  ++ ++    +  P+PV+  +P +  + P+   Y +P+YKTS R GTLSTTGHSTNFV+ + +P+ +  ++WI +G ALLCQL+D
Sbjct:  792 SDKTKVREILKEQMIATDEFQQQALQYRAYQKN---FKVEVTNFDALNEVCDELKRKQMMWDSLDEWEVFTKEWLECQFETLDPEQLNSEVAKYAKIVNQLEKGLP----PNNVVPLLKKKVEFIREKLPVVAFLRNPSLKARHWEMLEEIIGAPLRDKETPLTLAGLIELEVFHYAEQIQDVSGQASGEASLESILKKVEDGWKTAEFVVLPHRDSKDVFILAGTDEIQILLDDSIINISTITSSRYVGPIKSRVDEWQRQLLLFNQTLEEWMTCQRNWLYLESIFSAPDIQRQLPAEAKMFMQVDKSWKDIMRKIYRLPNALRAATQPGLLDTFKNNNALLEQIQKCLEAYLESKRVVFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDAIARLEFALAPAEGEQERTFTNDILAMVSPEGEKVSLGKGL---KARGNVEDWLGKVEEAMFQSLRRLTKMAIGEYQSMPRTEWVVSGLPSQVVLTVAQLMWCRDLTQCLEGGDHDHLQSVANFEKENFERLNSLACLVRGNLPKIHRCIITALITVDVHARDIVTDMVQEKVETANNFEWQRQLRYYWDLELDNCVARMALSQYVYGYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKVPRFMFEGREIKLIQTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPNYALIAEVILYSEGFESSRVLARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPHLREDVVLIRALRDSNLPKFLADDAMLFSGILSDLFPGVEIPNHDYGSLQSSI-ENALKARKLQAVPSMVHKVIQLYETMLVRHGVMLVGPTGGGKTTVYTALSDALGSLHEAGESKHNPFYQKVHTTVLNPKSISMGELYGEVNNLTLEWRDGLMALSVRVAVADDSEDHKWIVCDGPVDALWIENLNTVLDDNKMLCLANSERIKLTPQIHMIFEVQDLKVASPATVSRCGMVYIDSEELKWMPYVQTWMNGIIDKFGEDTGQYIMALFENYVEDGLRFVNKKCTQAM-PQVDISKVTTLSCLL--ESLLLGKGGPDLKMEHSRLTSIVCQTFVFCYLWAVGGNLVENCWDQFDTFVKHQFE---------------------ENHDAKLPSSGDLWSYYMDYDSK-----RLDPWERIVPNF-RYNKEVPFFEMLVPTTDTMRFGYLMEKLLAVKHSVLFTGTTGVGKSVVARGLLDKIQEEAQYVPLYINFSAQTSSTRTQEIIESKLEKKRKNIIGAPGKKRVIIFVDDLNMPKLDRYGSQPPIELLRQYQDFGGFYDREKMFWKEIQDAREDRGAMQPFCAPPGGGRNPVTPRFIRHFSMLCLPSPSEHSLKQIFQAILTGFLV--DFPVAVKQVATNIVEAAVEMYGRMSTELLPTPAKSHYIFNLRDLSKCMQGILQCDSGTVRDQNQIFRLFCHECQRVFHDRLINNEDKDYFNTMLAEMASKQFGVQVEAEYFVKH---------------PILFGDFMKVGVQRADRVYEDLTDVEKLKGVLQDYLDDYNLSSAKEMKLVFFQDAIEHVTRITRMIRQERGNALLVGVGGTGKQSLTRLACHMCGYRCFQIELSRGYSYDTFHEDLRKLYTIAGVEDKDTVFLFTDTQIVIEEFLEDINNILNSGEVPNLFEKDELEKV---LAATRPKAKEAGIPEGNRDEVLQFFINRVRARLHIVLCMSPVGDAFRARCRMFPSIVNCCTIDWFVQWPREALLSVSKTFFTPVDLGSDELKENLSEMCVEIHMSVTELAEHYYAELRRRYYTTPTSYLELINLYLSMLGEKRSQLTNSRDRIKNGLTKLLETNELVDKLQLELSALEPVLKQKSEDVEALMEKLATDQENADQVRRVVMEDEAVAKVKAEETQAMAADAQRDLDEALPALQAANRALDSLDRSDISEVRVFTNPPEGVRTVMEAICIVLSKKPD---------------WASAKQLLGDSNFLKRLTDYDKENISEDVIQKLK-VYINNKDFVPEKVERVSKACKSMCMWVRAMDLYSRVLKDVGPKRQRLATAQAELDATMAMLNDKQRRLKQVEDQIGALQDQFDMSVAEKESLAKNMALTQARMSRAGKLTSALGDEQIRWQESVAQFQVEINNVIGNVFIASACVAYYGAFTSHYRQMLIDRWISRCQELGIPINANFSLIGILGDPFEIRQWNTDGLPRDTVSTENGILVTRGRRWPLMIDPQDQANRWIRNKEMKNGLKIIKLTDGNFLRTLENAIRLGMPVLLEELKETLDPALEPILLKQTFVSGGRLLIRLGDSDVDYDKNFRFYMTTKMANPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPELEEQRNELIVRINADKNQLKVIEDRILKLLFTSEGNILDNEELIKTLQESKVTSGAIKTRLKEAEATEEMINTAREKYRPVAARGSVMYFVIASLSEIDPMYQYSLKYFKQLFNMTIETSEKRSDLAERLELLLKQTLLATYTNISRGLFEQHKLIFSFMLCIEILRQHGHVSDAEWNLFLRGAAGMDKERPTKPEIGWLAESTWNLCCDLEDHLPCFKGLKREIVAIPILVTLGRLEIRLNPEAWEGCMKEPLHFTEEVSENEIQGHWNERL-SKFQKLVLVKSFMEEKVVFAMTDFVIENLGKAFIENPPVDLATLYQDMSASTPLVFVLSTGSDPMGAFQRFAREMGY-SERVHAISLGQGQGPIAEKLIEEAVKSGDWVFLQNCHLAASWMLAMEEIIKALSEPNAVIHPNYRLFLSSMPTRNFPVTVLQNSVKVTNEPPKGLRANIRRAFTEITPA---FFEKNVLGQNWRKIIFGICFFHAIIQERKKFGPLGWNIHYEFNDSDRECALLNLNLFC-QDGRIPWDALIYITGEITYGGRVTDSWDQRCLRTILKRFFSPKTLE-PGYLYSTSGIYYASEEKTLQDHKDYIENLPLNDDPEIFGMHENANLAFQRQETGTLVKTILEVQPRSSGQGAGTSNDEIVKELADSILAKLPEILDMEGAMESLFTRDEKGRINSLTTVLEQEVDRFNTLLQVIRSSLHTLKKAIAGFVVMSEEMEKIYNSFLNSQVPVLWSDNAYPSLKPLGGWVKDLALRTTFIDAWIKTGPPKSFWISGFFFPQGFLTGTLQNHARKYNLPIDELGFHYKTLPVYRDQTSVAEAMRTQQFGQELEADIQLPAVQDGVLVHGLFMDASRWDDEDMVMEDALAAQMNPPLPVLHFEPCQNYQ-PDPSLYHAPLYKTSARAGTLSTTGHSTNFVVTVFIPSKRDSDYWISKGAALLCQLND 4111          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003959.1 (pep scaffold:Pmarinus_7.0:GL495754:4357:49943:-1 gene:ENSPMAG00000003592.1 transcript:ENSPMAT00000003959.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1955.64 bits (5065), Expect = 0.000e+0
Identity = 1054/2221 (47.46%), Postives = 1430/2221 (64.39%), Query Frame = 3
Query:  606 SVKKAIVDFVLKEPREK--ETDDTPIPEHRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPE-IIEKHKSTVRNVLIDESVGPTEHIKEF-DKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENK------------PIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPE-ALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAI-TDIHKKMWADIFERFIDAGIACIXXX----XXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMD----QRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGK-VTEDDIRSLIYCDFSDAKSSNKE--YIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLK 7181
            S+ K++V  +L +P  K  E +D   P    E      PW  SF  A K  + +L++ +  +  +L++         L+D+  +R     +EL  F +     +E  +EKLM  W   V +++   +K     S       E F  C STL+++ L++L + ++  Y  L                            DLA+    P F ++L  +D  ++  PS ED    +L V  Q+ + + +V  + + L    + +  K+       PE ++ +  + + + +     GP EH++ + D+Y  L+N    + +   +SE  DR SF+E A  ++++  LV++++      +   M  L C EL + L  +A+     LLD+++  HR  N  + + +E + ++ L +P N+E+M+EL  +V +     + +L  K+ +   R+ FL+D    +  D+  N  V      +   FD N++ ME  + + ++ L  +RER + ELD   ++V+ F    +++ I +Y+   +++  +L+ A   I   NKEE  + W++T+YP    ++  L P+ KL+   + +    K WM+GS  ++  + +  ++  ++R ++K  K F+ +            P  K+  +      E  ++  P +Q      +RDRHW Q+S++V   +  + G  L K++  NL P++ KFE IS AA KE++LEKA+  M   W  + F  + YRETG  ILSSVD+IQ  LDD IVKTQTMRGS FIKPFE EIK WE +L+ +Q+ LDEWLKVQA WLYLEPIFSS DIM QMPEEGR F +VD+ W+E+MK    D +VL    +  +L+KL+  N LL+ I+KGLN YLEKKRL+FPRFFFLSNDE+LEILSETKDP RVQPHLKKCFEGIA L F   LDI  M SSE E V L + +STS+ARG VEKWLL++E  M+ SVR  I      Y  T RK+WV++W GQ V+ +S  +WT  V +AIK GP+  L  Y +    Q+ +IV LVRG LSKQ R TL AL+ +DVHARDV+ ++I + V+NE DF WL QLRYYW    +  +++N  +KY YEYLGN+ RLVITPLTDRCYRTL GA +L+LGGAPEGPAGTGKTETTKDLAKA+A QCVVFNCSDGLDY+A+ KFFKGLAS GAW+CFDEFNRI+LEVLSVVAQQIL IQRAI  +  T  FEGTEL L+P C V ITMNPGYAGRSELPDNLK LFR+VAMMVP+YALIAEISLYS GF+NA+PL+VKIV TYRLCSEQLSSQ HYDYGMRAVK+VL AAGNLKLK+P+E+EDIL+LRSI DVN PKFL+HD+PLFNGI SDLFPG+  P  DY +  +  +E C + N++    F++K+ Q YEMMIVRHGFM+VGEPF GKT   +VLA  L  + E+G   E +VQ   +NPKAITMGQL+GQFDPVSHEW+DG++A ++R FA+S TPDRKW++FDGP+D +WIE+MNTVLDD  +LCLMSGEIIQ+S   +LIFE MDL  ASPATVSRCGM+YMEP+ LGW+P+  SWL  LPP +  + ++ +  ++F   +   +  ++K       KEL  +      K+L+  +DC++     +     ++       +  W    F F+  WS+GA+ + +GR  FD   REL+ G   +           +PP +  ++     +G +YDY +    +  G G W HW+EL+K      K  K  +IIVPT DT +YTYLM+L + H +P LFVGPTGTGKS YI + L+N ++K+ Y P  +NFSAQTSANQTQNIIMSKLD+RRKGVFGPP+GK+ ++FVDD+NMP  E +GAQPPIELLRQ+ DH NWYDLKDT+ I+L DLQ + AMGPPGGGRN +T RFLRH N  TIN F DETM+ IFSS++ +++   +F P+F    NQ++ ATL+VYK AM NLLPTP KSHY FNLRDFSRVIQGVLL      +    M RL+ HE++RV++DRLV DQDR W +   R++   H  E FD +F+  D  E+G+ + ++D+R L++ D+ +    ++E  Y EV  ++     VE  L+EYNQ  K  MNLV+F + +EH+SRISR+LKQP  HALLVGVGGSGRQSLTRLA +M+   LFQ EISKSY  TEWRED+K
Sbjct:  150 SMHKSMVQNILVKPNVKGLENEDISPPPREPEGLDFSNPWRDSFEAARKDIKGNLHIMHSALRSILDMGHTVLSQTLLLDLSGYRAMG-PLELTAFSNNVTLQLEKGEEKLMHSWFPRVVSLFADKHKSTEADST------ESFHGCVSTLLSNQLRDLIVRTIEAYVRLF---------------------------DLADGRALPHFRVQLTFDDESMESYPSSEDLRGAVLAVAAQIGRSLQAVPMVHAWLAGSSSPETIKVQT-----PEDVLTRASAALLHAVQANMQGPQEHLQSYIDRYGWLVNGTAMERVHTFISE--DR-SFDECATLVEEFRALVRELQ-GLPSVLHFPMVRLVCSELKQGLMDKARGFINLLLDKLLNQHRAHNAMICQAFEVMRQRCLKVPENSEEMIELGSYVDNARSKGIADLNDKIQECYRRMSFLLDVHILSPEDIAFNSQVLCWPREIAPAFDRNEELMEVAQRKGESELLARRERLLLELDKLSRRVDGFAECSELDMIAQYVSDMRMIGKRLQDADDTITFINKEEVLYKWELTSYPEVDAIRTKLDPFQKLFTLILRWQRAEKKWMDGSFLELNGETMATELEEFFREMYKHLKFFQQRQKKAEQERQRDAPRKKRGDSAEAEMEEAQEQSDPSVQMC---SIRDRHWVQMSEVVENDITPDSGTTLRKVLKQNLIPYLDKFEQISAAASKEYSLEKALHTMVETWDTIAFTTLQYRETGVSILSSVDEIQSTLDDQIVKTQTMRGSAFIKPFETEIKVWEERLVRIQETLDEWLKVQAQWLYLEPIFSSQDIMQQMPEEGRLFQTVDRNWREVMKFCTRDPKVLVATSMTGLLEKLQNCNGLLDKIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIARLGFLPNLDIGAMFSSEGERVELVERVSTSEARGAVEKWLLQVEDVMLRSVRDVIVRARTAYANTQRKDWVREWPGQVVICVSQMFWTTEVHEAIKGGPQQGLREYSERLQDQLKDIVELVRGDLSKQTRVTLGALVTIDVHARDVVFDMIDKGVSNETDFQWLAQLRYYWESEQVRVRIVNCNVKYAYEYLGNSPRLVITPLTDRCYRTLVGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMSKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIQTKMVTFAFEGTELVLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLIAAGNLKLKFPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGITLPAADYTLFLEAARECCSRHNVQPVKVFLDKLIQTYEMMIVRHGFMLVGEPFAGKTKVLQVLADTLTLMSERGQGGEERVQLRTVNPKAITMGQLFGQFDPVSHEWTDGIVANTFREFASSDTPDRKWVVFDGPIDTLWIESMNTVLDDCLQLCLMSGEIIQMSQPMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWQPLVQSWLGTLPPTLQQEDNRDLLQELFTWLVAPSLRMVRKQCKDIHEKELRLSEAFT--KALIVSVDCRLSGLCLKGLWVSVEALLVLLMLKLW--ASFAFSLVWSVGASCDSDGRVKFDSFLRELLTGKSKD---------HPLPPTVGKWECPLEERGLVYDYMY----ELKGRGHWVHWNELIKNPHLGDKGTKVQDIIVPTIDTARYTYLMDLCIQHSRPLLFVGPTGTGKSVYIKNKLMNNLDKERYLPFFVNFSAQTSANQTQNIIMSKLDKRRKGVFGPPMGKRSVIFVDDMNMPALEKFGAQPPIELLRQFFDHGNWYDLKDTSKIRLEDLQLLAAMGPPGGGRNAVTARFLRHFNICTINSFSDETMVHIFSSVMAFYLRNNDFPPEFFSVGNQIVSATLEVYKKAMQNLLPTPTKSHYTFNLRDFSRVIQGVLLLRREAADGRRSMLRLFVHEVYRVFHDRLVDDQDRRWLYGLSRDLLRDHFKESFDAVFE--DLKEEGRPLCQEDMRKLMFGDYMNPDLMDEERLYAEVPSVQQFSSVVEQCLEEYNQTHKNRMNLVIFGYVLEHLSRISRVLKQPGGHALLVGVGGSGRQSLTRLATAMSGMALFQPEISKSYGHTEWREDVK 2305          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003955.1 (pep scaffold:Pmarinus_7.0:GL495754:4342:49943:-1 gene:ENSPMAG00000003592.1 transcript:ENSPMAT00000003955.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1951.02 bits (5053), Expect = 0.000e+0
Identity = 1051/2213 (47.49%), Postives = 1427/2213 (64.48%), Query Frame = 3
Query:  606 SVKKAIVDFVLKEPREK--ETDDTPIPEHRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPE-IIEKHKSTVRNVLIDESVGPTEHIKEF-DKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENK------------PIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPE-ALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAI-TDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGK-VTEDDIRSLIYCDFSDAKSSNKE--YIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLK 7181
            S+ K++V  +L +P  K  E +D   P    E      PW  SF  A K  + +L++ +  +  +L++         L+D+  +R     +EL  F +     +E  +EKLM  W   V +++   +K     S       E F  C STL+++ L++L + ++  Y  L                            DLA+    P F ++L  +D  ++  PS ED    +L V  Q+ + + +V  + + L    + +  K+       PE ++ +  + + + +     GP EH++ + D+Y  L+N    + +   +SE  DR SF+E A  ++++  LV++++      +   M  L C EL + L  +A+     LLD+++  HR  N  + + +E + ++ L +P N+E+M+EL  +V +     + +L  K+ +   R+ FL+D    +  D+  N  V      +   FD N++ ME  + + ++ L  +RER + ELD   ++V+ F    +++ I +Y+   +++  +L+ A   I   NKEE  + W++T+YP    ++  L P+ KL+   + +    K WM+GS  ++  + +  ++  ++R ++K  K F+ +            P  K+  +      E  ++  P +Q       RDRHW Q+S++V   +  + G  L K++  NL P++ KFE IS AA KE++LEKA+  M   W  + F  + YRETG  ILSSVD+IQ  LDD IVKTQTMRGS FIKPFE EIK WE +L+ +Q+ LDEWLKVQA WLYLEPIFSS DIM QMPEEGR F +VD+ W+E+MK    D +VL    +  +L+KL+  N LL+ I+KGLN YLEKKRL+FPRFFFLSNDE+LEILSETKDP RVQPHLKKCFEGIA L F   LDI  M SSE E V L + +STS+ARG VEKWLL++E  M+ SVR  I      Y  T RK+WV++W GQ V+ +S  +WT  V +AIK GP+  L  Y +    Q+ +IV LVRG LSKQ R TL AL+ +DVHARDV+ ++I + V+NE DF WL QLRYYW    +  +++N  +KY YEYLGN+ RLVITPLTDRCYRTL GA +L+LGGAPEGPAGTGKTETTKDLAKA+A QCVVFNCSDGLDY+A+ KFFKGLAS GAW+CFDEFNRI+LEVLSVVAQQIL IQRAI  +  T  FEGTEL L+P C V ITMNPGYAGRSELPDNLK LFR+VAMMVP+YALIAEISLYS GF+NA+PL+VKIV TYRLCSEQLSSQ HYDYGMRAVK+VL AAGNLKLK+P+E+EDIL+LRSI DVN PKFL+HD+PLFNGI SDLFPG+  P  DY +  +  +E C + N++    F++K+ Q YEMMIVRHGFM+VGEPF GKT   +VLA  L  + E+G   E +VQ   +NPKAITMGQL+GQFDPVSHEW+DG++A ++R FA+S TPDRKW++FDGP+D +WIE+MNTVLDD  +LCLMSGEIIQ+S   +LIFE MDL  ASPATVSRCGM+YMEP+ LGW+P+  SWL  LPP +  + ++ +  ++F   +   +  ++K     L     +N  ++ L   D   + +++  +       + +  L+  F F+  WS+GA+ + +GR  FD   REL+ G   +           +PP +  ++     +G +YDY +    +  G G W HW+EL+K      K  K  +IIVPT DT +YTYLM+L + H +P LFVGPTGTGKS YI + L+N ++K+ Y P  +NFSAQTSANQTQNIIMSKLD+RRKGVFGPP+GK+ ++FVDD+NMP  E +GAQPPIELLRQ+ DH NWYDLKDT+ I+L DLQ + AMGPPGGGRN +T RFLRH N  TIN F DETM+ IFSS++ +++   +F P+F    NQ++ ATL+VYK AM NLLPTP KSHY FNLRDFSRVIQGVLL      +    M RL+ HE++RV++DRLV DQDR W +   R++   H  E FD +F+  D  E+G+ + ++D+R L++ D+ +    ++E  Y EV  ++     VE  L+EYNQ  K  MNLV+F + +EH+SRISR+LKQP  HALLVGVGGSGRQSLTRLA +M+   LFQ EISKSY  TEWRED+K
Sbjct:  152 SMHKSMVQNILVKPNVKGLENEDISPPPREPEGLDFSNPWRDSFEAARKDIKGNLHIMHSALRSILDMGHTVLSQTLLLDLSGYRAMG-PLELTAFSNNVTLQLEKGEEKLMHSWFPRVVSLFADKHKSTEADST------ESFHGCVSTLLSNQLRDLIVRTIEAYVRLF---------------------------DLADGRALPHFRVQLTFDDESMESYPSSEDLRGAVLAVAAQIGRSLQAVPMVHAWLAGSSSPETIKVQT-----PEDVLTRASAALLHAVQANMQGPQEHLQSYIDRYGWLVNGTAMERVHTFISE--DR-SFDECATLVEEFRALVRELQ-GLPSVLHFPMVRLVCSELKQGLMDKARGFINLLLDKLLNQHRAHNAMICQAFEVMRQRCLKVPENSEEMIELGSYVDNARSKGIADLNDKIQECYRRMSFLLDVHILSPEDIAFNSQVLCWPREIAPAFDRNEELMEVAQRKGESELLARRERLLLELDKLSRRVDGFAECSELDMIAQYVSDMRMIGKRLQDADDTITFINKEEVLYKWELTSYPEVDAIRTKLDPFQKLFTLILRWQRAEKKWMDGSFLELNGETMATELEEFFREMYKHLKFFQQRQKKAEQERQRDAPRKKRGDSAEAEMEEAQEQSDPSVQMC-----RDRHWVQMSEVVENDITPDSGTTLRKVLKQNLIPYLDKFEQISAAASKEYSLEKALHTMVETWDTIAFTTLQYRETGVSILSSVDEIQSTLDDQIVKTQTMRGSAFIKPFETEIKVWEERLVRIQETLDEWLKVQAQWLYLEPIFSSQDIMQQMPEEGRLFQTVDRNWREVMKFCTRDPKVLVATSMTGLLEKLQNCNGLLDKIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIARLGFLPNLDIGAMFSSEGERVELVERVSTSEARGAVEKWLLQVEDVMLRSVRDVIVRARTAYANTQRKDWVREWPGQVVICVSQMFWTTEVHEAIKGGPQQGLREYSERLQDQLKDIVELVRGDLSKQTRVTLGALVTIDVHARDVVFDMIDKGVSNETDFQWLAQLRYYWESEQVRVRIVNCNVKYAYEYLGNSPRLVITPLTDRCYRTLVGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMSKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIQTKMVTFAFEGTELVLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLIAAGNLKLKFPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGITLPAADYTLFLEAARECCSRHNVQPVKVFLDKLIQTYEMMIVRHGFMLVGEPFAGKTKVLQVLADTLTLMSERGQGGEERVQLRTVNPKAITMGQLFGQFDPVSHEWTDGIVANTFREFASSDTPDRKWVVFDGPIDTLWIESMNTVLDDCLQLCLMSGEIIQMSQPMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWQPLVQSWLGTLPPTLQQEDNRDLLQELFTWLVAPSLRMVRKQCKM-LMLKLWLN-TRTQLCPSDITKERYSNAPESCIFMHANSIYSLQASFAFSLVWSVGASCDSDGRVKFDSFLRELLTGKSKD---------HPLPPTVGKWECPLEERGLVYDYMY----ELKGRGHWVHWNELIKNPHLGDKGTKVQDIIVPTIDTARYTYLMDLCIQHSRPLLFVGPTGTGKSVYIKNKLMNNLDKERYLPFFVNFSAQTSANQTQNIIMSKLDKRRKGVFGPPMGKRSVIFVDDMNMPALEKFGAQPPIELLRQFFDHGNWYDLKDTSKIRLEDLQLLAAMGPPGGGRNAVTARFLRHFNICTINSFSDETMVHIFSSVMAFYLRNNDFPPEFFSVGNQIVSATLEVYKKAMQNLLPTPTKSHYTFNLRDFSRVIQGVLLLRREAADGRRSMLRLFVHEVYRVFHDRLVDDQDRRWLYGLSRDLLRDHFKESFDAVFE--DLKEEGRPLCQEDMRKLMFGDYMNPDLMDEERLYAEVPSVQQFSSVVEQCLEEYNQTHKNRMNLVIFGYVLEHLSRISRVLKQPGGHALLVGVGGSGRQSLTRLATAMSGMALFQPEISKSYGHTEWREDVK 2299          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003938.1 (pep scaffold:Pmarinus_7.0:GL495754:984:26133:-1 gene:ENSPMAG00000003592.1 transcript:ENSPMAT00000003938.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1465.67 bits (3793), Expect = 0.000e+0
Identity = 718/1222 (58.76%), Postives = 902/1222 (73.81%), Query Frame = 3
Query: 3891 LKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAI-TDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGK-VTEDDIRSLIYCDFSDAKSSNKE--YIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQ 7544
            +KY YEYLGN+ RLVITPLTDRCYRTL GA +L+LGGAPEGPAGTGKTETTKDLAKA+A QCVVFNCSDGLDY+A+ KFFKGLAS GAW+CFDEFNRI+LEVLSVVAQQIL IQRAI  +  T  FEGTEL L+P C V ITMNPGYAGRSELPDNLK LFR+VAMMVP+YALIAEISLYS GF+NA+PL+VKIV TYRLCSEQLSSQ HYDYGMRAVK+VL AAGNLKLK+P+E+EDIL+LRSI DVN PKFL+HD+PLFNGI SDLFPG+  P  DY +  +  +E C + N++    F++K+ Q YEMMIVRHGFM+VGEPF GKT   +VLA  L  + E+G   E +VQ   +NPKAITMGQL+GQFDPVSHEW+DG++A ++R FA+S TPDRKW++FDGP+D +WIE+MNTVLDD  +LCLMSGEIIQ+S   +LIFE MDL  ASPATVSRCGM+YMEP+ LGW+P+  SWL  LPP +  + ++ +  ++F   +   +  + +   KEL  TSD N+V SL  L +  +     +    + D +++  W+   F F+  WS+GA+ + +GR  FD   REL+ G   +           +PP +  ++     +G +YDY +    +  G G W HW+EL+K      K  K  +IIVPT DT +YTYLM+L + H +P LFVGPTGTGKS YI + L+N ++K+ Y P  +NFSAQTSANQTQNIIMSKLD+RRKGVFGPP+GK+ ++FVDD+NMP  E +GAQPPIELLRQ+ DH NWYDLKDT+ I+L DLQ + AMGPPGGGRN +T RFLRH N  TIN F DETM+ IFSS++ +++   +F P+F    NQ++ ATL+VYK AM NLLPTP KSHY FNLRDFSRVIQGVLL      +    M RL+ HE++RV++DRLV DQDR W +   R++   H  E FD +F+  D  E+G+ + ++D+R L++ D+ +    ++E  Y EV  ++     VE  L+EYNQ  K  MNLV+F + +EH+SRISR+LKQP  HALLVGVGGSGRQSLTRLA +M+   LFQ EISKSY  TEWRED+K +L+ +       VFL +D QIKQE+FLEDI+NLLN GEVPNL+  DE+Q++ E +      +   +  + SP+AL+ FFV R R+ LH+V+A SPIGDAFR RLR+FPSL+NCCTIDWFQ
Sbjct:    1 VKYAYEYLGNSPRLVITPLTDRCYRTLVGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMSKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIQTKMVTFAFEGTELVLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLIAAGNLKLKFPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGITLPAADYTLFLEAARECCSRHNVQPVKVFLDKLIQTYEMMIVRHGFMLVGEPFAGKTKVLQVLADTLTLMSERGQGGEERVQLRTVNPKAITMGQLFGQFDPVSHEWTDGIVANTFREFASSDTPDRKWVVFDGPIDTLWIESMNTVLDDCLQLCLMSGEIIQMSQPMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWQPLVQSWLGTLPPTLQQEDNRDLLQELFTWLVAPSLRMV-RKQCKELVQTSDGNLVVSLTRLFEMLLCGLLGQ----EPDSKNVRVWIMASFAFSLVWSVGASCDSDGRVKFDSFLRELLTGKSKD---------HPLPPTVGKWECPLEERGLVYDYMY----ELKGRGHWVHWNELIKNPHLGDKGTKVQDIIVPTIDTARYTYLMDLCIQHSRPLLFVGPTGTGKSVYIKNKLMNNLDKERYLPFFVNFSAQTSANQTQNIIMSKLDKRRKGVFGPPMGKRSVIFVDDMNMPALEKFGAQPPIELLRQFFDHGNWYDLKDTSKIRLEDLQLLAAMGPPGGGRNAVTARFLRHFNICTINSFSDETMVHIFSSVMAFYLRNNDFPPEFFSVGNQIVSATLEVYKKAMQNLLPTPTKSHYTFNLRDFSRVIQGVLLLRREAADGRRSMLRLFVHEVYRVFHDRLVDDQDRRWLYGLSRDLLRDHFKESFDAVFE--DLKEEGRPLCQEDMRKLMFGDYMNPDLMDEERLYAEVPSVQQFSSVVEQCLEEYNQTHKNRMNLVIFGYVLEHLSRISRVLKQPGGHALLVGVGGSGRQSLTRLATAMSGMALFQPEISKSYGHTEWREDVKALLKSAGAKGRKTVFLITDTQIKQETFLEDIDNLLNTGEVPNLFAADERQDIMEAV--RPVAQAGNKNVELSPLALFAFFVNRCRENLHVVVAFSPIGDAFRTRLRQFPSLINCCTIDWFQ 1200          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Yeast
Match: DYN1 (Cytoplasmic heavy chain dynein; microtubule motor protein; member of the AAA+ protein family, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p; motility along microtubules inhibited by She1p [Source:SGD;Acc:S000001762])

HSP 1 Score: 407.142 bits (1045), Expect = 9.754e-114
Identity = 293/932 (31.44%), Postives = 459/932 (49.25%), Query Frame = 3
Query: 2571 GLRDRHWQQISDIVGY-----TLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFS-SPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYK-ATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTT------LQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVE------NNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSF-----FMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTP----DRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVY 5282
             L+ RHW  I   +G       L ++    L  ++ +NL         I E A KEF +EK++ ++K  W   ++ VI +  +G  ++   D ++    + + +  +M+ S + K FE +  D ESKL  + +I   W++VQ  WL L  I   + DI   +P E  KF S+   +K I  +       + VI I      LK + + L+ I   L+ +LE++R  FPRF+FL ND+LL+I+   K   +V   +KK F  I S++F E   IT ++S E E++ L + I   K   Q ++WL  L+ ++  SV     + L   K  T  +  V K+  Q +L  +   WT  V+  ++        Y K       E+   ++G L K N+++      ++AL+V  +H  +V+  L       E    W    ++Y         N++       +L+Y +EY+G   RL+ TPL    + TL  +LH   GG   GPAGTGKTET K   + + +  VVFNC D  DY  L +   G+   GAW CFDEFNR+D +VLS V+  I  IQ  +   +  +     E  L P  AVFIT+NPGY GRSELP+NLK  FR  +M  P    IAE+ L   GF +++ LA KIV    L S + SS  HY +G+R +K VL     L  ++ + ++ +  + S+  V LP   + D  +F    S +F     P      LN      CLK   + S F     F++K  Q Y M   +   ++VG+   GKT+ +K +  A+       + + +     +++ K +T   LYG     + EW DG+     R      T      R W++FD  +D  ++E MN+VLDDNK L L +GE + + P+  ++FE  +L+  +PAT++RCG+++
Sbjct: 1309 ALKPRHWNMIFRDIGKRQIQKNLLDKLEFSLKDVMVLNLTLNEILLTKIIERAQKEFVIEKSLNRIKKFWKEAQYEVIEH-SSGLKLVREWDVLEQACKEDLEELVSMKASNYYKIFEQDCLDLESKLTKLSEIQVNWVEVQFYWLDLYGILGENLDIQNFLPLETSKFKSLTSEYKMITTRAFQLDTTIEVIHIPNFDTTLKLTIDSLKMIKSSLSTFLERQRRQFPRFYFLGNDDLLKIIGSGKHHDQVSKFMKKMFGSIESIIFLEDF-ITGVRSVEGEVLNLNEKIEL-KDSIQAQEWLNILDTEIKLSVFTQFRDCLGQLKDGTDIEVVVSKYIFQAILLSAQVMWTELVEKCLQTN--QFSKYWK-------EVDMKIKGLLDKLNKSSDNVKKKIEALLVEYLHFNNVIGQLKNCSTKEEARLLWAKVQKFYQKNDTLDDLNSVFISQSGYLLQYKFEYIGIPERLIYTPLLLIGFATLTDSLHQKYGGCFFGPAGTGKTETVKAFGQNLGRVVVVFNCDDSFDYQVLSRLLVGITQIGAWGCFDEFNRLDEKVLSAVSANIQQIQNGLQVGKSHITLLEEETPLSPHTAVFITLNPGYNGRSELPENLKKSFREFSMKSPQSGTIAEMILQIMGFEDSKSLASKIVHFLELLSSKCSSMNHYHFGLRTLKGVLRNCSPLISEFGEGEKTV--VESLKRVILPSLGDTDELVFKDELSKIFDSAGTP------LNSKAIVQCLKDAGQRSGFSMSEEFLKKCMQFYYMQKTQQALILVGKAGCGKTATWKTVIDAM------AIFDGHANVVYVIDTKVLTKESLYGSMLKATLEWRDGLFTSILRRVNDDITGTFKNSRIWVVFDSDLDPEYVEAMNSVLDDNKILTLPNGERLPIPPNFRILFETDNLDHTTPATITRCGLLW 2214          

HSP 2 Score: 327.02 bits (837), Expect = 1.970e-89
Identity = 320/1387 (23.07%), Postives = 631/1387 (45.49%), Query Frame = 3
Query: 5880 EIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRR------RKGVFGPPVG--KKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGG-GRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAH-MKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHL-NEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDL-ELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELD-------------------QSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTM--IIVEQQSTEASKQ-----EKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKD-NIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFA-------LEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSR-RWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFN-LSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFIL 9896
            +I++PT DT+K+  +   LL   +  +  GP G+GK+  + + L    N  +Y    INFS  T+       I+S L R        KG+   P    K +++F D++N+P  + YG+Q  +  LRQ ++   ++   +   + +  +  +GA  PP   GR P++ RF RH   + +     +++  I+     ++       P+F+       +A++ +Y         T  +SHYLF+ R+ +R+++GV  ++     +    + RLW +E +R++ DRLV  +++  F   + E  +K+L N+D             G ++   +         D K  NK     TDL   + +  + + DE  ++   PM  V+    ++H+ RI R LKQ + H +L+G   +G+  LTR  A +    + Q +I +    +++   LK+ +   +  ++    +  ++ I + +FLE +N LL   ++P+L+  +E  ++   +R   R    +  T+     LY++FV  +   LH+V  +    +   + +   P+L N C I+W   W    ++ VA   ++ + ++                   Q+++D  +++   F    R   +K  + +   N  +P  +++ +     L+  K  ++Q+ +R   VGLEKL  +   ++ + K L     +L E  KE   T+  +++EQ  +E  ++     +KI+K +E    D  K  E +       + +  P +  A + ++ +    +T +R+M++PP GV++VMEAVC + G +                 W   ++ + +  F+  +  +D   ++   I K + E++L++ +F  E I  AS AC  L +WV A       LE  D + + +   +    K       A        A+++  + K  +L  ++E+ K    +++  +D       R+  L+  L  EK+RW+            L G+ ++SS    Y G      RA+        + + ++     +  I  L    E   W   GL  +++ +EN  I+ NS+   P ++DP       I N    N   ++   +  FV+ LEN I+FG+ V++++ GE  DP++  L+ ++    G  + +++GD  ++ S DF+ +I +   +         +V L++F+   E ++ ++  I ++ E  E++ ++  LI+ +   K KLK LE  +L  L+ S+GN+LE++  +  LN+ K+ +  I +K +  EE   + D     Y  I  HS  +F  +         Y  S+  F++ F  + I  S ++   + R+  +       +YC    +L +K K++ +  +
Sbjct: 2389 DIVIPTIDTIKHEKIFYDLLNSKRGIILCGPPGSGKTMIMNNAL---RNSSLYDVVGINFSKDTTTEH----ILSALHRHTNYVTTSKGLTLLPKSDIKNLVLFCDEINLPKLDKYGSQNVVLFLRQLMEKQGFWKTPENKWVTIERIHIVGACNPPTDPGRIPMSERFTRHAAILYLGYPSGKSLSQIYEI---YYKAIFKLVPEFRSYTEPFARASVHLYNECKARY-STGLQSHYLFSPRELTRLVRGVYTAINTGPRQTLRSLIRLWAYEAWRIFADRLVGVKEKNSFEQLLYETVDKYLPNQDL------------GNISSTSLLFSGLLS-LDFKEVNK-----TDLVNFIEERFKTFCDEELEV---PM--VIHESMVDHILRIDRALKQVQGHMMLIGASRTGKTILTRFVAWLNGLKIVQPKIHRHSNLSDFDMILKKAISDCSLKESRTCLIIDESNILETAFLERMNTLLANADIPDLFQGEEYDKLLNNLRNKTRSLGLLLDTEQE---LYDWFVGEIAKNLHVVFTICDPTNNKSSAMISSPALFNRCIINWMGDWDTKTMSQVANNMVDVIPMEFTDFIVPEVNKELVFTEPIQTIRDAVVNILIHFD---RNFYQKMKVGV---NPRSPGYFIDGLRALVKLVTAKYQDLQENQRFVNVGLEKLNESVLKVNELNKTLSKKSTELTEKEKEARSTLDKMLMEQNESERKQEATEEIKKILKVQE---EDIRKRKEVVMK----SIQDIEPTILEAQRGVKNIKKQQLTEIRSMVNPPSGVKIVMEAVCAILGYQFSN--------------WRDIQQFIRKDDFIHNIVHYDTTLHMKPQIRKYMEEEFLSDPNFTYETINRASKACGPLYQWVNAQINFSKVLENVDPLRQEMKRIEFESLKTKANLLAAEEMTQDLEASIEVSKRKYSLLIRDVEAIKTEMSNVQANLD-------RSISLVKSLTFEKERWLNTTKQFSKTSQELIGNCIISSIYETYFGHLNERERADMLVILKRLLGKFAVKYDVNYRFIDYLVTLDEKMKWLECGLDKNDYFLENMSIVMNSQDAVPFLLDPSSHMITVISNY-YGNKTVLLSFLEEGFVKRLENAIRFGSVVIIQD-GEFFDPIISRLISREFNHAGNRVTVEIGDHEVDVSGDFKLFIHSCDPSGDIPIFLRSRVRLVHFVTNKESIETRIFDITLTEENAEMQRKREDLIKLNTEYKLKLKNLEKRLLEELNNSQGNMLENDELMVTLNNLKKEAMNIEKKLSESEEFFPQFDNLVEEYSIIGKHSVKIFSMLEKFGQFHWFYGISIGQFLSCFKRVFIKKSRETRAARTRVDEILWLLYQEVYCQFSTALDKKFKMIMAMTM 3702          

HSP 3 Score: 69.707 bits (169), Expect = 1.285e-11
Identity = 53/217 (24.42%), Postives = 97/217 (44.70%), Query Frame = 3
Query: 10407 GKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGV-LEKTVEELNPETTHPDFRLWLTSYPSS-TFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDM---EFFGTSKDLSAWK-KLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLH--MFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYC 11033
            G  E+L+  Q +       I +   EG W+LLQN  ++ SW+   L K VEE      H  F++++T + +    P  +LQ   +   E   G+          D + D+   +FF T K    W     F L +FHA++  R +  P G++ KY FN+ D + +   L   +  +  +++ +  ++       YGG++ ++ D   +  +    +C
Sbjct: 3817 GSIENLNYAQEE-------ISKSKIEGGWILLQNIQMSLSWVKTYLHKHVEETKAAEEHEKFKMFMTCHLTGDKLPAPLLQRTDRFVYEDIPGIL---------DTVKDLWGSQFF-TGKISGVWSVYCTFLLSWFHALITARTRLVPHGFSKKYYFNDCDFQFASVYLENVLATNSTNNIPWAQVRDHIATIVYGGKIDEEKDLEVVAKLCAHVFC 4016          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Nematostella
Match: EDO45806 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRR2])

HSP 1 Score: 5309.19 bits (13771), Expect = 0.000e+0
Identity = 2657/3972 (66.89%), Postives = 3170/3972 (79.81%), Query Frame = 3
Query:  225 PPTKPRKLKGEDLAFERSQLRKDREKFRKALVDMILQGEDRPIKESIETVRLPPLTQEKTPVGMSATEKDILRYYYYIHNGIDTEHVAKMEXXXXXXXXXXXXXXXXAEHPXXXXXXXXXXXXXXXXSVKKAIVDFVLKEPREKETDDTP-IPEHRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIIT----QNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFAL---EKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFF-GTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD 12113
            PP  P  + G+  A      +KDRE FR ALV++I+         S     LPPL +  +P   +A EKDILRYYYYIHNGIDTEHVA MED W++++ +L+ + LK      +E+L DE+KEDYLLSVKKAIVDFVLK+PREKE D    + EHR EL  VPKPW +S++ A    ++ L+VTNP M  VL+LW  +F  LRLVD  + + +  A+EL  FQ+  MRHIE AKE L+K+W  +VQNIYYQGNK+K VPS Q+   LE FFN AS LMT+ LQ L L+S+ DYT L   PS  I  +                       EHPGF++RL+LE   +KFEP  +DFE +LLNVYD M+K +  V R+E++LYS+W+G  TK  L PII  EI+ + K+ V  V+  E  GP EH+K +DKY+ LI R+ + ++D  L EG   H F  F+K ++ +  LV +I+Y+SR+ IR+GMFEL CDELIRAL+KR   +  KLL R+ + H+  N+ L +EYE+I  KAL  PANTE +MEL  ++   E  T+ +LEK+L ++  RL FL+DYA+F+ +DM LN SVF  H RM  +F+E+KK +   + +++ +LK +RERF+EEL+SY KQ+EEFQ  GDM+E+ +YLKK+Q L  +LE A  +I  FN EEEAFGWD T+YP RQ++ N L PYLKLYET VEF  KYK+WMEG    ++PD+V+++ GNY+R+L+KLEKQ    P+ ++IA ++KTKVEEFKE++PL+Q +F PGLRDRHW+Q+S+I+G+ L+ +E M L+K+ +MNLEP++ +FE+ISEAA KEF+LEKAMEKM  EW  +EFV+I YRETGT ILSS+DDIQ +LDD IVKTQTMRGSPFIKPFE EIK+WE KLIL Q+I+DEWLKVQATWLYLEPIFSSPDIMAQMPEEGR+F++VDK W+E MK  + DK VLTVI IEKML KLKKSNELLE ILKGLN+YLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASL FT+TLDITHMKSSE E+V LKDVISTSKARGQVEKWLLEL+ DM+ASVR  I E +  Y    R +WV+ W GQ VL ++ YYWT  V  AI+ G + LD YL+ NNSQID+IV LVRG+LSKQNR TL AL+VLDVHARDVL  L +  +++E+DF WL QLRYY+ E N++T+MI++ L YGYEYLGN+ RLVITPLTDRCYRTLFGAL LHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQ  I +  DTL+FEGTE+KLDPTCAVFITMNPGYAGRSELPDNLKALFR+VAMMVP+YA+IAEISLYS GFVNAR LAVKIV TY LCSEQLSSQ HYDYGMRAVKSVLTAAGNLKLKYPDE+EDILMLRSI DVNLPKFL HDLPLF GI SDLFPGV  P PDY +L     E C  MNL+    F+ KI QIYEMMIVRHGFMIVGEPFGGKT AY+VLA AL D+ E+GLMEENKVQ  ++NPK+ITMGQLYGQFDPVSHEWSDGVLAV+YRAFA+STTPDRKWLIFDGPVDA+WIENMNTVLDDNKKLCL SGEIIQL+ +TNLIFEPMDLEVASPATVSRCGM+YMEP  LGW+P+  SWL  LP  + + +K++  D+F+R  +A +  I+KGG KELSPT+D N+V S +N++D  +D F+DE +  ++++R++  WLE ++ F+  WS+GAT + EGRK+FDKL RE++ G +  E++ K  ++E V PP + +   +P K T+YDYRFI E    G GKWE W+E +K    I KD  FNEII+PT DTV+YTYLM  L+TH KP LFVGPTGTGKS YI +FLL ++ ++ YKP LINFSAQT+A QTQ+IIMSKLD+RRKGV+GPP+GKK +VFVDDLNMP RE YGAQPPIELLRQWLDHW WYDLKDT+ I L+D+Q + AMGPPGGGRNPITPRFLRH NTI+I +F D TM+ IFS I+NWH+ T    + FS DF P  + L+  TL++Y++A+ NLLPTPAKSHYLFNLRDF+RVIQG LLS P+ I E   +KRLW+HE+FRV+YDRLV   DR+W +N +REV   HLN +FD LF+ LDFD DGKV EDD+RSL++CDF+DAK+  K Y+EV DL+ LR  VE YLDE+N MSKKPM LVLFRFAIEHVSRISR++KQPR H LLVGVGGSGRQSLTRLAA MAD+DLFQVEI K YTSTEWRED+K ILRK+ E + + VFLF+D QIK+ESFLEDINNLLNAGEVPNL+P DEKQE+CEKMRQ DRQRDK +QTDGSPVAL+N+F++RVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQ+WP DAL  VA RFLE+ E++  +K+GC+++CK FHTSTR LS +Y  EL R+NYVTPTSYLELISTFK LL+KK+ EV K KRRYEVGLEKL SA S ++ MQ+EL   QP+L++A KEVD  M+I+E+ S E +K EKIVK +EA+AN+QA AA+AIK+ECD DL EAIPILESAL AL TLTPADIT+V+TM SPP GV+LVMEA+C+LKG+KPDR+ DPSGSGKKIEDFW PSKR+LG+MKFL+GL+ +DKDNIP P +K IR+KY +N +F P++I VASTA EGLC+WV A+   EKYD +        + L   + ++      LNKKRAALKEVQDKL  L E+ E+N ++K DLE +VDLCSKKL RAE+LIGGLGGEK RW + A+ LGVR+ NL GD+L+SSGVVAYLGAFT++FR    + +                L+  +  PV+IR W I+GLPTD FSIENGIII+N+ RWPLMIDPQGQANKWIKNMEKKNNL VIKLTDAD+VR LENCIQFGTPVLLEN+GEELDPLLEPLLLKQTFKQGGSICIK+GDS+IEYS DFRFYITTKLRNPHYLPET+VKVTLLNFMITPEGL+DQLLGIVV+RERPELEEEKN LI QSA NK++LKE+ED+IL VLS+SEGNILEDE+AI VL+SSK L+NEI+EKQA  EETE+KID+ R+GY PIA+HS ILFFSIADLANI+PMYQYSLTWFINLF +SIDNSEKSE L +RL+NL+++FTYSLYCNVCRSLFEKDKLLFSF+LC NIL HD  +  DEWRFLLTGGVGLDNPH NP++WLP +SWDE+CRLDD+S F G RQ+F    + WKKIYDS EP    LP EW E+  D F KM +LRCLRPDKI   +QNFV  ++GKKYIEPPPFDL  +F DSN  +PL+F+LSPG+DP AALLKFADDQGF G K  SLSLGQGQGPIA++MI++ +K+GTWV+LQNCHLA SWM  LEK  EELNP+TTHPDFRLWLTSYPS  FPV +LQNGVKMTNEPPKG+R NI RSYL DPISD EFF GT +    +KK+LFGLCFFHA+VQERR+FGP+GWNI YEFNETDLRISVQQLHMF+++YD VQY+AL+YLTGECNYGGRVTDD DRRTL+TIL KFY   V +D  YKF  SG YYAP D DYE YIEY ++LPL   P +F MH N    + +     +      TQ    SGGG+S D+IV  VS D+L+++P  FDT+  +RK+PT Y QSMNTVLVQEMVRFN L+  +RSSL NI+KAIKGLVVMSS+LEEVV  +LK KIPG+WMKKSYPSLKPLGSYVND LARLKFL DW+DNG P +FWISGF+FTQAFLTG +QN+ARKYTIPIDLL FD+E+L+D+ Y+  PEDG YV GLF++GARWDR  K I ES  KVL D +PV+WL P K  +I  +P Y++P+YKTSERRGTLSTTGHSTNFV+ M LP+D+P+EHW+MRGVALLCQLDD
Sbjct:   25 PPVPP--INGKKQAATSYAPKKDREAFRSALVNIIMP--------SSAGAELPPLERTGSP---TAAEKDILRYYYYIHNGIDTEHVAPMEDSWLDHVLSLVPSRLKDGLEVCIENLSDEMKEDYLLSVKKAIVDFVLKDPREKEEDKKEEVLEHRIELDQVPKPWYKSYLMASAAIEQDLFVTNPTMAGVLDLWHKTFGTLRLVDKNDIQMRPEALELAMFQNVVMRHIEIAKETLLKRWFPEVQNIYYQGNKRKQVPSNQNAKRLEAFFNSASVLMTNQLQMLALNSISDYTELFCPPSSSIRVL-----------------------EHPGFIMRLVLEGDTVKFEPDFKDFEVVLLNVYDVMIKAVMVVPRVETKLYSEWSG--TKKTLKPIISEEIVNEAKAKVHAVIEHEMAGPKEHLKFYDKYKDLITRKAEADVDQFLLEG---HKFNRFSKEVEKFAKLVDEIQYNSRKVIRVGMFELHCDELIRALAKRGDGLRTKLLQRMSKDHQVLNKMLCEEYEKIAEKALTSPANTEHLMELKNYIEQVENETIFDLEKRLVETKSRLGFLVDYASFSPADMRLNNSVFQWHFRMPEVFEEHKKIVNANRVQYENSLKMRRERFVEELESYSKQLEEFQTFGDMSEVPRYLKKAQALHQRLETAAEKIVTFNVEEEAFGWDTTSYPQRQQLINTLNPYLKLYETTVEFQNKYKEWMEGPWGTIDPDKVESETGNYWRSLYKLEKQLTEVPLAQRIAGRMKTKVEEFKEYLPLVQVVFNPGLRDRHWEQMSEILGFPLKPDEDMNLAKMAEMNLEPYLAQFETISEAASKEFSLEKAMEKMVGEWDAVEFVMIPYRETGTHILSSIDDIQTLLDDQIVKTQTMRGSPFIKPFENEIKEWEGKLILTQEIIDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRRFSTVDKNWRETMKVAVLDKHVLTVIGIEKMLGKLKKSNELLELILKGLNEYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLQFTDTLDITHMKSSEGELVLLKDVISTSKARGQVEKWLLELQEDMVASVRKVIMEAMEAYLKEERVKWVRDWPGQTVLCVTQYYWTAEVHKAIRGGQKQLDQYLQQNNSQIDDIVTLVRGKLSKQNRATLGALVVLDVHARDVLTKLCELGISSEDDFEWLAQLRYYFEEENVMTRMISAHLAYGYEYLGNSGRLVITPLTDRCYRTLFGALQLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQMGIKSGGDTLLFEGTEIKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPNYAMIAEISLYSYGFVNARSLAVKIVTTYTLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPDENEDILMLRSINDVNLPKFLAHDLPLFAGITSDLFPGVQLPKPDYTVLTAAAAEVCKSMNLQMVDEFLTKILQIYEMMIVRHGFMIVGEPFGGKTCAYRVLAKALSDVAEKGLMEENKVQIVVINPKSITMGQLYGQFDPVSHEWSDGVLAVNYRAFASSTTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLNSGEIIQLASTTNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWKPLLTSWLHTLPKTLNEENKELIKDLFDRMEEALLQFIRKGGFKELSPTNDTNLVNSHMNMMDTLMDEFHDEQRFKELNEREVAAWLECIYLFSCVWSLGATLDGEGRKSFDKLLREIVEGPLSLESKSKYHILEIVDPPPRPFLCPFPSKATVYDYRFIKE----GMGKWELWTEEIKDAPPIPKDMAFNEIIIPTVDTVRYTYLMEQLVTHGKPSLFVGPTGTGKSVYITNFLLKKL-EETYKPLLINFSAQTTAKQTQDIIMSKLDKRRKGVYGPPLGKKTVVFVDDLNMPAREVYGAQPPIELLRQWLDHWQWYDLKDTSPIHLVDIQILAAMGPPGGGRNPITPRFLRHFNTISITKFDDGTMVKIFSRIMNWHLTTNASCRGFSKDFGPIGDMLVNGTLEIYRNAIVNLLPTPAKSHYLFNLRDFARVIQGTLLSAPDRITEHDMLKRLWSHEVFRVFYDRLVDGGDRDWLYNNLREVCKSHLNVEFDTLFQRLDFDGDGKVKEDDLRSLVFCDFTDAKADPKPYVEVEDLDKLRGVVENYLDEFNNMSKKPMTLVLFRFAIEHVSRISRVIKQPRGHCLLVGVGGSGRQSLTRLAAHMADFDLFQVEIGKGYTSTEWREDIKAILRKTAEGETNGVFLFTDTQIKEESFLEDINNLLNAGEVPNLFPLDEKQEICEKMRQFDRQRDKSKQTDGSPVALFNYFIERVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQSWPADALQVVAQRFLEECEIEADVKEGCVEMCKSFHTSTRDLSLRYQSELKRHNYVTPTSYLELISTFKALLNKKQQEVVKAKRRYEVGLEKLNSAQSQVASMQEELEALQPQLIQAGKEVDDIMVIIERDSIEVAKTEKIVKADEAVANEQAMAAKAIKDECDKDLGEAIPILESALAALNTLTPADITVVKTMKSPPAGVKLVMEAICILKGVKPDRIPDPSGSGKKIEDFWAPSKRILGDMKFLQGLQTYDKDNIPAPAIKQIRQKYTSNPEFDPDKIKVASTAAEGLCRWVIAMDSYEKYDHLTTTFKSIDLLLMSVLCDFQ----GLNKKRAALKEVQDKLARLQEKYEANVKKKSDLEKQVDLCSKKLDRAEKLIGGLGGEKTRWTEVANALGVRYTNLIGDVLVSSGVVAYLGAFTAAFRQGTCRAY----SSSGRLVEYGRVLVALIAQPVKIRDWTIFGLPTDSFSIENGIIINNANRWPLMIDPQGQANKWIKNMEKKNNLHVIKLTDADYVRTLENCIQFGTPVLLENVGEELDPLLEPLLLKQTFKQGGSICIKVGDSVIEYSKDFRFYITTKLRNPHYLPETAVKVTLLNFMITPEGLEDQLLGIVVARERPELEEEKNALILQSAENKRQLKEIEDKILEVLSSSEGNILEDETAINVLSSSKVLANEISEKQAIAEETEEKIDKTRMGYTPIAVHSAILFFSIADLANIEPMYQYSLTWFINLFIMSIDNSEKSEELDKRLENLRNHFTYSLYCNVCRSLFEKDKLLFSFLLCVNILMHDGEVCRDEWRFLLTGGVGLDNPHSNPASWLPSRSWDEICRLDDMSKFKGFRQKFPRTLEGWKKIYDSNEPQTMPLPGEWEEKF-DFFQKMVLLRCLRPDKITPCVQNFVTVKLGKKYIEPPPFDLGKAFADSNSCAPLIFVLSPGSDPTAALLKFADDQGFSGSKLSSLSLGQGQGPIALRMIEKAVKDGTWVVLQNCHLATSWMPTLEKLCEELNPDTTHPDFRLWLTSYPSPNFPVTVLQNGVKMTNEPPKGIRANIIRSYLGDPISDPEFFTGTGQKSPQFKKMLFGLCFFHALVQERRQFGPLGWNIPYEFNETDLRISVQQLHMFMNKYDEVQYEALKYLTGECNYGGRVTDDRDRRTLLTILNKFYTPGVIKDDRYKFSPSGNYYAPDDGDYETYIEYARSLPLINHPEIFDMHANVFSLRTSMRHISVLTHQTCTQCVLLSGGGRSDDEIVASVSEDILSKMPQEFDTDAALRKFPTTYTQSMNTVLVQEMVRFNRLIKVVRSSLVNIQKAIKGLVVMSSELEEVVSGILKGKIPGLWMKKSYPSLKPLGSYVNDLLARLKFLQDWYDNGAPSVFWISGFFFTQAFLTGSKQNFARKYTIPIDLLTFDFEVLEDKKYETPPEDGVYVNGLFMEGARWDRDTKAIGESQAKVLFDSLPVMWLCPCKTEDIKKRPHYVTPVYKTSERRGTLSTTGHSTNFVMEMRLPSDQPQEHWVMRGVALLCQLDD 3941          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Nematostella
Match: EDO34727 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNG1])

HSP 1 Score: 3952.13 bits (10248), Expect = 0.000e+0
Identity = 2084/3938 (52.92%), Postives = 2721/3938 (69.10%), Query Frame = 3
Query:  423 TEKDILRYYYYIHNGIDTEHVAKME---XXXXXXXXXXXXXXXXAEHPXXXXXXXXXXXXXXXXSVKKAIVDFVLKEPREK---ETDDTPIPEHRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNK--KKLVPSVQDQANL--ERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPE-IIEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEG------EDRHS----FEEFAKYLKDY---NDLVKKIEYDS--------RRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNLGDM--NEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAF--NDEAK-ISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELV-KGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSA-WLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEE-LNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEIL-DDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD 12113
            T +D+ RY YYI  GI    +A  +    + +   +        +E   LL +L+ E+ EDY  SV+KAIVD+VLK+P EK       TP P  ++ +   P PW   +  ++    K+L++TNP M ++  LW   F   R VD  E       +   +F+   ++     +E L K W+    N+ Y G      LVP  + ++ +  ++FF+C S LM+  L+++ ++S+ D+ + L N  +         +D R +           M EH    + L +    +    +  D+               +   ++E+ L+ D   DK ++ L  + + E +++ +     +V    +VGP +++  + KY+ L+N + + ++   L +         +H+       F   LK      D  K  E+ S          ++ L M  L C E+ + LS RA  + + ++  V++ +R  NR + ++Y+E+  K   +P NT+ ++ L +F+     + +++L+  +D + ERL+FL+DYA     D+ LN +VFH    +  IF+ +K  +  +K+    +LK + + + E+L+ Y K+VE F+    M   E+ K ++K   L T L+AA   + D N EEE   W+ T +P+ Q +     PY KL+ TA+ F  K++ W+ G   ++  + V+ ++G  +RT+ KL K F + P P+++A  V++K+++FK H+PL+Q +  PG+R+RHW Q+S++VG+ ++ E    L  +++ NL   + + E IS +A KEF LEKAMEKMK EW+ M F  + YR+TG  ILS+VDDIQ++LDDHIVK QTM GSPFIKPFEAEIK W  KLIL+QDI+D WLK QATWLYLEPIFSS DIMAQMPEEGRKF  VD  WK+IM + + D +VL       ML +L++SN+LLE I KGLN YLEKK+L+FPRFFFLSNDELLEILSETKDP RVQPHLKKCFEGIA L FTE  ++  M S+ENE V     I  +KA+G VEKWL+++E  M+ S++    + +  Y  T R +WV++W GQ                           YL+ +N QIDEIVALVRG+L    R TL AL V+DVHARDV   +  + V +  DF WL QLRYY+ E  +I +MI + + YGYEYLGN+ RLVITPLTDRCYR           GAPEGPAGTGKTET+KDLAKAVAKQCVVFNCSDGLD+ A+GKFFKGLA  GAW+CFDEFNRI+LEVLSVVAQQI TIQ+AI   +   +FEGTEL L+PTC +FITMNPGYAGR ELPDNLK LFR+VAMMVPDYALI+EISLYS GF+NAR LA KIVATY LCSEQLSSQ HYDYGMRAVKSVLTAAGNLKL+YPD+DE  LMLR++++VNL KFL+ D+PLF GI SDLFPG   P PDY +L   ++ENC + NL+++ ++M+KI Q+YEMMIVRHGFMIVG+P GGKT A+KVL+ A+ D+ + G   + KV Y I+NPK+ITMGQLYG FDPVSHEWSDGVLA S+R FA+STT DRKWLIFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQ+S   +LIFEP DLE ASPATVSRCGM+YMEP  LGW+P+  S+L  LP +++  H++    +F+  ++  +  I+      L+ +SD+++V     L  C +D     D A+   +M  + I  WL G++ F+  WSIG T N + RK FD   R L++G   +  + K   +          Q ++P +GT+YDY F+ +      G W +W EL  KGK  I K AK +E+ + T DT +  + +   LTH+ P LFVGPTGTGKS     +L+ ++ K+ Y P  INFSA+TSA QTQ+IIM KLDRRRKGV+GPP GKK ++FVDDLNMP +E YGAQPPIELLRQ LDH +WYD KDT+ ++L+DL F+ AMGPPGGGRN IT RF+RH N I+I+ F D TM  IF+SI +WH   + F   F+     ++ AT+ VYKSA+   LPTP+KSHY+FNLRDF+RV+ G LL     + E   + RLW HE++RV+YDRL+ D DR+ FF  I++   +    + D L  HL      K+ ++ IR+L + D+   +S +K Y EV+DL+ L   +E YLDEYNQMSK PM+LV+F+FAIEH+SR+SR+LKQ   H LLVG+GGSGRQS TRLA  MADYDLFQ+EI+K+YT TEWR+DLK++L K+       VFLFSDNQIK+ESF+EDIN +LN G+VPN++  DEK +V EKM+ + R   K    D +P+A+YNFF+ RVR  LH+VLAMSPIGDAFRNRLR FPSL+NCCTIDWFQ WPEDAL  VA +FLE+V++   +K  C+ +CK FH S R+LSE+Y   L R+NYVTPTSYLELI TFK LLD KR E+   K RY  GLEKL+ AAS +SVMQKEL D QP+L++ S E +K M+ +EQ + E   +++IV  +EA+AN+ A  A+ IK EC+ DLAEA+P LE+ALKAL+TL P+DI++V++M +PP  V+LVMEAVC++K +KP+R  DPSGSG+ IED+WG S+++LG+MKFL+ LKA+DKDNIP+P+MK IREKY+TN +F P+ I   S+ACEGLCKWV A+E YD+VAKVVAPKK  L  A  E    M  LN KRA LKEV DKL+ L +E ++   +K +LE  +DLC KKL RAE+LIGGLGGEK+RW + A  L  RF  +TGD+LLSSG VAYLG FT  FR E    W+ +   + IPCS+ FSL  TLGD V+IR+WNI GLP D FS++NGII+ N+RRWPLMIDPQGQANKWIKNMEK+N L VIKL+DA++VR LEN I FGTPVLLENIGE+LDP+LEPLLLKQTFKQGG   +KLG++ IEYS DF+FY+TT+LRNPHYLPE SVKVTLLNFMITP GL+DQLLGIV ++E+PELEE+KN+LI +SA+NKK+LKE+ED+IL VLS+SEGNILEDE+AIKVL+SSK LS EI+ KQ     TE++IDE R GY P+A HS++LFF I+DLA+I+PMYQYSLTWFINL+  SI NSE+S  L +R++ L  +FT S+Y NVCRSLFEKDKLLFSFIL   ILK  + + +  WRFLLTGGV LDNP+ NP   WL  K+W E+ R  DL    G++         WKK YDS  P ++ +PD W   L    ++M VLRCLRPDKIV A+Q+F+ E +G+ YIEPP F+L  S++DS+C +PL+F+LSPGADPMA LLKFA+D+GFGG + +++SLGQGQGPIA  MI + +K+GTWV+LQNCHLA SWM  LEK  EE +NP+ TH DFRLWLTSYPS  FPV+ILQNGVKMTNEPPKGLR NI RSYL+DPISD EFF      +AW+KLLFGLCFFHA+VQERRKFGP+GWNI YEFNE+DLRIS++QL MF++ YD +  DAL YL G+CNYGGRVTDD DRR L+ +L    C  +                   +D E                    H+N            LFD ILLT  R S GGGKS  ++++E++AD+L++ PP FD E+V++KYP  Y  SMNTVL QE++RFN L + + S+L+N++KAIKGLVVMS +LE+V  +ML  K+P +W  KSYPSLKPLGSYV D L RLKF  DW D+GPP +FW+SGFYFTQ+FLTG +QN+ARKYTIPID + F++ ++ ++R+ D  PEDG YV GLFL+GARWDR+  ++ ES PK+L D +PV+W+ P +KS+  +KP+Y  P+YKTS RRGTLSTTGHSTNFV+ + LP+DK E HW+ RGVALLCQLDD
Sbjct:  177 TRRDLERYQYYITKGIPAHALAPQDPDVMERILTERIHDKLTSDSELEPLLNELKSEVAEDYDFSVRKAIVDYVLKDPSEKNRLHIKSTPKPFPQRTVRA-PVPWHTPYRQSWDINAKNLFITNPVMMEIQNLWYDRFAQSRFVDGNELLASGLPVSPSEFEELVVKQCARTREFLKKTWIPACANLLYSGRSHWSYLVPGNEGESTVLVQQFFSCVSALMSIQLRSMVINSLKDFVDFL-NHYQDGNDFGESYSDLRYV-----------MGEHS---VDLTVGWWALPSPQTPFDYP-----------HARTGTRQVETELFPD-MRDK-RLPLRSVAVEEMLVQDYMDRAVDVFKLNTVGPQKYLNTYKKYQDLLNNKAETDVQAFLQDDPVLLALAKKHTHWLPLSTFVTKLKRIFLIGDFQKIDEFQSLSREIASLHLTVPLNMLCLNCQEVNQELSLRASKLADTMIHYVVDQNRDKNRGICRQYDEVSDKVQEMPDNTKDLVTLTQFLEKASTVMVVQLQSHVDDAGERLLFLLDYATLPYEDIKLNSTVFHWPEHIQKIFELSKNRIGHRKDLAMDDLKHRVKMYEEKLNGYNKEVEAFRKKEIMAAEEMKKNVEKLDELGTALDAARDELMDLNTEEELLQWEPTQFPILQSMMAYKEPYEKLWRTALNFQNKHEAWLNGPFVEINAEDVEEEIGGMFRTVIKLSKTFGDSPAPRRVAESVRSKIDKFKVHLPLLQVICNPGIRERHWTQMSEVVGFDIKPEASTSLCNMLEYNLHKHLDRLEEISGSASKEFGLEKAMEKMKVEWNDMFFEFVPYRDTGVSILSAVDDIQMLLDDHIVKAQTMSGSPFIKPFEAEIKSWCEKLILMQDIIDAWLKCQATWLYLEPIFSSEDIMAQMPEEGRKFGIVDSYWKDIMTESVKDTKVLVATGQPNMLGRLQESNQLLEEIQKGLNAYLEKKQLFFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIARLEFTEEQEVVGMVSAENETVPFSTKIVPAKAKGMVEKWLIQVEEVMMDSLKKVAGDAVAAYVNTVRGKWVQEWPGQ--------------------------EYLEKSNKQIDEIVALVRGKLDPGVRVTLGALTVIDVHARDVTAQMAHDGVHSLEDFQWLSQLRYYFEEKRVIVRMITTSINYGYEYLGNSGRLVITPLTDRCYR----------HGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDFKAMGKFFKGLAQAGAWACFDEFNRIELEVLSVVAQQIHTIQKAIAEHKKKFIFEGTELVLNPTCTMFITMNPGYAGRQELPDNLKVLFRTVAMMVPDYALISEISLYSMGFLNARSLAQKIVATYTLCSEQLSSQSHYDYGMRAVKSVLTAAGNLKLRYPDDDEAELMLRAVLEVNLAKFLSQDVPLFEGIISDLFPGTKWPNPDYGVLMDSLRENCSRRNLQATDWYMKKIIQVYEMMIVRHGFMIVGDPLGGKTMAFKVLSEAMTDLNKAGYPFQ-KVIYKIINPKSITMGQLYGCFDPVSHEWSDGVLANSFRDFASSTTEDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKQSLIFEPADLEQASPATVSRCGMIYMEPYQLGWKPLMESYLNTLPESLSKEHRETVRLLFDWLMEPCLNFIRHDCKFFLT-SSDMHLVTCFQRLYSCLMDEIRAQDHAEGADRMSSQQITNWLMGLYIFSMVWSIGGTLNGDSRKKFDAFFRLLISGTDKDHPKPKEIKMSK--------QNVFPDRGTVYDYYFVKQAS----GSWGNWIELTHKGKSVIPKTAKASELTIETDDTARQIFFLETFLTHEVPMLFVGPTGTGKSAITNSYLV-KLPKEKYLPVNINFSARTSAGQTQDIIMGKLDRRRKGVYGPPPGKKCVMFVDDLNMPAKEKYGAQPPIELLRQLLDHGHWYDPKDTSKLELLDLLFVSAMGPPGGGRNDITGRFVRHANVISIDSFDDNTMNKIFTSIADWHF-AKGFDATFQRLGKIVVMATMQVYKSAVDKFLPTPSKSHYVFNLRDFARVMFGTLLVPSTHLNEGDKLIRLWIHEVYRVFYDRLIDDTDRQMFFEVIKDTIKQQFKLEMDRLVGHL-VPTGQKLKDEHIRNLFFGDYMAPESPDKIYDEVSDLKALTTQMEAYLDEYNQMSKTPMSLVMFKFAIEHISRVSRVLKQDNGHCLLVGIGGSGRQSATRLATFMADYDLFQIEITKNYTKTEWRDDLKKMLIKAGVDGKPTVFLFSDNQIKEESFVEDINMILNTGDVPNIFAADEKADVIEKMQTVARVEGKK--IDATPLAMYNFFIDRVRCNLHVVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEEVDISLEVKKQCVFMCKYFHESVRMLSERYYETLRRHNYVTPTSYLELIMTFKTLLDIKRNEILALKNRYLTGLEKLEFAASQVSVMQKELSDLQPELIQTSAETEKLMVKIEQDTVEVEAKKEIVAADEAVANEAAGVAQGIKEECEGDLAEALPALEAALKALDTLKPSDISMVKSMKNPPGAVKLVMEAVCIMKSVKPERKPDPSGSGRMIEDYWGSSQKILGDMKFLDSLKAYDKDNIPVPVMKKIREKYVTNPEFNPDNIRTVSSACEGLCKWVRAMEVYDRVAKVVAPKKEKLAAAEAELAIQMEKLNLKRAELKEVADKLQALNDEFDAMTTKKKELEANIDLCEKKLDRAEKLIGGLGGEKERWTETARLLEDRFFKVTGDVLLSSGEVAYLGPFTVDFRNECIDGWVKECTTRKIPCSESFSLNATLGDAVKIRAWNICGLPVDAFSVDNGIIVDNARRWPLMIDPQGQANKWIKNMEKENKLSVIKLSDANYVRTLENSITFGTPVLLENIGEDLDPILEPLLLKQTFKQGGVEYLKLGENSIEYSRDFKFYMTTRLRNPHYLPEISVKVTLLNFMITPLGLEDQLLGIVAAKEKPELEEKKNELILESAHNKKQLKEIEDKILEVLSSSEGNILEDETAIKVLSSSKVLSEEISAKQEIATATEKEIDETRNGYKPVATHSSVLFFCISDLASIEPMYQYSLTWFINLYLQSILNSERSPELSERIEFLNDHFTQSIYSNVCRSLFEKDKLLFSFILTIGILKGRNKVDDQVWRFLLTGGVALDNPYPNPCPEWLGDKNWSEIVRASDLPNLKGLKDDL--ANPGWKKFYDSSTPQSESMPDPW--DLLSGLDRMVVLRCLRPDKIVPAVQDFIVENMGRSYIEPPTFNLQLSYDDSHCCAPLIFVLSPGADPMAGLLKFANDKGFGGNRIQTISLGQGQGPIAAGMIDQALKKGTWVVLQNCHLATSWMPKLEKICEEVINPDDTHQDFRLWLTSYPSPDFPVSILQNGVKMTNEPPKGLRSNILRSYLNDPISDSEFFTACNKPAAWEKLLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISMRQLQMFLNDYDEIPLDALTYLIGQCNYGGRVTDDKDRRLLVCLLSICVCRDI-------------------VDNEK-------------------HKN------------LFDCILLTLPRQSGGGGKSPAEMIEELAADILSKFPPLFDLEMVIKKYPVIYTDSMNTVLRQELIRFNRLTAVVISTLRNLQKAIKGLVVMSGELEDVFNNMLLGKVPAVWAAKSYPSLKPLGSYVTDLLDRLKFFQDWIDHGPPNVFWMSGFYFTQSFLTGARQNFARKYTIPIDHVGFEFNVMKEERDMDHKPEDGVYVNGLFLEGARWDRETMLVAESLPKILFDTLPVMWIIPGEKSKFKSKPNYPCPVYKTSARRGTLSTTGHSTNFVMFVDLPSDKTERHWVNRGVALLCQLDD 3976          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Nematostella
Match: EDO37961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE81])

HSP 1 Score: 2842.76 bits (7368), Expect = 0.000e+0
Identity = 1465/2536 (57.77%), Postives = 1830/2536 (72.16%), Query Frame = 3
Query: 3867 ITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDF--SDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQ---------GGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPS-AWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFF-GTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLST 11435
            + ++IN+ +KYG EYLGN+ RLVITPLTDRCYRTL  A HL+LGGAPEGPAGTGKTETTKDLAKA+A QCVVFNCSDGLDY+ +GKFFKGLASCGAW+CFDEFNRI+LEVLSVVAQQIL IQRAI A QD  +FEGT+L L+P C V ITMNPGYAGRSELPDNLK LFR+VAMMVPDYALI EI LYS GFV+AR L+VKIV TY LCSEQLSSQ HYDYGMRAVK+VL AAGNLKLKYP+ DE++L+LRSI+DVNLPKFL+HD+PLF GI SDLFPG+  P  DYD     ++E C K N++   FF EKI Q YEMM+VRHG                         C  G +  +  Q+       I     Y         W+DG++A ++R +A     +  W                                                    PATVSRCGM+Y+EP+SLGW P+  SWL  LP  + + H K+   +F+  + A +  ++K    E    SD N+ +SL+NL++  +   ++E      D + +  W+   F F+  WS+GA  + E R  FD   ++LM GG +++  I   LV  +  P+       P +G +YDY F    +    G W  W++L+K      K  + N+IIVPT DT +Y+YLM+L++ ++KP LFVGPTGTGKS Y+ D L+N + KD+Y P  +NFSAQTSANQTQ+IIMSKLD+RRKGVFGPPVGK+ ++FVDD+NMP  E YGAQPPIELLRQ+LDH NWYD KDTT I LIDLQFI AMGPPGGGRNP++PRFLRH N +++  F+DETM  IFSSI+ ++    +F  D   + NQ++ AT+++YK AM NLLPTPAKSHY FNLRDFSRV+ GVLL   + + +   + RLW HE++RV+YDRLV D+DR+W           H   + D L          + +EDD+RSL++CDF   DA + ++ Y EVT+++ L K VE  LDEYNQ  K  MNLV+FR+ +EH+ RISR+LKQP  +ALLVGVGGSGRQSL+RLAA +A + +FQ EISKSY  TEWRED+K +L+ +       +FL +D QIK+ESFLED+++LLN GEVPNL+PTDEK E+ E +R   + + + +  + SP+AL+NFFV   +++LHI+L MSPIGDAFRNRLR+FP+L+NCCTIDWFQ WPEDAL  VA +FLED  L  + +   + LCK FHTS+R LSEKYL  L R+NYVTPTSYLELIS+FK LL +K+ EV + KRRYEVGLEKL  AAS ++ MQ EL + QP+LV A+ E DK MII+E++S E     ++V+ +EA AN QA  A+A+K+EC+ DLAEAIP LE+A+ AL TL PADITIV++M +PP GV+LVM AVCV+K IKP++VNDP G+GKKI DFWGPSK+LLG+M FL  LK +D+DNI   IM  IR++Y+ N DF P ++  AS+A EGLCKWV A+E YD+VAKVVAPKK +L KA       MS LN KR  L EV+ KL  L  + +    +K +LE +VDLCSKKLVRAE+LIGGLGGEKDRW  AA  L   F NLTGD+L+SSGV+AYLGAFT+ FR E T +W      K+IPCSD F L  TLG+ ++IR+WNI GLPTD FSI+NG+I+  +RRWPLMIDPQGQANKWIKN EK+N L VIKLTD D++R LEN IQFG PVLLEN+ EELDP L+P+LL +  K+         GG +CI+LG+S+IEYS DFRFYITTKLRNPHYLPE S KVTLLNFMITPEGLQDQLLGIVV++ERP+LEEE+  LI QSA NKK+LKE+ED+IL  LS+SEGNILEDE+AI++L+SSK LS+EI++KQ   +ETE KI+E+R GY PIA H+++LFFSI DL NIDPMYQYSLTWF+NLF  SI +S KS+ L++RL+ L  +FTY+LYCNVCRSLFEKDKLLFSF+LC+NILK  S +   E+ F LTGG+GL+N  ENP  +WL  +SWDE+CR+ DLS F   R+ F      W+KIYDS EPH   LP  W+E+L D F KM V+RCLRPDK+V  + NFVE+++GKK+I+PPPFDL  S+ DSN  +PLLFILSPGADPMA L+KFADD+GF G KF ++SLGQGQGP+A ++IQ  ++ G+WV+LQNCHLA SWM  LEK  E+LNPETTH DFRLWLTSYPS+ FPV +LQNGVKMTNEPP GLR N+ +SY++DPISD EFF G  +    W+KLLFGLCFFHA+VQERRKFGP+GWNI Y FNE+DLRISV+QL MFI++Y+   YDA+ YLTG CNYGGRVTDD DRR L++IL  F+   +  D  YKF  SG YYAPP   Y+ Y+E+I+ LP +  P VFGMH N DI+KD + T++L    L        GGGK ++D + E++ D+L++LP NFD E  + KYP  YE+SMNTVLVQEM RFN  + T
Sbjct:    1 MVRIINASVKYGCEYLGNSGRLVITPLTDRCYRTLMSAFHLNLGGAPEGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYLQMGKFFKGLASCGAWACFDEFNRIELEVLSVVAQQILCIQRAIAAHQDRFIFEGTDLNLNPNCYVAITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIGEIMLYSYGFVDARNLSVKIVTTYTLCSEQLSSQFHYDYGMRAVKAVLAAAGNLKLKYPNNDENVLLLRSIMDVNLPKFLSHDIPLFEGIISDLFPGIKLPKADYDTFLDTVQEVCAKKNIQFVDFFREKIIQTYEMMVVRHG-------------------------CGTGSLTPSPSQWYSFLASLIQFRIRY---------WTDGIVANTFREYAADHDGNPMW----------------------------------------------------PATVSRCGMIYLEPSSLGWDPVLQSWLGELPEVLKE-HDKLIDALFKWALPACLTFVRKSCK-EAVHCSDSNLARSLMNLVEIMLKEASEEGA----DIKHLKIWVVSSFLFSVVWSVGACVDTESRAKFDVFFKDLM-GGKLDDHPIP-TLVGKIESPI-------PPEGMVYDYLF----ERKNRGNWLQWTKLIKSTSLGGKGTRINDIIVPTMDTARYSYLMDLMIHNNKPLLFVGPTGTGKSAYVKDKLMNGLPKDLYLPAFVNFSAQTSANQTQDIIMSKLDKRRKGVFGPPVGKRFVIFVDDVNMPALEKYGAQPPIELLRQYLDHRNWYDRKDTTKISLIDLQFICAMGPPGGGRNPVSPRFLRHFNVVSVATFNDETMQRIFSSIVQFYFRNNDFPTDALCAGNQVVSATMEIYKEAMINLLPTPAKSHYTFNLRDFSRVVLGVLLIKKDALADKKTITRLWVHEVYRVFYDRLVDDKDRDWL----------HTTCNCDFLCTLF-----SQASEDDMRSLMFCDFLNPDAMAEDRLYQEVTEIDELYKIVEACLDEYNQTHKTGMNLVVFRYVLEHLVRISRVLKQPGGNALLVGVGGSGRQSLSRLAADIAGFAVFQPEISKSYGMTEWREDVKTLLKSAGCQMKPTIFLLTDTQIKEESFLEDVDSLLNTGEVPNLFPTDEKAEIIEAVRPHAQAQAEDKNAEFSPLALFNFFVNSCKEKLHIMLCMSPIGDAFRNRLRQFPALINCCTIDWFQPWPEDALEMVANKFLEDAVLTDNERKEIVTLCKYFHTSSRNLSEKYLEVLGRHNYVTPTSYLELISSFKTLLGRKQDEVLRSKRRYEVGLEKLAFAASQVAKMQVELEELQPQLVVAAAENDKMMIIIEKESKEVEATSELVRKDEAAANIQAAEAQALKDECEADLAEAIPALEAAMSALNTLKPADITIVKSMANPPAGVKLVMSAVCVMKDIKPEKVNDPGGTGKKILDFWGPSKKLLGDMTFLTSLKEYDRDNISPHIMAKIRKEYIPNPDFDPSKVKTASSAAEGLCKWVIAMEIYDRVAKVVAPKKESLAKAEASLAETMSLLNAKRRELAEVEAKLAALKSQFQEMTEKKENLEFQVDLCSKKLVRAEKLIGGLGGEKDRWSLAAKTLQDTFDNLTGDVLISSGVIAYLGAFTAGFRKECTHEWTKICQSKNIPCSDDFLLSKTLGEAIKIRAWNIAGLPTDSFSIDNGVIVDCARRWPLMIDPQGQANKWIKNSEKENQLSVIKLTDGDYIRTLENSIQFGNPVLLENVEEELDPSLQPMLLGRDSKKPYHVKITLVGGVVCIRLGESVIEYSSDFRFYITTKLRNPHYLPELSTKVTLLNFMITPEGLQDQLLGIVVAKERPDLEEERQALILQSAANKKQLKEIEDKILETLSSSEGNILEDETAIQILDSSKVLSDEISKKQKIADETEAKINESRRGYNPIAAHASVLFFSITDLPNIDPMYQYSLTWFVNLFLNSIHDSNKSKILERRLRYLSDHFTYNLYCNVCRSLFEKDKLLFSFVLCANILKSKSELDMTEFMFFLTGGIGLENKLENPDPSWLSDRSWDEICRMCDLSGFKDFRKSFSNTTHEWRKIYDSKEPHRAPLPSPWSEQLTD-FQKMIVIRCLRPDKVVPLVTNFVEDKLGKKFIQPPPFDLAKSYVDSNACAPLLFILSPGADPMAGLMKFADDKGFSGDKFNAISLGQGQGPVAARLIQEAVQNGSWVVLQNCHLAVSWMTALEKICEDLNPETTHTDFRLWLTSYPSNKFPVTVLQNGVKMTNEPPTGLRQNLLQSYITDPISDPEFFNGCGEKAPVWEKLLFGLCFFHALVQERRKFGPLGWNIPYGFNESDLRISVRQLQMFINEYEETPYDAVTYLTGACNYGGRVTDDNDRRCLMSILADFFNPDIVHDSKYKFSLSGNYYAPPKSTYDEYVEFIQELPQSQSPEVFGMHDNVDISKDCKHTRVL----LTQAQGAGGGGGKKSEDTLLEIATDILSKLPKNFDLEAALAKYPVTYEESMNTVLVQEMERFNKYVCT 2411          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Nematostella
Match: EDO31800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWW2])

HSP 1 Score: 2621.27 bits (6793), Expect = 0.000e+0
Identity = 1453/3407 (42.65%), Postives = 2076/3407 (60.93%), Query Frame = 3
Query: 2160 DMNEINKYLKKSQVLDT------------KLEAAIGRIED----FNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRET-GTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRK-----EWVKKWFGQGV---LAISMYYWTIYVQ-----DAIKEGPEALDAYLKVNNS-------QIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVEN--NMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEEN----KVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKIS---QMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSD--AKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELD-QSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEF-SIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDN--PHENPSAWLPPKSWDELCRLDD-LSVFHGIRQRFIEQ--KDSWKKIYDSVEPHNQQL--PDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEEL--NPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSY---LSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQAR-GSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRK-YPTKYE---QSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDD-RNYDE---------------------APEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD 12113
            D+ E+ +  +  ++LD+            +L+  + R+ D    +   ++ F  +VT +   +EV   LR    L+ + VE++   +DW E   E++ P+ +  +V  Y +T+ +LEK       P  +   +K K+E  +  +P+I  L  P L+ RHW QI  I  Y  ++EE + L  L  +         E +S  A  E +LE  ++K+++ W   EF+V+ +R++   FIL  VDDIQ +LDD ++   T+ GS  + P    +++W+ +L L  + +DEW+  Q  WLYLE IFS+PDI  Q+P E + F +VDK+WKEIM++V      L       +L+  + +N LL+ I K L  YLE K + FPRF+FLSNDELLEILS+T++P  VQPHL+KCF+ IA L F  T+             T +D   T     +  ++       MI+     +S G V Y  +         W+K      +     IS++   +Y+        I      ++A    + S        ++ + ALVRG L K  R  L ALI +DVHARD++  ++  +V +EN+F W+ QLRYYW  +  N + +M NSM  YGYEYLG + RLVITPLTDRCY  L GAL L LGGAP GPAGTGKTETTKDLAKA+AKQCVVFNCS+GLD+  +G+FF GLA  GAW CFDEFNRID+EVLSV+AQQ+LTI+ A  A+    MFEG E+KL P+CA FITMNPGYAGR+ELPDNLKALFR +AMMVP+YALIAE+ LYS GF +++ LA K+   YRLCSEQLS Q HYD+GMRAVKSVL  AG LK   PD +ED++++R++ D NLPKFL  D  LF  I +DLFPG   P  DY  L   I++  +   L++    ++K+ Q+YE MIVRHG M+VG    GKT+ Y +L   L  + EQ   E++     VQ  ILNPK++TMG+LYG+ + ++ EW DG++A+  R     TTPD KW++ DGPVDA+WIENMNTVLDDNK LCL + E I+L+ + +++FE  DL VASPATVSRCGMVYM+P  LGWRP   SW++     + +  ++   ++F+ ++DAG+    K   + +    DI+ V ++     C  D+F   AK      +D   +   +   F F + WSIG    E   ++FD   R+L       + RI                   P  G +Y Y    + +     + E W +++      S +  + +++VPT DTV++ +LM+ LL+ +K  L+ G TG GKS      L +   K  Y   ++NFSAQTS+ +TQ +I +KL+++RK + G P GK++++FVDDLNMP  +TYG+QPPIELLRQ+ D   +YD +     ++ D+    A  PPGGGRNP+TPRFLRH +   I    + T+  IF SI++  ++  +F  + +   + ++ A++++Y    T+LLPTPAKSHY+FNLRD S+ IQGVL + P  I +   + RL+ HE  RV+ DRL+  +D+ +F   + E+++KH             F +     + +   +++ DF    A  ++K Y E+TDL+ ++  +  YLD+YN  S K M LV F  AIEH+SRI+R+++QPR +ALLVGVGG+G+QSLTRLA  M+ Y  FQ+E+++ Y  + +REDLK++   +     + VFLF+D QI  E FLEDINN+LN+GEVPNL+  +E + V   +        +    +G    ++++F+ RVR+ LHIVL MSP+GDAFR R R FPSLVNCCTIDWF  WP +AL +V++ F E+V+L  + +KD   ++C   HTS   +++++  EL R  Y TPTSYLELI+ + ++LD+KR ++   + R + GL+KL      +  MQ EL   +P+L + S +V+K M  ++    EA K   +V+ EEA+A ++A    AI  E   DL EA+P LE+A KAL++L  +DI+ +R    PP+ V  VME++C+L G+KPD               W  +K +LG+  FL+ L  +DKD IP   ++ ++ KY+ N  F  E +   S AC  +  WV A++ Y +V + V PK+  L  A  E    MS+L +K+A+L EV+ K+  L    + +   K  L   +   + +L RA +L   LG E+ RW +      +   N+ G++ +++  VAY GAFTS +R E    W+    E  +P SD FSLI  L DP EIR WN  GLP D   +IE+ I+   + R  L +    +AN+WI+  E KN L++IKLTD +F+R LENCI+ G PVLLE +GE LDP LEP+LLKQTF QGG + I+LGDS I+Y  +FRFY+TTKL NPHYLPE  +KVT++NF +T  GL+DQLL  VV  ERP+LE+++N+LI +  ++K +LK +ED IL +L  SEGNIL+DE  I  LN SK  S  I+ +    E TE+KI  AR  Y P+A   ++++F +A LA +DPMYQYSL +F  LFN  I++SEK+++L +RL+ L +  T S+Y NV R LFEKDKL+FSF+LC +I++   +I ++EW F L G  GLD   P +    WL    W+  C L+D L  F G +  F++     S   +  S    + Q   P  W +RL  SF ++  ++  + +K+V A  +FV E +GK ++E P  DLP  F + +   PL+FILS G+DPM A L+FA D  +   + +++SLGQGQGP+A K+I    K G WV LQNCHLA SWM  +E T+++L  N    H DFRL+L+S P+  FPV +LQN VK+TNEPPKGLR N  R++   ++DP  +    G       W+KL+FG+CFFHAI+QER+KFGP+GWNIKYEFN++D   +++ L MF+   +++ +DAL ++TG+  YGGRVTD+WD+R L TIL +F+  ++ ED +YKF +SG Y+ P       Y EY+  LPL  EP VFGMH+NA+I    QET  L  ++L  Q R  SSGGGK+ D+IV E++  +L +L    D E   +  + T  +    S+ TVL QE+ RFN LL  I++SL  ++KAIKGLVVMS +L++V  S L +++P MW   SYPSLKPLGS+V D + R  F+  W  +GPP  FWISGF+F Q FLTG  QN+ARKY +PID L F Y +L   RN +E                      P+DG  V GL+LDGARWD    M+ ++    +  P+P++ ++P + + +P+   Y+SP+YKTS R G LSTTGHSTNFV+++ LPTD P+  WI +G ALLCQL++
Sbjct:  584 DVKEVKQKAQDPKILDSSSKSESIIAYLKELQGKMDRLHDTAFTYKSYQKNFKVEVTKFEELEEVHAELRLKQSLWNSLVEWDQSQQDWTETLFEELNPETLSNNVMKYAKTVMQLEKGLP----PNSVVPILKEKLENMRHKLPVITNLRNPALKQRHWDQIQQIFNYHFKDEEPLTLGLLDKIEAFEHTESIEEVSGQASSEASLEGILKKVEDAWKSTEFIVLPHRDSKDVFILGGVDDIQAVLDDSMINVSTIAGSRHVGPIRPRVEEWQRQLYLFSETMDEWMTCQRNWLYLESIFSAPDIQRQLPAEAKMFMTVDKSWKEIMRKVNRLPNALRAATQPGLLETFQNNNALLDQIQKCLEAYLESKCVIFPRFYFLSNDELLEILSQTRNPHAVQPHLQKCFDAIAKLEFGSTVQAPS---------TPQDQPVTPTGERRKMRYATNDILGMISPEGEKVSLGKVSYSHSIETLTLCFSWLKDMSNHPLNLHKKISLFSSLMYITWSRSPQYIITSSTTINALFPSHYSLCIVFPMNLNNLAALVRGVLPKLTRNILGALITIDVHARDIVTGMVNAKVDSENNFEWIKQLRYYWDPDLDNCVVRMSNSMYIYGYEYLGASARLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAKQCVVFNCSEGLDFKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLLTIRNAKVAKASRFMFEGREIKLVPSCAAFITMNPGYAGRTELPDNLKALFRPMAMMVPNYALIAEVILYSEGFESSKNLARKMTQMYRLCSEQLSQQDHYDFGMRAVKSVLVMAGALKRSNPDLEEDVVLIRALRDSNLPKFLAADAILFRAILTDLFPGKEIPDHDYGKLQSTIEDCMVAKGLQAIPALVKKVIQLYETMIVRHGVMLVGPTGSGKTTNYMMLQDTLTSLHEQA--EDSPYYLPVQTHILNPKSVTMGELYGEVNKLTMEWRDGLMALKVRQCVQETTPDHKWIVCDGPVDALWIENMNTVLDDNKMLCLANSERIKLNNTIHMLFEVQDLAVASPATVSRCGMVYMDPNELGWRPFVRSWMQKHSDKMKEETREYLWNLFDHYVDAGLKFASKKCTQAMQQV-DISKVTTMC----CLFDSFFFPAKGGPDFNLDPTKLHPLICTAFLFVFLWSIGGNLVETCNESFDTFTRDLFAD--THDVRI-------------------PGSGDLYSYYVDFDTR-----RMEPWEKIIPAF-KYSSEVPYFDLLVPTVDTVRFGFLMDKLLSVNKSVLYTGTTGVGKSVIAKAILDDISQKSNYMAIMMNFSAQTSSQRTQEMIETKLEKKRKNILGAPAGKRMVIFVDDLNMPKLDTYGSQPPIELLRQYQDFRGFYDREKLFWKEIHDMTICSACAPPGGGRNPVTPRFLRHFSMFCIPSSAEHTLGHIFKSIVSGFLL--DFPAEVRECADAIVGASVEIYARMSTDLLPTPAKSHYVFNLRDLSKCIQGVLQADPGVIRDKGQIFRLFCHEASRVFQDRLINKEDKTFFNTIMSEMAHKH-------------FQQARSPEKFESNPILFGDFMKMGADPADKLYEELTDLKKVKNLLTDYLDDYNMNSSKEMKLVFFMDAIEHISRIARMVRQPRGNALLVGVGGTGKQSLTRLACHMSAYKCFQIELTRGYDYSAFREDLKKLYDVAGVKGENTVFLFTDTQIVVEEFLEDINNILNSGEVPNLFEPEEYEAV---LNGTRPLAKEAGIPEGDRDGVFDYFISRVRNNLHIVLCMSPVGDAFRTRCRMFPSLVNCCTIDWFTEWPREALLSVSSNFFEEVDLGAEGVKDKVAEMCVEIHTSVSTMADRFYAELRRRYYTTPTSYLELITLYLSMLDEKRKQLIGARDRVKNGLKKLLETNDLVDTMQVELVALEPQLKQKSLDVEKLMEKLQVDQEEADKVRNVVQAEEAVAKEKADETSAIAAEAQKDLDEALPALEAAQKALDSLDKSDISELRVFTKPPELVMTVMESICILLGVKPD---------------WPSAKTMLGDAGFLKKLMDYDKDKIPDSTLRKLK-KYIDNPKFVVEVVEKVSKACRSMVMWVRAMDLYARVYRTVEPKRAKLAAAQAELEVVMSTLREKQASLAEVESKIAELQAAYDHSIAEKETLTKNIAQTAARLKRASKLTTALGDEQGRWTENVAAFELEIGNVVGNVFVAAACVAYFGAFTSLYRHELINSWIEQCKELGVPVSDDFSLINVLADPYEIRQWNSDGLPRDSLKAIEDRILKLLNMRSTLFL----KANRWIRTKEAKNGLKIIKLTDNNFLRTLENCIRIGMPVLLEEVGESLDPALEPILLKQTFVQGGRLLIRLGDSDIDYDKNFRFYMTTKLANPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLERPDLEDQRNQLIVRINSDKNQLKAIEDRILKLLFHSEGNILDDEVLINTLNESKVTSGVISTRLKEAERTEEKITIAREKYRPVATRGSVMYFVVASLAEVDPMYQYSLKYFKQLFNACIESSEKTDDLDRRLEILLNNCTESVYVNVARGLFEKDKLVFSFMLCGDIMRQQEIITDEEWNFFLRGTGGLDKERPAKPDVPWLTDFMWNTCCDLEDVLHSFKGFKGDFVKAPITISMGNLQQSEVGDDDQAEKPRSWQDRLT-SFERLIFIKAFKEEKVVFAAVDFVCENLGKTFVESPSIDLPVLFENVSNMIPLIFILSTGSDPMNAFLRFARDMNY-TERIQAISLGQGQGPVAEKLIANASKNGDWVFLQNCHLAASWMLAMETTIKDLTNNEAEVHEDFRLFLSSMPTKAFPVTVLQNSVKVTNEPPKGLRANTKRAFGELMADPF-ESHVLGVR-----WRKLVFGICFFHAIIQERKKFGPLGWNIKYEFNDSDRMCALENLKMFLVD-ENIPWDALTFITGQITYGGRVTDEWDQRCLTTILGRFFSPKILED-NYKFSESGIYFPPGFESLHDYREYVDNLPLTDEPEVFGMHENANIAFQTQETHQLIYTVLEVQPRLASSGGGKTNDEIVYELADSILGKLMDVLDMEKAEKSLFETDAKGRYNSLTTVLGQEVDRFNNLLKVIKNSLTQLQKAIKGLVVMSLELDKVYTSFLNNQVPDMWANSSYPSLKPLGSWVKDLVLRTMFVEQWIIHGPPKSFWISGFFFPQGFLTGTLQNHARKYNLPIDQLTFSYNVLPQYRNQEEVAEETAKLEYGQALPLDEELDCPDDGVLVHGLYLDGARWDDDSMMLGDARYGEMNPPLPILHMEP-QMNLVPDPSQYMSPLYKTSARAGVLSTTGHSTNFVVSVYLPTDLPQAFWIEKGTALLCQLNE 3894          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Nematostella
Match: EDO34077 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQG6])

HSP 1 Score: 2223.74 bits (5761), Expect = 0.000e+0
Identity = 1232/2905 (42.41%), Postives = 1749/2905 (60.21%), Query Frame = 3
Query: 2541 MPLIQTLFVPGLRDRHWQQISDIVGYTL-RNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTE---TLDITH---MKSSENEIVTLKDVISTSKARGQVEKWLLELEADM-------IASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNN-----SQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVEN--NMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPD-EDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWL--KVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYN-QMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVEL-DQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGE-EAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKT-KQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHE--NP-SAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGY------IEYIKTLPL 11144
            MPLIQ L    +RDRHW QI   V        +   L K+I++ L+ F  +   IS AA KE ++E+A+  + + W  +   +  Y++ G F L   D++   L+D+ V   TM+ S ++K FEAE+  WE  L L+ ++++  L VQ  W+YLE IF   DI  Q+P E  +F  V+  WK IM+++  D   L       +L+ L   N  LE I K L+ YLE KR  FPRF+FLSND+LLEIL ++K+P  VQPHLKKCF+ I +L       T D T    M S+E E V     +      G VE WL ++E  M       +   RL + + L     + R +WVK+W GQ  +  S   WT     A+    E  D     +      S +++   ++RG L+K  R  + AL+ ++VH RDV+  LI+    +   F WL QLR YW ++  + + +  N+  +YGYEYLGN+ RLVITPLTDRCY TL  ALHLH GG+P+GPAGTGKTET KDL KA+    +V NCS+GLD+ ++G+ + GLA  GAW CFDEFNRI++EVLSVVAQQIL+I  A+ A     +FEG E+ L  +C +FITMNPGYAGR+ELPDNLK++FR ++M VPD  +IAEI L++ GF N + LA K+   Y L  +QLS Q HYD+G+RA+ SVL  AG  K   PD  DE+IL+L S+ D+N+ K    D PLFNGI SDLFPG+  PV DY  L   I         + +   + KI Q+YE    RH  ++VG+   GK+  ++VL +A+  +   G    N V+   +NPKA+++G+LYG+FD  ++EW+DGVL+   R   +   P+ KW++FD PVD +WIE+MN+V+DDNK L L++GE I +    +L+FE  DL VASPATVSRCGMVY +   LGW+P  +SWL  +V   ++  + +     +FE+F+   +   +K   KE  PTS++N V SL  L D       +E  +   +       LE  F F   WS+ A+ +E+ RK  D   REL                          +G +P K T+Y+Y  +  KQ+     W  W + ++     +    F +I++PT DTV+Y +L+  L+   +P L  GP GTGK+  +   +L +++   Y   +IN SAQTS+N  Q II SK+++R KGV+ P  GK++I F+DD NMP ++T+G+QPP+EL+R W+D+  WYD    T   + D+  + +MGPPGGGR  I+ R     N I +    +  +  IF +++N  +  Q+F  D KP  + + QAT+++Y + +  +LPTP + HYLFNLRD S++ QG+L +  +  +    + RLW HE FRV+ DRL+ + DRE F   + +     L   FD+ F +L  ++   +            F +    +  Y ++ D + +++ +E  +++YN +     +NLVLFR AIEHV+RI R++ QPR + LLVG+GGSGRQSLTRLA+ + +Y +FQ+E++K Y   E+R+DLKR+  ++   +   VFLF+D Q  +E FLED+NN+L++GEVPNLY  DE +EV   +               +P ++++FF++RVR  LHIVL MSP+GD FRNR+R +P+ VNC TIDWF  WP DAL  VA R+LE++EL D+  K     +    H S   +S + LLEL R+NYVTPT+YLEL+S +++LL +K+ E+     +   GL+K+    + + VM  EL D   K+ E  K+ ++ ++++ QQ  EA +Q+K+V+   E IA ++ K     +N   +DL EAIP L+ A+KALE+L   D+T +++   PP  V  VMEAV +L+  +P                W  +KR LG+  F++ L  +DKDN+   I+K I   Y    DF+PE I   S A + LC WV A+E Y ++ +VV PKK  L +A  +     + L + +A LKEV D+++ L  + +    +K +L  K +L   KL RA +L+ GL GE+DRW  +   L      L GD L+++  ++Y G F S++R E   K WL  V +  + C+  FS    L  P  +R WNI GLP+D FS ENG++++   RWPLMIDPQGQA KWIKNME K+ L++I L  +D++R LEN +QFG+PVLL+N+ EELDP L P+L K   K GG   IKLGD  +EYS DFRFYITTKL NPHY PE S K T++NF +  +GL+ QLLGIVV RERPELEE+K+ L+   A  KKKL+ELEDEIL +L T++G++L+DE  +  LNSSK  S E+AE+    E+TE KID AR GY P A  ++ILFF + D+  IDPMYQ+SL  +I+LFN SI+ S++S NL  R+QNL  Y TY++Y   CR LFE+ KLLFSF +CS IL+    +  DE+ F L GGV LD   +  NP + WL   SWD +  LD L  FHGI   F +    W + Y S EP N  LP EW E   +   +M V+R LRPD++     +F+   +G K++EPP  D+    +DS+  +PL+F+LSPG DP +ALL+ A++ G    +F +LSLGQGQ PIA +MI+ G+K+G WV L NCHL+ SWM  L+K VE+L  E  HPDFRLWL+S P   FP++ILQ G+KMT EPPKGL+ N+ R Y    I++ +F    K    +KKLLFGLCFFH+++ ERRKF  +GWNI Y FN++D  +S   L +++D+Y+   +DAL+YL    NYGG VTDD+DRR L + + + +  Q  + P YK      YY P D     Y      + YI+  PL
Sbjct: 1120 MPLIQDLKNSAMRDRHWSQIKTEVQKPFDHTGDDFTLEKIIELGLDQFGEQICEISGAASKELSIEQAISGIASIWDQVSLDIGPYKDRGHFRLKQTDEVFQQLEDNQVTLSTMKASRYVKAFEAEVDKWERTLSLILEVVEMILTVQRQWMYLENIFLGEDIRKQLPRESAEFDDVNANWKIIMQRLNKDPNALRGTHYPGLLETLNDMNTKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSKNPEAVQPHLKKCFDNIKTLKMARVGLTFDKTEAVGMYSAEGEYVEFGHSVLLE---GPVEAWLCDVERSMRWTLKELLKHCRLGLKKSL-----SKRDKWVKEWPGQLTITSSQMQWTSDCNKALSSSKERGDKKALKSLKKKQVSMLNKFSEMIRGSLTKMQRLKIVALVTIEVHGRDVIEKLIKAGCNDVTAFEWLSQLRLYWDKDIDDCVVRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGNYVIVVNCSEGLDFKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGATRFVFEGREINLVWSCGIFITMNPGYAGRTELPDNLKSMFRPISMCVPDSGMIAEIILFAEGFNNTKVLAKKVHTLYTLAVQQLSKQDHYDFGLRALTSVLRYAGRKKRANPDMSDEEILLL-SMKDMNVAKLTTQDAPLFNGIVSDLFPGIEAPVIDYGKLRNAIVAELKDGGYQPTPNTILKIIQLYETKNSRHSTIVVGQTGSGKSVTWRVLQSAMTRLKRDGEPGFNVVREFPINPKAVSLGELYGEFDLNTNEWTDGVLSSVMRQTCSDEKPEEKWILFDAPVDTLWIESMNSVMDDNKVLTLINGERISMPDMVSLLFEVEDLAVASPATVSRCGMVYTDFRDLGWQPYVDSWLDRRVDKQSVEHLQR-----LFEKFV-PKVLEFRKHHCKEPVPTSELNSVVSLCVLFDA---LATEENGVRMSNGESYARMLELWFLFCLIWSVCASVDEDSRKKMDNFLREL--------------------------EGQFPAKDTVYEYH-VDIKQKT----WASWEDKLRSGWRYNPSVPFYKIMIPTVDTVRYDFLVYNLIQAKRPVLLTGPVGTGKTS-VAQKVLQKLDPKTYGLLVINMSAQTSSNDVQEIIESKVEKRTKGVYVPIGGKQMITFMDDFNMPAKDTFGSQPPLELIRLWIDYGFWYDRMKQTVKYVKDMHLLASMGPPGGGRMVISKRLQSRFNLINMTFPQESQIKRIFGTMINQKL--QDFEEDVKPLGDIMTQATIEIYNTIVAKMLPTPTRIHYLFNLRDISKIFQGLLRANKDLHDTKTAISRLWVHECFRVFSDRLIDNTDRESFVTLLSD----KLGSMFDLTFHNLCPNKQSPI------------FGNFMKDDTMYEDLVDFKAIKRYMEDQMEDYNMEPGVIAINLVLFRDAIEHVTRIVRVIGQPRGNMLLVGIGGSGRQSLTRLASYIIEYKVFQIEVTKHYRRQEFRDDLKRLYYQAGVDNKPTVFLFNDTQALEEGFLEDVNNILSSGEVPNLYKPDEFEEVRTAL----SDIAAKEDVQDTPESMFHFFIERVRSNLHIVLCMSPVGDPFRNRIRMYPAFVNCTTIDWFSEWPGDALLEVAERYLENIELGDEETKANVAQIFVTVHRSVVDMSARMLLELKRHNYVTPTNYLELVSGYQSLLAEKKKELGDAASKLRNGLDKIDDTRAKVEVMSVELEDATLKVAEFQKQCEEYLVVIVQQKREADEQQKMVQARSEKIAIEEDKCRVMAEN-AQHDLDEAIPALQEAMKALESLNKKDMTEIKSYGRPPALVEKVMEAVMILRQSEPT---------------WAEAKRQLGDGNFIKQLVNYDKDNMTDRILKKI-GTYCAQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIYRVVEPKKQRLHQATAQLEEKQAILAEAKAKLKEVTDRMEELKRQYDEKSAQKEELRAKAELLEIKLDRAGKLVSGLAGERDRWEASVTILEENIGYLVGDCLIAAAFMSYAGPFLSNYRDELVLKTWLAQVRQLGVACNPNFSFSGFLAKPTTVREWNIQGLPSDAFSTENGVMVTRGNRWPLMIDPQGQALKWIKNMEGKSGLKIIDLQQSDYLRTLENAVQFGSPVLLQNVQEELDPSLAPILNKSVVKVGGRYLIKLGDKEVEYSPDFRFYITTKLSNPHYTPEISTKTTIVNFAVKEQGLEAQLLGIVVRRERPELEEQKDALVINIAAGKKKLEELEDEILRLLQTAQGSLLDDEQLVNTLNSSKTTSQEVAEQLTVSEQTEIKIDAAREGYRPCAQRASILFFVLNDMGRIDPMYQFSLDAYIDLFNNSIEKSQRSPNLDNRIQNLNEYHTYAVYKYTCRGLFERHKLLFSFQMCSKILEAAGKLNMDEYNFFLRGGVVLDREGQMDNPCTQWLTDTSWDNVTELDKLPNFHGIVTSFEQYPRDWNQWYTSSEPENTPLPGEW-ENACNELQRMLVVRSLRPDRVSFTATSFIVNNLGSKFVEPPVLDMSSVVDDSSTRTPLIFVLSPGVDPTSALLQLAENCGM-SNRFHALSLGQGQAPIATRMIKEGVKDGNWVFLANCHLSLSWMPQLDKLVEQLQVEDPHPDFRLWLSSSPHPEFPISILQVGIKMTTEPPKGLKANMKRLY--QLITEQQFSRCHKQ-DKYKKLLFGLCFFHSVLLERRKFLMLGWNIVYGFNDSDFEVSENLLSIYLDEYEETPWDALKYLVAGVNYGGHVTDDFDRRLLHSYINEMFNDQAIQTPYYKLSSLPTYYVPKDGPLSTYRVSVILLMYIQASPL 3930          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Medaka
Match: dnah12 (dynein axonemal heavy chain 12 [Source:NCBI gene;Acc:101164478])

HSP 1 Score: 3686.35 bits (9558), Expect = 0.000e+0
Identity = 1957/3797 (51.54%), Postives = 2604/3797 (68.58%), Query Frame = 3
Query:  870 IELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVE----------FNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENK------------------PIPKK----------IAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLP-PAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDF--SDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKR-ILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETL-TPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQ--AYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPS-AWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFF-GTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKS-TDDIVDEVSADVLN-RLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD 12113
            ++ +  Q+  +   +  ++ +M  W   +  ++   N +K   S  DQ     F+NCASTL+++ L+++    + ++ ++  +PSR      H +                     P F + L  +D  ++  P+  D E  +L + + +      V  ++S     W G  +  ++N  +  +     +STV++ ++    GP +H + +D Y  L+N     ++D  L E    HSFEE+ K ++ +++L K+I     + +   M +L C+EL + L+ +A+ +C                    E+E I +K L +P NTE++ ++ K++  T++  + EL  ++ ++N  +I+L++     + D+ LN +V+   + +   F+++++ ++  +++ +  L  +RER   +L+     ++ F    ++  I +Y+   +    +L+ A   I   NKEE  + W++T YP  + ++  + PY K++E  ++          F+   K WM+GS   +  + ++  V  +YR ++K+ K F+ K                  P  K           + + V  ++++FK+++P++  L  PGLR RHW+++S I G+ L    G  L KL+ + LEPF+ +FE+IS AA KEF+LEKAM+ M   W  + F    +++TG  I +++DDIQ+MLDD IVKTQTM GSPF+KPF++E+K WE +L+ +Q+ +DEWLK+QA WLYLEPIFSS DIM Q+PEEGR F +VD+ W+EIM   + D +VL    +  +L++L+ SN LLE I+KGLN YLEKKRL+FP                                               M SSE E V L   ISTS+A G VEKWLL+LE  MI+SVR +I +    Y+ T R +WVK+W GQ VL  S  +WT+ V  A+      L  Y +   +Q++EIV LVRG+L KQ RTTL AL+ +DVHARDV+ +LI E+V++E DF WL QLRYYW+ +N+   +IN  +KY YEYLGN+ RLVITPLTDRCYRTL GA HL+LGGAPEGPAGTGKTETTKDLAKA+A QCVVFNCSDGLDY+A+GKFFKGLAS GAW+CFDEFNRI+LEVLSVVAQQ+L IQRAI  + +   FEGT LKL+P C V ITMNPGYAGRSELPDNLK LFR+VAMMVP+YALIAEISLYS GF+NA+PL+ KIV TYRLCSEQLSSQ HYDYGMRAVK+VL AAGNLKLK+P+E+EDIL+LRSI DVN PKFL+HD+PLFNGI SDLFPGV+ PV DY +  +  +E C   N++ +  F +K+ Q YEMMIVRH FM+VGE F GKT    VLA  L  + E+G  EE KV +  LNPK+ITMGQL+GQFD VSHEW+DGV+A ++R FA + TPDRKW++FDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQ+S   +LIFE  DL  ASPATVSRCGM+YMEP+ LGW+P+  SW+  LP P  +  ++ +  D+F   I   +  + +   +E+ PT++ + V +L  L    +    DE   +  D   I TW+   F  +  WS+G   + + R+ F+   R+ ++G   E           +P  ++ ++     KG +YDY +  +++    G+W HW++ ++  +    + K  EIIVPT DTV+YTYLM+L ++   P LFVGPTGTGKS Y+ D LLN ++KD Y P  INFSA TSANQTQNIIMSK+D+RRKGVFGPP+GK+ ++FVDDLNMP RE +GAQPP+ELLRQ+LDH + YDLKDT+ I L+D+QFI AMGPPGGGRN +T RFLRHLN I+IN F D+TM+ IFSSI+ + +    FSP+F    NQ++ A ++VYK AM NLLPTPAKSHY FNLRDFSRVIQG LL    ++E    + RL+ HE++RVY+DRLV D+DR W +  +  +   H N  FD +F  L   +  K+ E D+++L++ D+   D +   + Y EV  +E   + V+  L+EYNQM K  MNLV+F + +EH+SRISR+LKQP  +ALLVGVGGSGRQS+TRLA SMA   LFQ EISK+Y  TEWR+DLK+ +LR +       VFL +D QIK E+FLEDI+++LN GEVPNL+  DEKQE+ E +      +   +  + SP+ L+ FFV R ++ LH+V+A SPIG AFR RLR+FPSL+NCCTIDWFQ WPE+AL  VA  FLE +E+ ++ +   I +CK FHTS   LS+ +  EL RYNY+TPTSYLELI+TF+ L+ +KR  +   K+RY  GL++L  A S+++ M+KEL D QPKL +A  +  K M ++E +S E   + ++V  +E  A  +A  A+A+K+EC+NDLAEA+P LE+AL AL+TL  P+DI+IV+ M +PP GV+LVM AVCV+K +KPDR+ DP+G+GKKI D+WGPSK+LLG+M FL  LK +DKDNIP+P+M+ IR +++TN DF P ++A AS+A EGLCKW+ A+E YDKVAKVVAPKK  L +A        + L++KRA LKEV+D+L  L +  E     K  LE +V+ C++KL RAE+LIGGL GEK  W +AA DL   + NLTGD+L+S+GV+AYLG FTS FR   TK W      K+IP SD FSL  TLG+P+EIR+WNI GLP D FSI+NG+I+ NSRR PLMIDPQGQANKW+KN+EK NNL VIKLTD D++R LENCIQFGTP+LLEN+GEELDP LEPLLLKQTFKQG    IKLG+ +IEYS DFRFY+TT+L+NPHYLPE + KV+LLNFMITPEGL+DQLLGIVV++E PELEEE+  LI QSANNK++LKE+ED IL  L +S+GNILEDESAI++L+S+K +SNEI +KQ     E+TE KI E+R GY  +A HS+ILFFSIADL NIDPMYQYSL WF+NL+  SI +  KS+ L+QRL+ LK +FTY+LYCNVCRSLFEKDKLLFSF+LC N+L     I+  +  FLLTGG+GL N   NP  +WL  KSWDE+CR  +L  F G+ + FI+  + +K IYDS EP +  LP  W E+L D   KM + RCLRPD +V A+  FV   +GKK+++PP FDL  SF DSN T PL+F+LSPGADPM ALLKFA D+   G +F+S+SLGQGQGPIA KMI   ++ G+WV LQNCHLA SWM  LEK  E+ +  T H DFRLWLTSYPS  FPV ILQNGVKMTNE P GLR N+ +SYL+DP+SD  FF G       W+KLLFGLCFFHA+VQER+KFGP+GWNI Y FNE+DL IS++QL  F+++YD V ++A+ YLTGECNYGGRVTDDWDRR L+T L  FYC  + +   Y    SG Y+APP   YE YI++I+ LP++ +P VFG+H+N DI+KD Q+T+LLFDS+LLTQ  G+ GG  S  D+ + +++ ++L  +LPP FD E V+ KYP  YE+SMNTVLVQEM R+N L STI  SLQN+ KA+KGLVVM S+LE V  +++  K+P  W K SYPSLKPLGSY+ DFLARLKFL  W++NG P +FW+SGF+FTQAFLTGV QN+ARKY IPIDLL FD+E+L     +  PEDG YV GLFLDGARWD++  ++ E HP++L D MP+IW+KP KK+ I     Y+ P+YKTSER+GTLSTTGHSTNFVIAM L T K  +HWI RGVA+L QLDD
Sbjct:   39 MDCKSLQNKLVLECKRKEDSVMNTWFPQILKLF---NNEKTPESTGDQKQ-ASFYNCASTLISNQLRSVLHKGIEEFVSVF-DPSR-----QHCL---------------------PIFQMALTFDDEKMEMYPTPRDVEKSVLEILNVITNTFQKVQTVQS-----WLGHASPSFVNAKVTGDYFLWAQSTVKSAVLKNMEGPGKHFQSYDSYSWLVNGTAQTQVDTFLKE---EHSFEEYTKKVETFHNLAKEISSLPPK-VYFTMVQLDCEELKQGLTNKAK-IC-------------------SEFEAIKQKVLDIPKNTEEIAQMEKYIDFTKKNIVPELNNEVKEANSHIIYLLETHVAKSEDIKLNSTVYLWPHNILLAFEQSEEVLQSSRQKEEKELIARRERLTVQLEKLEHNIKTFPLYSELGLIQEYIADVRTTGKRLQEAEENIVGINKEEAFYKWEITCYPEVKAMKEQMEPYQKVFECILKWQHTESINLTFHTLLKRWMDGSFLDLNGETMETQVDEFYREIYKMLKFFQQKQSKAAQEVAKTYGKAEGQPDEKNSSKQECPTVNLCSIVIEQIQKFKDYIPVVSILCNPGLRGRHWEKMSQIAGFDLTPNFGTSLRKLLQLKLEPFLEEFETISVAASKEFSLEKAMQTMTQVWDGVSFHHQPHKDTGVSIFTALDDIQMMLDDQIVKTQTMMGSPFVKPFQSEMKQWEERLLHIQESIDEWLKLQAQWLYLEPIFSSQDIMQQIPEEGRLFQTVDRNWREIMGHCVKDSKVLQATSLPGLLERLQDSNALLEKIMKGLNAYLEKKRLFFP-----------------------------------------------MYSSEGERVELIQNISTSEANGAVEKWLLQLEDGMISSVR-DIIDRSRAYEKTARNQWVKEWPGQVVLCTSQIFWTLEVHKAL-----GLKKYYQQLQNQLNEIVELVRGELPKQTRTTLGALVTIDVHARDVVKDLI-EKVSDETDFEWLAQLRYYWMNDNVRVHIINCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFHLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQVLCIQRAIMHKLEYFDFEGTMLKLNPNCFVSITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSAKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLLAAGNLKLKFPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGVSLPVADYKLFLEAAEECCKIHNVQPTKVFTDKLIQTYEMMIVRH-FMLVGESFAGKTKVLHVLADTLSLMNERGHGEEEKVIFRTLNPKSITMGQLFGQFDLVSHEWTDGVVANTFREFALAETPDRKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSNQMSLIFEANDLSQASPATVSRCGMIYMEPSQLGWKPLVISWINTLPDPLQSPDNRSLILDLFHWLIPPSLQML-RRHCREVVPTTNSHTVVALCRLFKMIL----DEPVKTGPDDESIRTWIMAAFASSLVWSVGGCCDTDSREKFNDFIRQTVSGKNKE---------HPIPETIERWECPINEKGLVYDYFYEFKEK----GRWIHWNDTIENINLGEINTKGQEIIVPTIDTVRYTYLMDLCISQG-PLLFVGPTGTGKSVYVKDKLLNNLDKDCYLPFFINFSAHTSANQTQNIIMSKMDKRRKGVFGPPLGKRYVLFVDDLNMPAREQFGAQPPVELLRQFLDHGH-YDLKDTSKISLVDVQFIAAMGPPGGGRNAVTSRFLRHLNIISINPFSDDTMVHIFSSIVAFSMKKNLFSPEFVIVGNQIVTAMMEVYKKAMANLLPTPAKSHYTFNLRDFSRVIQGCLLLKKGSLEGKQTLIRLFVHEVYRVYHDRLVDDEDRTWLYQLMNSIVKDHFNVPFDQVFGQL--KQGDKLEEKDMQNLLFGDYMNPDLEGDERLYTEVPSIETFAEVVKSCLEEYNQMHKNRMNLVIF-YLLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATSMAHMTLFQPEISKNYGMTEWRDDLKQMLLRNAGVKGQKTVFLITDTQIKDEAFLEDIDSVLNTGEVPNLFAVDEKQEIIETI--RPIAQAGKKSVELSPLTLFAFFVARCKENLHVVVAFSPIGKAFRKRLRQFPSLINCCTIDWFQPWPEEALERVANSFLESLEMSENERQEVITICKTFHTSANQLSD-FQAELGRYNYITPTSYLELIATFQQLISQKRETIMNAKQRYINGLDQLAFAESEVAKMKKELVDLQPKLEQAKIDNTKMMEVIEVESIEVEAKSRVVHVDEEAAAMKANEAQALKSECENDLAEALPALEAALTALDTLKQPSDISIVKAMKNPPSGVKLVMAAVCVMKNVKPDRIPDPAGTGKKILDYWGPSKKLLGDMNFLRDLKEYDKDNIPVPVMQTIRNEFMTNPDFDPSKVANASSAAEGLCKWITAMEVYDKVAKVVAPKKAKLAEAQESLAATKAVLDQKRAELKEVEDRLTALQKTFEEKTEEKARLEMQVESCARKLERAEKLIGGLSGEK-IWSKAADDLQNTYDNLTGDVLISAGVIAYLGPFTSGFRQNCTKLWTTLCQSKNIPSSDDFSLSKTLGNPIEIRAWNIAGLPNDSFSIDNGVIVRNSRR-PLMIDPQGQANKWVKNLEKDNNLNVIKLTDGDYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQTFKQGVE-SIKLGERVIEYSADFRFYVTTRLKNPHYLPEVATKVSLLNFMITPEGLEDQLLGIVVAKE-PELEEERTALILQSANNKRQLKEIEDSILETLQSSKGNILEDESAIQILDSAKIMSNEITKKQQIQIAEKTELKIAESREGYREVAKHSSILFFSIADLTNIDPMYQYSLIWFVNLYINSIQDI-KSKVLKQRLEYLKDHFTYNLYCNVCRSLFEKDKLLFSFLLCCNLLARKE-IEHSDLMFLLTGGIGLQNTVANPDPSWLQDKSWDEICRASELPGFQGL-EAFIKNPEDFKLIYDSREPCSIDLPAPWCEKLTD-LQKMIIFRCLRPD-MVPAVTKFVTRNLGKKFVQPPAFDLTKSFLDSNSTIPLVFVLSPGADPM-ALLKFASDKKMDGSRFQSISLGQGQGPIAAKMIFTAMQNGSWVCLQNCHLAVSWMSNLEKICEDFSLTTCHQDFRLWLTSYPSPKFPVGILQNGVKMTNEQPTGLRLNLLQSYLTDPVSDPNFFNGCPDKKPVWEKLLFGLCFFHALVQERKKFGPLGWNIPYGFNESDLHISMRQLQQFVNEYDKVPFEAITYLTGECNYGGRVTDDWDRRLLMTTLADFYCEDIIKTFRYPLSPSGKYFAPPKSSYEDYIQFIENLPISQQPEVFGLHENVDISKDLQQTKLLFDSLLLTQGGGAMGGVSSGGDNTLYDIANNILTQQLPPTFDREAVLLKYPVLYEESMNTVLVQEMERYN-LCSTICVSLQNLLKALKGLVVMDSELEAVAGNLIVGKVPEKWAKFSYPSLKPLGSYITDFLARLKFLQVWYENGQPKVFWLSGFFFTQAFLTGVMQNFARKYQIPIDLLTFDFEVLPIDKSETPPEDGVYVNGLFLDGARWDKE-GVLTEQHPRILFDSMPIIWVKPEKKNMIQTDSLYVCPLYKTSERKGTLSTTGHSTNFVIAMMLSTKKRPQHWIKRGVAMLLQLDD 3682          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 1798.48 bits (4657), Expect = 0.000e+0
Identity = 1144/3347 (34.18%), Postives = 1789/3347 (53.45%), Query Frame = 3
Query: 2265 FGWDVTTYP----VRQEVQNVLRPYLKLYETAVEFNGKYKD--WMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNE-EGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFIL--SSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVL-TVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETL--DITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGL--VDYKATPRKEWVKKWFGQ-GVLAISMYYWTIYVQDAIKEGPEALDAYLKVNN---SQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENN--MITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMF-EGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACI--XXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWS----ELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDL-KDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQ-NFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFK------HLDFDED-----GKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYN-QMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQS--LKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTM--IIVEQQSTEASKQE--KIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVL--KGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLD--NPHENPSAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFES--LSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDL------SAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDS---VQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQAR-GSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYAR-KYTIPIDLLHFDYEILDDRNYD--EAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQL 12107
            FG  VT +P    +R E+  +L+    LY   +E    Y D  W   ++EK+  + +D       R L +  K+++     K+   +            PL++ +    +  RHW++I+++ G+ L  E E   L  +++ +   +  + E I  +A KE ++E+ ++++  EW    F    ++  G  +L   S  ++   L+D ++   ++  + +  PF+A+I+ W   L    DI++ W+ VQ  W+YLE +F   DI  Q+P+E + F+S+DK+W +IM +      V+ + +    M   L    E L+S  K L  YLEKKRL FPRFFF+S+  LLEIL +  D   +Q HL   F+ I S+ F E +   I  + S E E + L   I+   A G VE WL  L  +   S+ L I +    +  +     +++  +  Q G+L I M  WT   ++A+           K N    + ++ ++ +    L    RT  + LI + VH RD+  +L +  + N +DF WL Q R+Y+ E++  M   + +    Y  E+LG T RLVITPLTDRCY TL  AL + +GGAP GPAGTGKTET KD+ + + K  VVFNCSD +D+  LG+ FKGLA  G+W CFDEFNRI+L VLSV AQQI  +      +  T +F +G  + ++P   +F+TMNPGYAGR ELP+NLK  FRSV+MMVPD  +I  + L SCGF++   LA K    Y+LC EQLS Q HYD+G+R + SVL   G  K   P + E  ++ R + D+NL K ++ D  LF  +  DLFPG+      Y  L   I +   +  L +   +  K+ Q+YE   VRHG M +G    GKT+  ++L  A+ + C Q   E        +NPKAIT  Q++G+ D  +++W+DG+ +  +R    +   +  W++ DGPVDAIWIEN+N+VLDDN+ L L +G+ I ++P+  ++FEP +++ ASPATVSR GMV+M  + LGW PI   WLK   P   ++ +++++  F       +  +  K    +       IN+++ L+ L          + +  ++ +      LE ++ FA  WS GA    E RK  +   R            I+ +L E +PP  ++         T++DY   AE      G W HWS    E +   D      K++ I+VP  D V+  +L++ +    K  L +G  GT K+  +  F +++ + +I     +NFS+ T+    Q  + S +D+R    +GPP GKK+ + +DD+NMP+   +G Q   E++RQ ++   +Y+L K      ++D+QF+ AM  PGGGRN I  R  R  +        + ++  IF  I   H   Q  F  + + ++ QL+  T  +++     +LPTPAK HY+FNLRD SR+ QG+L +    I     +  LW HE  RV  DR     D EWF   + ++  + L E+   +         +DF  D     G+  E+        DF   K     Y  +   E L+  +  +L +YN  +    M++V F+ A+ H+ ++SRI++ P  +ALLVGVGGSG+QSLTRLA+ +A Y +FQ+ +++ Y +T   EDLK + R +        F+++DN+IK+ESFLE +NN+L++GEV NL+  +E  E+   +  + ++    R        LY++F+ RVR  LH+VL  SP+G+ FRNR  KFP+L++ CT+DWF  WP+DAL  V+  FL   ++D S  +K   +     F          Y L   R  +VTP SYL  I  +K +  +KR EV         GL+KL+ A+  ++ + KEL   + +L  A+++ D  +  + V+ +++E  K E  K+    +AI  D   A +AI  E    L  A P LE A  AL+T+ P+DI  VRT+  PP  +   M+ V +L  + + P  +N  +     I   W  S  L+    FL  LK F KD I    ++++ + Y    ++  ER   AS+   GL  W  A+  +  + K V P K  L    N    A   L K +A L   Q +L V+  E E     K+ L      C +K+  A  LI GL GEK+RW + + +   +   L GD+LL++  ++Y G F   FR+    +W  ++ ++SIP  +   +   L D   +  WN+ GLP DE SI NGII++ + R+PL+IDPQ Q   WIKN E KN LQ+  L    F   LE  +  G P+L+E++GEELDP+L+ +L K   K G +  +K+GD  ++    F+ Y+TTKL NP Y PE S + ++++F +T  GL+DQLLG V+  E+ E+E+E+  L++    NK+K+KELED +L  L++++G++++DES I VL ++K+ + E+ +K     +T+ +I+ AR  Y P+A   +IL+F I +++ ++ MYQ SLT F+ LF+LS+  S KS N  +R++++  Y T+ +Y    R L+E+ K LF+ +L   I      +   E+  L+ GG  LD     + P+ W+   SW  L  L  L  F  I  +    +  WK  +D   P  + LP+ +     D F ++ ++RC  PD+ ++  + ++ + +G+KY E    D+ G++ +SN  +PL+  LS G+DP  +++           K E+  +S+GQGQ   A K++Q+ +  G W LLQNCHL  ++M  L  TV E   E  +  FRLW+T+     FP+ +LQ  +K TNEPP+GL+  + R+Y           G ++DL      + WK +L+ + F H+ VQERRKFGP+GWNI YEFN+ D   +VQ +   +D  D+   V ++ +QY+ GE  YGGRVTDD+D+R L T  + ++   + E  D+ F     Y  P     + Y+ YI+ LP    P VFG+H NADIT  +++ + + D+IL  Q +  SSGGG++ +  V  ++ D+L +LPP++    V R       + MN  L QE+ R   ++  +RS+L +++ AI G ++MS +L + +  M  ++IP  WM KS+ S   LG +  + L R +    W   G P  FW++GF+  Q FLT ++Q  AR      +D +    E+      D    P  G YV GL+L+GA WDR    + ES PKVL + MPVIW+   + + + +   Y  P+YK   R           N + ++ L T +P EHW++RGVALLC +
Sbjct:  889 FGITVTQHPQLMKIRTEL-TLLQKLYGLYNNVIETVNGYYDILWTNINIEKINNELLD--FQTRCRKLPQALKEWQAFLDLKRTIDEFSEC-------CPLLELMTSKAMMARHWKRITEVTGHNLDVESENFKLRNIMEADPLKYKEEIEDICISAVKERDIEQKLKEVITEWDNKTFTFAGFKNRGELLLRGDSTSELIASLEDSLMVLGSLMSNRYNTPFKAQIQKWVQYLSNTSDIIEHWMIVQNLWIYLEAVFVGGDIAKQLPKEAKLFSSIDKSWMKIMTRAHEMPNVVQSCVGDVTMGQLLPHLLEQLDSCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVQFHEKIYDRILAVSSREKETMELDRPIT---AEGNVEVWLNALLKESQRSLHLVIRQAALAIQNEGFELIDFLNSFSAQVGLLGIQMI-WTRDSEEALTNAHYDRGIMSKTNQHFLNLLNTLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIDNPSDFEWLKQCRFYFNEDSDKMTINITDVSFDYQNEFLGCTERLVITPLTDRCYITLAQALGMCMGGAPAGPAGTGKTETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTE-CGQPHREMR------MNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNEAEVLRQLFSSSFSELYRFSVQSLEFKMDMLEAFVIMQCINMLQGLIPL----------KEQCGELPREH----LERLYIFALMWSAGALLELEDRKKMELWFR--------GNDVIRRSLPE-IPPGREE---------TMFDYYVTAE------GHWVHWSTRVEEYIYPPDVT---PKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSF-MSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNAEVINSVHVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKVVDCGVERYFVDFLRDPPEATGEEPEES-------DFDMPKV----YEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRLYNTTNLMEDLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNE--NLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYFLRYRRSTHVTPKSYLSFIQGYKTIYVEKRAEVMN------TGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIV-DSITADKAIAEE---KLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNF---ITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELL-QPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWNLQGLPNDELSIHNGIIVTKAARFPLLIDPQTQGKTWIKNKEAKNELQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGGASLDLKTCPQKPAEWILDMSWLNLVELSKLWQFSEILDQISHHEKLWKSWFDKEAPEEEVLPNSYQSL--DCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKL-----KIETRYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFMDELMDTVIE--TECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTY----------GGINQDLLDVSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFER-DFNFYKG--YGIPKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEVKRLQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWM-KSWAS-STLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYA-ENNVVKDPRLYSCPIYKKPTRT--------DINCIASVGLKTTQPPEHWVLRGVALLCDV 4112          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Medaka
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:NCBI gene;Acc:101170214])

HSP 1 Score: 1581.23 bits (4093), Expect = 0.000e+0
Identity = 1076/3399 (31.66%), Postives = 1736/3399 (51.07%), Query Frame = 3
Query: 2079 NLKFKRERF----IEELDSYRKQVEEFQ---NLGDMNEINKYLKKSQVL---DTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTL-RNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVF----TETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPE----ALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVE--NNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAA--LGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXE-LSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDA-KFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLI-DLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPN----TIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELE-SNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKT-KQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNL-QVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSAWLPPKSWDELCRLDDL--SVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEEL-NPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFI----DQYDS-VQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFD-----------DSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDW-FDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPE--DGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLD 12110
            +LK  RE F    +EE++++++ +  F    N      +   L+K  ++   + +L   + + E   K  +     +  YP    +Q  L    ++Y            W +      +   +   +  +  +L +L K  +  P+    A  + + ++EF+  + L+  L    LRD HW ++ +  G +   N +   L  L  + L  +    + I  +A KE ++E   ++ K    P     +   +   F+L +VD+I + LD+ ++K Q M GS F  PF   I+ WE  L L  + ++ WL+VQ  W+ LE IF   DI +Q+PEE +K   + K + EIMK    +  +     +   L  L      LE I K L  +L+ KR  FPRFF +S+DELL +L    DP  +Q H+ K ++ I SL      +    +  M S+E E++  +  +       +VE W++ +  +M  + RL   E +  Y      +W++ +    VLA +  +WT  V++AIK   +    AL  Y +  + QIDE+V  +     + +R  +  ++V DVHARD++ N +   +   +DF W  QLR+YWV+  +++  +  N+ L YGYEY+G   RL ITPLT R Y TL  AL ++LGGA  GPAG GKTET KDLAKA+   CVV +C++ +D I LGK   GLA CG W CFDEFNRI   VLSVV+ QI  I+ A+ +      FEG ++ LD    ++ITMNP Y  R ELP+++K  FR V ++ PD   I EI L+S GF+ A+ LA K+   Y+    QLS QPHYD+G+ + KSVL  AG +K    +  ED++++R++ D+NLPK ++ D+P+F G+ SD+FPG++     +    + ++E   K N       ++K+ QIYE+M+ +   MIVG+  GGK+     L  A  LG +C          +   LNPKA ++ +LYG FDP + +W+DG+ +  +R    ST    ++++FDG VD+ W+ENMN+VLDDNK L L +G+ I+L     L+FE  DL+ ASPATVSRC +V+++P  L + P +  W+K                +FE+++ +   CI      E + P +D+N+V  L  ++D  +++ N  A++           LE  F  A   S+GAT  E GR  FDKL + L     +++ +                 G  P+  T+YD+ F  E QE    KW  WS LV   + I   A KF +I+ PT DT +  +++  ++   +P L VG  GT K+  II  LL   + D      INFS++T++   Q  + + +++R K  +GPP+GKK++VF DD+NMP  + +G Q P+ LLR  LD    YD K   + K I DL +I AM   GGGRN + PRFL   +   I     E++  I++SI+  H  T+ F    +     + + TL ++ + +T+L PTP+K HY F+ R+ SR+  G+ L+ P+    T+E+     R+W +E  R ++DRL  + D+     +I+++  ++   D + +        D +   ++    +Y D  D   S   +                               LF  A+EH++R+ RIL+  R HALL+G  GS  Q+LT+LAA  AD ++F++ + + Y    +R DLK +  K    +   VFLF+D  I +E FLE INN+L    VP L+  DEK+ + +++     Q         S  +++ +F+++  + LHIVL +S  GDA + R R FP + N   IDW+  W   AL AVA   LE+  + ++     ID   M H S    S++ LL+  R NY T  S+L+ IS++  LL++K   V  Q +  E  L +L+ A   I  +  +L              D+ +++ ++ +T  +  E+I K +                                            TI  +   PPK V++V E + VL+G K              E  W  +K+++ E  FL  L   D D+I    +  I  K+L N     E +   S A  G+ K+V +   Y  +AK V PKK  +++   E+  + + L   +  L  +Q +   L E+ E +N  +++ L ++  L  ++L  A++L+ GL  E++ W +   +L  +   L GD L+++  ++Y GAF   FR      +W  DV +K IP S  F +   L + +EI SW   GLP DE S++NGI+ +   R+PL IDPQ QA  WIKN EK NNL QV  L D DF++ LE  I++G P LL+++ E++DP++  +L +      G   I LGD  + Y  +F+ ++ T L NP Y P    K  ++N+  T  GL+DQLL +         +++   L+++ + NK  LK L D +L  L TS GN+L++   I+ L  +K  ++E  +K +  +    +    R GY P+A    +LFF+++D+A ++ MYQYSLT +++LF LS+  S    NLQQRL+N+ +  TY    NV   LF K KLLFS  +   I + +  + + E  FL+    G     + P  W+P ++W ++ +L +L    F  +     +   +WK  +D   P     P +++E L  +F K+ +LRCLR D++  A+ ++V   +G   + PP  +    +  S   SP++FI+S G+DP   L+KFA+     G KF  +++GQGQ  + +K++++ +  G+W++LQNCHL   W+  LEK +E++ NP     +FR+W+T+     FP+ ILQ   K+  EPP+ ++ N+  +Y    IS      +S    A+  L++ L FFHA+VQER K+G  GW++   FN++D   S++ L  ++    +Q DS + +++LQYL GE  YGGR  D +DRR L   + +++        D+ F            D G+   PP   +  Y E I+ +PL   P V G+    +I    Q  + ++  + + Q     G G   D+ +  ++ D+  +LP  FD  +V  +  T    + + VL+QE+ RFN L+  ++ S+  + +A+ G V MS + +++  +     +P MW + +  +LK L  +++    R +  S+W    G P + W+SG +  +++L  V Q   RK   P+D   F  E+   R  D+  +     Y+ GLFL+GA WD +   +  S PKVL   +P++ + P++K+ +  + +  +P+Y TS RR            V    L T     HW++ GV L    D
Sbjct: 1004 SLKDVRETFSKIKMEEMEAFKQDLSIFAESFNTHGPGTVGNDLEKLNIIGKFEKELSKIMAKQEHLTKTAKLLDLQLAEYPEIISIQKYLSGLSQIYNIYKAHKEAKTKWSQTLWVNFDIKLLQDGIDGFIESLMQLSKDVQTLPV----AFFLDSHLKEFRVSLSLLLDLKNTALRD-HWNKLMERTGKSFDMNLQRFTLETLFSLELHKYANDIDEIVTSALKELSIEMTWKRTKFNMQPQ----LKVNQERVFLLGAVDNILVNLDNDVMKLQCMAGSRFGGPFLDAIQQWEKNLTLFSETIEIWLQVQHKWMNLENIFCGEDICSQLPEEAKKLKKITKKFTEIMKSTENEPNIKKCCTVPGRLSSLWVLRNDLERIQKNLANHLDSKRNEFPRFFLISDDELLNVLGSV-DPACIQEHVIKMYDNIESLRLGVDSSGQTVVGAMVSNEGEVMEFRKPVPL---EARVEDWIMAVLQEMKRTSRLITKEAVYHYV-----DWIRSYQCMMVLAANRVWWTWEVENAIKNVNKGDKYALKKYAEQIHRQIDELVTCLGRPTKESDRLKISNVLVTDVHARDIVDNFVGRSIKEVHDFEWESQLRFYWVKEHDSLFVRQCNTSLSYGYEYMGLNGRLAITPLTSRIYLTLTQALSMYLGGALAGPAGAGKTETVKDLAKALGLFCVVTHCTEDMDTITLGKIISGLAKCGFWGCFDEFNRIGASVLSVVSSQIQAIRNALTSHFKMFQFEGQQISLDDHMGIYITMNPSYERRPELPESVKVFFRPVVVVTPDVQQICEIMLFSQGFLQAKELAKKMTVLYKTAGIQLSKQPHYDFGLHSQKSVLKMAGKMKRDSLELSEDVVLMRALRDINLPKLVSEDVPVFLGLISDIFPGLDSSRVGFPSFRETVEEILQKSNYTILPDQVDKVVQIYEIMLTQQATMIVGQTCGGKSVVINTLCQAQTLG-LC---------TKLYPLNPKATSVDELYGSFDPETRDWTDGIFSKLFREINQSTDKKERYILFDGDVDSQWLENMNSVLDDNKLLTLANGDRIRLQSHCALLFEVGDLQHASPATVSRCAVVFIDPKHLSYTPYWQRWMK-----------NRLNRLFEKYVPS---CIDVTLNSETIVPRTDVNMVSQLCLMLDVLLESKNSSAEV-----------LECYFLEALYCSLGATLVESGRLKFDKLVKSLSCLSTVDDEKAAAG------------PGEIPYLPTLYDFHF-DETQE----KWVPWSSLVP--EYIHNPAMKFADIL-PTVDTTRTHWILEQMVKIKRPVLLVGECGTSKTA-IIQNLLKNTSTDSSISLTINFSSKTTSLDLQRNLEANIEKRTKDTYGPPIGKKLLVFFDDINMPKVDDFGTQQPVALLRLLLDQGGLYDRKQKLSFKTIKDLGYIAAMRKTGGGRNEVDPRFLSLFSVFNIPPPATESLHLIYASIIKGH--TRPFKAAIQEVCQTITECTLKLFTTIITDLPPTPSKFHYTFSQRELSRIYCGLTLTKPDFSCLTVEQ---FVRVWRNECLRNFHDRLTDETDKALVHGHIKKLVEEYFETDSEAVLADPILFGDYRAAREECEQRVYEDIGDYDVSKAIF------------------------------QLFEDAVEHLTRVHRILRSDRGHALLIGADGSWTQALTKLAAFTADCEVFEIILRRGYNELNFRNDLKTLYLKLGIENRRTVFLFTDAHIVEEGFLEQINNML-ISMVPTLFADDEKESIIKQINSEALQEG----AGSSKESVWQYFLRKSANNLHIVLCLSATGDALKTRCRNFPLMSNT-VIDWYLPWSAQALHAVAQCVLENPTIPKAHFGAVIDHICMVHASLCDFSKQLLLKHQRCNYATSKSFLDFISSYSTLLEEKNEHVL-QCKCLEGSLNRLREAREQIDELNLKL-------------ADQKVVLAKKTATCTAFLEEIDKNQ--------------------------------------------TI--SFAKPPKQVQVVCECILVLRGKK--------------ELNWLTAKKMMSEAGFLHSLMQMDCDSISNSHISTI--KFLKNLQTSVEEMQSISKAGSGILKFVESFMSYWDIAKEVQPKKDQVKRLEKEFLQSKAELECIKNDLNNMQKEASSLKEKYEDANLEKELQL-DEAKLMERRLTAADKLVLGLTSERE-WTKDLEELKQQHECLLGDCLIAAAFLSYAGAFNWDFRNNMVYDKWTQDVKQKGIPLSQPFKIENFLTNQLEI-SWGSEGLPPDEQSVQNGILTTKGSRFPLCIDPQQQALNWIKNKEKDNNLKQVSSLNDPDFLKQLELSIKYGYPFLLQDVNEDIDPIIINVLERNVVVSEGRTVIVLGDKEVNYDPNFKLFLHTTLANPQYSPSVFEKALVINYS-TLRGLEDQLLSVTTGFLEKVFQQQHLLLVEEISENKTLLKSLGDSLLMELGTSTGNMLDNTELIQTLEKTKTEASETIKKLSVAQSKTVEFANLREGYRPVAKRGAVLFFALSDMALVNRMYQYSLTSYLSLFELSLQESLAHPNLQQRLENIINTLTY----NVHNYLFGKHKLLFSMNMTVKIEQTEGGVPQKELDFLIKNLSGDGTKVQKPHEWIPDQAWQDITKLAELFPEQFSSLPSDIEQNSTNWKSWWDLRAPEQAPFPLQYSESL-SAFQKLLLLRCLRADRLHRAMADYVTVTMG-NCVHPPLINFTTIYERSTAFSPIVFIMSSGSDPTTDLIKFAEK---SGTKFTLIAVGQGQEQVVLKLLEKAVSIGSWLILQNCHLLVKWLKDLEKALEKITNPNI---NFRMWITTNAIDDFPIGILQKSQKVVAEPPEDIKLNMKATY--SKISQQTL--SSCQHPAFCSLVYVLAFFHAVVQERSKYGKTGWSVPCNFNDSDFSASLEVLSTYLTKCHEQGDSFIPWESLQYLIGEVVYGGRAIDSFDRRILKVYMDEYF-------GDFLFSPFQHFHFFRNKDVGYKIPPPGRKH-VYTE-IEKMPLITTPEVAGLPSTVEIGYYTQAVEEMWTHLRVLQPETQVGRGIGGDEHISHIAQDIQKQLPELFDINLVGEELGTDLSPT-SVVLLQELRRFNKLVLCMQQSVVELLRALTGEVGMSKESDDLAHAFCNDLVPAMWKRLAPETLKSLDDWMSHLRRRYEQYSNWQVREGEPKVMWLSGLHVPESYLAAVVQAACRKKGWPLDQSTFHTEVTRYRTEDDIDDRLKQCYLSGLFLEGADWDMENGCLARSKPKVLVVELPILKVIPVQKNSLRLRNTLRTPVYTTSLRRN-----ASGAGLVFEADLFTTMHTSHWVLSGVCLYLNSD 4176          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 1574.3 bits (4075), Expect = 0.000e+0
Identity = 980/2776 (35.30%), Postives = 1503/2776 (54.14%), Query Frame = 3
Query: 3939 TPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMF-EGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWS----ELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDL-KDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQ-NFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLL---SLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFK------HLDFDED-----GKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYN-QMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQS--LKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTM--IIVEQQSTEASKQE-KIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVL--KGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLD--NPHENPSAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFES--LSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDL------SAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDS---VQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQAR-GSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYAR-KYTIPIDLLHFDYEILDDRNYD--EAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWL------KPMKKSEIPNKPS-YLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQL 12107
            T L   CY TL  AL + +GGAP GPAGTGKTET KD+ + + K  VVFNCSD +D+  LG+ FKGLA  G+W CFDEFNRI+L VLSV AQQI  +      +  T +F +G  + ++P   +F+TMNPGYAGR ELP+NLK  FRSV+MMVPD  +I  + L SCGF++   LA K    Y+LC EQLS Q HYD+G+R + SVL   G  K   P + E  ++ R + D+NL K ++ D  LF  +  DLFPG+      Y  L   I +   +  L +   +  K+ Q+YE   VRHG M +G    GKT+  ++L  A+ + C Q   E        +NPKAIT  Q++G+ D  +++W+DG+ +  +R    +   +  W++ DGPVDAIWIEN+N+VLDDN+ L L +G+ I ++P+  ++FEP +++ ASPATVSR GMV+M  + LGW PI   WLK   P   ++ +++++  F       +  ++      L     +  +  L  LI  ++       K++Q         LE ++ FA  WS GA    E RK  +   R            I+ +L E +PP  ++         T++DY   AE      G W HWS    E +   D      K++ I+VP  D V+  +L++ +    K  L +G  GT K+  +  F+ ++ + +I     +NFS+ T+    Q  + S +D+R    +GPP GKK+ + +DD+NMP+   +G Q   E++RQ ++   +Y+L K      ++D+QF+ AM  PGGGRN I  R  R  +        + ++  IF  I   H   Q  F  + + ++ QL+  T  +++     +LPTPAK HY+FNLRD SR+ QG+L    S  N I +   +  LW HE  RV  DR     D EWF   + ++  + L E+   +         +DF  D     G+  E+        DF   K     Y  +   E L+  +  +L +YN  +    M++V F+ A+ H+ ++SRI++ P  +ALLVGVGGSG+QSLTRLA+ +A Y +FQ+ +++S         LK + R +        F+++DN+IK+ESFLE +NN+L++GEV NL+  +E  E+   +  + ++    R        LY++F+ RVR  LH+VL  SP+G+ FRNR  KFP+L++ CT+DWF  WP+DAL  V+  FL   ++D S  +K   +     F          Y L   R  +VTP SYL  I  +K +  +KR EVQ    R   GL+KL+ A+  ++ + KEL   + +L  A+++ D  +  + V+ +++E  K E + VK +     D   A +AI  E    L  A P LE A  AL+T+ P+DI  VRT+  PP  +   M+ V +L  + + P  +N  +     I   W  S  L+    FL  LK F KD I    ++++ + Y    ++  ER   AS+   GL  W  A+  +  + K V P K  L    N    A   L K +A L   Q +L V+  E E     K+ L      C +K+  A  LI GL GEK+RW + + +   +   L GD+LL++  ++Y G F   FR+    +W  ++ ++SIP  +   +   L D   +  WN+ GLP DE SI NGII++ + R+PL+IDPQ Q   WIKN E KN LQ+  L    F   LE  +  G P+L+E++GEELDP+L+ +L K   K G +  +K+GD  ++    F+ Y+TTKL NP Y PE S + ++++F +T  GL+DQLLG V+  E+ E+E+E+  L++    NK+K+KELED +L  L++++G++++DES I VL ++K+ + E+ +K     +T+ +I+ AR  Y P+A   +IL+F I +++ ++ MYQ SLT F+ LF+LS+  S KS N  +R++++  Y T+ +Y    R L+E+ K LF+ +L   I      +   E+  L+ GG  LD     + P+ W+   SW  L  L  L  F  I  +    +  WK  +D   P  + LP+ +     D F ++ ++RC  PD+ ++  + ++ + +G+KY E    D+ G++ +SN  +PL+  LS G+DP  +++           K E+  +S+GQGQ   A K++Q+ +  G W LLQNCHL  ++M  L  TV E   E  +  FRLW+T+     FP+ +LQ  +K TNEPP+GL+  + R+Y           G ++DL      + WK +L+ + F H+ VQERRKFGP+GWNI YEFN+ D   +VQ +   +D  D+   V ++ +QY+ GE  YGGRVTDD+D+R L T  + ++   + E  D+ F     Y  P     + Y+ YI+ LP    P VFG+H NADIT  +++ + + D+IL  Q +  SSGGG++ +  V  ++ D+L +LPP++    V R       + MN  L QE+ R   ++  +RS+L +++ AI G ++MS +L + +  M  ++IP  WMK+S+ S   LG +  + L R +    W   G P  FW++GF+  Q FLT ++Q  AR      +D +    E+      D    P  G YV GL+L+GA WDR    + ES PKVL + MPVIW+         KK +I   P  Y  P+YK   R           N + ++ L T +P EHW++RGVALLC +
Sbjct:   13 TYLMTWCYITLAQALGMCMGGAPAGPAGTGKTETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTE-CGQPHREMR------MNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNEAEVLRQLFSSSFSELYRFSVQSLEFKMDM-LEAFVIMQCINMLQGLIPLKV-----RLKLNQH--------LERLYIFALMWSAGALLELEDRKKMELWFRG--------NDVIRRSLPE-IPPGREE---------TMFDYYVTAE------GHWVHWSTRVEEYIYPPDVT---PKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFM-SKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNHSSRNIIFQV--LLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKVVDCGVERYFVDFLRDPPEATGEEPEES-------DFDMPKV----YEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRSGLLEGLIAYLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNE--NLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYFLRYRRSTHVTPKSYLSFIQGYKTIYVEKRAEVQMLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEE---KLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNF---ITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELL-QPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWNLQGLPNDELSIHNGIIVTKAARFPLLIDPQTQGKTWIKNKEAKNELQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGGASLDLKTCPQKPAEWILDMSWLNLVELSKLWQFSEILDQVHHHEKLWKSWFDKEAPEEEVLPNSYQSL--DCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKL-----KIETRYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFMDELMDTVIE--TECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTY----------GGINQDLLDVSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFER-DFNFYKG--YGIPKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEVKRLQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMKESWAS-STLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYAENNGSSEKKKKIVKDPRLYSCPIYKKPTRT--------DINCIASVGLKTTQPPEHWVLRGVALLCDV 2686          
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 1540.78 bits (3988), Expect = 0.000e+0
Identity = 1065/3342 (31.87%), Postives = 1682/3342 (50.33%), Query Frame = 3
Query: 2265 FGWDVTTYP----VRQEVQNVLRPYLKLYETAVEFNGKYKD--WMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFIL--SSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVL-TVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLD-ITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGL--VDYKATPRKEWVKKWFGQ-GVLAISMYYWTIYVQDAIKEGPEALDAYLKVNN---SQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENN--MITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMF-EGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACI--XXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWS----ELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDL-KDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQ-NFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFK------HLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYN-QMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTM--IIVEQQSTEASKQE--KIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVL--KGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGG-VGLDNPHENPSAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDS-WKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDK-IVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFES--LSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDL------SAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDS---VQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQAR-GSSGGGKSTDDIVDEVSADVLNRLPPN---FDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYAR-KYTIPIDLLHFDYEILDDRNYD--EAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQL 12107
            FG  VT +P    +R E+  +L+    LY   +E    Y D  W   ++EK+  + +D      ++T  KL +  +      +    +K  ++EF E  PL++ +    +  RHW++I+          E +C+S                    A KE ++E+ ++++  EW    F    ++  G  +L   S  ++   L+D ++   ++  S +  PF+A+I+ W   L    DI++ W+ VQ  W+YLE +F   DI  Q+P+E + F+S+DK+W +IM +      V+ + +    M   L    E L+S  K L  YLEKKRL FPRFFF+S+  LLEIL +  D   +Q HL   F+ I S+ F E  D I  + S E E + L   I+   A G VE WL  L  +   S+ L I +    +  +     +++  +  Q G+L I M  WT   ++A+           K N    + ++ ++ +    L    RT  + LI + VH RD+  +L +  + N +DF WL Q R+Y+ E++  M   + +    Y  E+LG T RLVITPLTD                           ET KD+ + + K  VVFNCSD +D+  LG+ FK LA  G+W CFDEFNRI+L VLSV AQQI  +      +  T +F +G  + ++P   +F+TMNPGYAGR ELP+NLK  FRSV+MMVPD  +I  + L SCGF++   LA K    Y+LC EQLS Q HYD+G+R + SVL   G  K   P + E  ++ R + D+NL K ++ D  LF  +  DLFPG+      Y  L   I +   +  L +   +  K+ Q+YE   VRHG M +G    GKT+  ++L  A+   C Q   E        +NPKAIT  Q++G+ D  +++W+DG+ +  +R        +  W++ DGPVDAIWIEN+N+VLDDN+ L L +G+ I ++P+  ++FEP +++ ASPATVSR GMV+M  + LGW PI   WLK   P   ++ +++++  F       +  +  K    +       IN+++ L+ L          + +  ++ +      LE ++ FA  WS GA    E RK  +   R            I+ +L E +PP  ++         T++DY   AE        W HWS    E +   D      K++ I+VP  D V+  +L++ +    K  L +G  GT K+  +  F +++ + +I     +NFS+ T+    Q  + S +D+R    +GPP GKK+ + +DD+NMP+   +G Q   E++RQ ++   +Y+L K      ++D+QF+ AM  PGGGRN I  R  R  +        + ++  IF  I   H   Q  F  + + ++ QL+  T  +++     +LPTPAK HY+FNLRD SR+ QG+L +    I     +  LW HE  RV  DR     D EWF   + ++  + L E+   +         +DF  D              DF   K     Y  +   E L+  +  +L +YN  +    M++V F+ A+ H+ ++SRI++ P  +ALLVGVGGSG+QSLTRLA+ +A Y +FQ+ ++  Y +T   EDLK + R +        F+++DN+IK+ESFLE +NN+L++GEV NL+  +E  E+   +  + ++    R        LY++F+ RVR  LH+VL  SP+G+ FRNR  KFP+L++ CT+DWF  WP+DAL   +  FL   ++D                S +V SE                 ++ + +F++ + +K  +          GL+KL+ A+  ++ + KEL   + +L  A+++ D  +  + V+ +++E  K E  K+    +AI  D   A +AI  E    L  A P LE A  AL+T+ P+DI  VRT+  PP  +   M+ V +L  + + P  +N  +     I   W  S  L+    FL  LK F KD I    ++++ + Y    ++  ER   AS+   GL  W  A+  +  + K V P K  L    N    A   L K +A L   Q +L V+  E E     K+ L      C +K+  A  LI GL GEK+RW + + +   +   L  D+LL++  ++Y G F   FR+    +W  ++ ++SIP  +   +   L D   +  WN+                                             Q+  L    F   LE  +  G P+L+E++GEELDP+L+ +L K   K G +  +K+GD  ++    F+ Y+TTKL NP Y PE S + ++++F +T  GL+DQLLG V+  E+  L                                    ++DES I VL ++K+ + E+ +K     +T+ +I+ AR  Y P A   +IL+F I +++ ++ MYQ SLT F+ LF+LS+ +S KS N  +R++++  Y T+ +Y    R L+E+ K LF+ +L   I      +   E+  L+ G  + L    + P+ W+   SW  L  L  L  F  I  + I   +  WK  +D   P  + LP+ +     D F ++ ++RC  PD+ I    + ++ + +G+KY E    D+ G++ +SN  +PL+  LS G+DP  +++           K E+  +S+GQGQ   A K++Q+ +  G W LLQNCHL  ++M  L  TV E   E  +  FRLW+T+     FP+ +LQ  +K TNEPP+GL+  + R+Y           G ++DL      + WK +L+ + F H+ VQERRKFGP+GWNI YEFN+ D   +VQ +   +D  D+   V ++ +QY+ GE  YGGRVTDD+D+R L T  + ++   + E  D+ F     Y  P     + Y+ YI+ LP    P VFG+H NADIT  +++ + + D+IL  Q +  SSGGG++ +  V  ++ D+L +LPP+   F+ ++  R       + MN  L QE+ R   ++  +RS+L +++ AI G ++MS +L + +  M  ++IP  WMK+   +   LG +  + L R +    W   G P  FW++GF+  Q FLT ++Q  AR      +D +    E+      D    P  G YV GL+L+GA WDR    + ES PKVL + MPVIW+    ++ + +   Y  P+YK   R           N + ++ L T +P EHW++RGVALLC +
Sbjct: 1117 FGITVTQHPQLMKIRTEL-TLLQKLYGLYNNVIETVNGYYDILWTNINIEKINNELLD------FQTCRKLPQALKEW----QAFLDLKRTIDEFSECCPLLELMTSKAMMARHWKRIT----------EDICIS--------------------AVKERDIEQKLKEVITEWDNKTFTFAGFKNRGELLLRGDSTSELIASLEDSLMVLGSLM-SNYNTPFKAQIQKWVQYLSNTSDIIEHWMIVQNLWIYLEAVFVGGDIAKQLPKEAKLFSSIDKSWMKIMTRAHEMPNVVQSCVGDVTMGQLLPHLLEQLDSCQKSLT-YLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVQFHEKYDRILAVSSREKETMELDRPIT---AEGNVEVWLNALLKESQRSLHLVIRQAALAIQNEGFELIDFLNSFSAQVGLLGIQMI-WTRDSEEALTNAHYDRGIMSKTNQHFLNLLNTLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIDNPSDFEWLKQCRFYFNEDSDKMTINITDVSFDYQNEFLGCTERLVITPLTD---------------------------ETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFK-LAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAM--TCGQPHREMR------MNPKAITAPQMFGRLDVATNDWTDGIFSTLWRK-TLKAKKEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNEAEVLRQLFSSSFSELYRFSVQSLEFKMDMLEAFVIMQCINMLQGLIPL----------KEQCGELPREH----LERLYIFALMWSAGALLELEDRKKMELWFR--------GNDVIRRSLPE-IPPGREE---------TMFDYYVTAE-------HWVHWSTRVEEYIYPPDVT---PKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSF-MSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIF-VIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNAEVINSVHVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKVVDCGVERYFVDFLRDPPEAT---EEPEESDFDMPKV----YEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLT-LYNTTNLMEDLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNE--NLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVE-SHHFLSAFDID---------------CSPQVKSE----------------VVQCMGSFQDCVAEKCVDY-----FMNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIV-DSITADKAIAEE---KLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNF---ITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELL-QPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLV-DVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWNL---------------------------------------------QITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKRSL------------------------------------VDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRP-ATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLASS-KSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGASLDLKTCPQKPAEWILDMSWLNLVELSKLWQFSEILDQQISHHEKLWKSWFDKEAPEEEVLPNSYQSL--DCFRRLLLIRCWCPDRTIAQQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKL-----KIETRYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFMDELMDTVIE--TECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTY-----------GINQDLLDVSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFER-DFNFYKG--YGIPKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEIQVRERLQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMKQESWASSTLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWM--YAENNVKDPRLYSCPIYKKPTRT--------DINCIASVGLKTTQPPEHWVLRGVALLCDV 4158          
BLAST of Dynein heavy chain 7 axonemal vs. Planmine SMEST
Match: SMESG000012956.1 (SMESG000012956.1)

HSP 1 Score: 8052.2 bits (20892), Expect = 0.000e+0
Identity = 4029/4029 (100.00%), Postives = 4029/4029 (100.00%), Query Frame = 3
Query:   27 MTSNSCETTSQKRGRKGPDLTKLLPTIPMKRVKPEWAQNPPSFTLDGKQKINEDAGIELIYELTAKPPTKPRKLKGEDLAFERSQLRKDREKFRKALVDMILQGEDRPIKESIETVRLPPLTQEKTPVGMSATEKDILRYYYYIHNGIDTEHVAKMEXXXXXXXXXXXXXXXXAEHPXXXXXXXXXXXXXXXXSVKKAIVDFVLKEPREKETDDTPIPEHRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD 12113
            MTSNSCETTSQKRGRKGPDLTKLLPTIPMKRVKPEWAQNPPSFTLDGKQKINEDAGIELIYELTAKPPTKPRKLKGEDLAFERSQLRKDREKFRKALVDMILQGEDRPIKESIETVRLPPLTQEKTPVGMSATEKDILRYYYYIHNGIDTEHVAKMEDDWMNNMKNLLDNDLKAEHPELLEDLEDEIKEDYLLSVKKAIVDFVLKEPREKETDDTPIPEHRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDENKKNMEQKKEEFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIATKVKTKVEEFKEHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIKKGGGKELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMRQIDRQRDKIRQTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDKVAKVVAPKKIALEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGEELDPLLEPLLLKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSANNKKKLKELEDEILNVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD
Sbjct:    1 MTSNSCETTSQKRGRKGPDLTKLLPTIPMKRVKPEWAQNPPSFTLDGKQKINEDAGIELIYELTAKPPTKPRKLKGEDLAFERSQLRKDREKFRKALVDMILQGEDRPIKESIETVRLPPLTQEKTPVGMSATEKDILRYYYYIHNGIDTEHVAKMEDDWMNNMKNLLDNDLKAEHPELLEDLEDEIKEDYLLSVKKAIVDFVLKEPREKETDDTPIPEHRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDENKKNMEQKKEEFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIATKVKTKVEEFKEHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIKKGGGKELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMRQIDRQRDKIRQTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDKVAKVVAPKKIALEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGEELDPLLEPLLLKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSANNKKKLKELEDEILNVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD 4029          
BLAST of Dynein heavy chain 7 axonemal vs. Planmine SMEST
Match: SMESG000012956.1 (SMESG000012956.1)

HSP 1 Score: 7997.5 bits (20750), Expect = 0.000e+0
Identity = 4006/4029 (99.43%), Postives = 4006/4029 (99.43%), Query Frame = 3
Query:   27 MTSNSCETTSQKRGRKGPDLTKLLPTIPMKRVKPEWAQNPPSFTLDGKQKINEDAGIELIYELTAKPPTKPRKLKGEDLAFERSQLRKDREKFRKALVDMILQGEDRPIKESIETVRLPPLTQEKTPVGMSATEKDILRYYYYIHNGIDTEHVAKMEXXXXXXXXXXXXXXXXAEHPXXXXXXXXXXXXXXXXSVKKAIVDFVLKEPREKETDDTPIPEHRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD 12113
            MTSNSCETTSQKRGRKGPDLTKLLPTIPMKRVKPEWAQNPPSFTLDGKQKINEDAGIELIYELTAKPPTKPRKLKGEDLAFERSQLRKDREKFRKALVDMILQGEDRPIKESIETVRLPPLTQEKTPVGMSATEKDILRYYYYIHNGIDTEHVAKMEDDWMNNMKNLLDNDLKAEHPELLEDLEDEIKEDYLLSVKKAIVDFVLKEPREKETDDTPIPEHRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPS                       DLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDENKKNMEQKKEEFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIATKVKTKVEEFKEHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIKKGGGKELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMRQIDRQRDKIRQTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDKVAKVVAPKKIALEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGEELDPLLEPLLLKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSANNKKKLKELEDEILNVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD
Sbjct:    1 MTSNSCETTSQKRGRKGPDLTKLLPTIPMKRVKPEWAQNPPSFTLDGKQKINEDAGIELIYELTAKPPTKPRKLKGEDLAFERSQLRKDREKFRKALVDMILQGEDRPIKESIETVRLPPLTQEKTPVGMSATEKDILRYYYYIHNGIDTEHVAKMEDDWMNNMKNLLDNDLKAEHPELLEDLEDEIKEDYLLSVKKAIVDFVLKEPREKETDDTPIPEHRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPS-----------------------DLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDENKKNMEQKKEEFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIATKVKTKVEEFKEHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIKKGGGKELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMRQIDRQRDKIRQTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDKVAKVVAPKKIALEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGEELDPLLEPLLLKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSANNKKKLKELEDEILNVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD 4006          
BLAST of Dynein heavy chain 7 axonemal vs. Planmine SMEST
Match: SMESG000065732.1 (SMESG000065732.1)

HSP 1 Score: 3891.27 bits (10090), Expect = 0.000e+0
Identity = 2038/3894 (52.34%), Postives = 2692/3894 (69.13%), Query Frame = 3
Query:  606 SVKKAIVDFVLKEPREK--ETDD-TPIPEHRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPEIIEKH-----KSTVRNVLIDESVGPTEHIKEFDK--YRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNE--INKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENK-------------------------PIPK-------------KIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAI-TDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPP--LQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDF--SDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENP-SAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFF-GTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPS-YLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD 12113
            S+K+++V   LK+P     E+DD  P PE    L    + W  SF+   +   K L +  P M ++L L + +F    + DV      + A++ +  + T     E   + +MK W   V NI+   N++K VP ++     E F+NC + L+++ ++NL                R +E+   +  +              N    P   + L  +   ++F P+ +D E L+  + + + + +  +  I++ + S+           P+ +P ++  H     K  +R+        P E+ K   +  Y  LIN E +  I   L+E    HSF+E+ +Y++ +  + +KI+          +  L+C++L   L K    + + LL+RV + HR+ N E+ +++E I + A  +P  ++++ +LI ++ +     M+ L +K+  S  RL +L+D   F+  D+ LN  VF    ++  IFD N K  E  K + +  L  +RE+ I EL  ++ +V+EF   G+M+   + +Y++  + L +KL+ A   +   N EEE F    + +P  +E++    P+++L++  +++    + W+ G    ++ D+++A+V   YR LFK++KQF N+                         P+P              +I +K   ++ EFKE +P+I  L  PG++ RHW ++S I    +    G  L+K++ M L+ ++ +F  IS AA +EF LE  M+KM+ EW  +EF +  YRE+G  IL+SVDDIQ +LDD IVKTQTMRGSPFIKPFE EIK WE KL+   + +D+WLKVQA WLYLEPIFSS DIM QMPEEGR F +VD+ WK+IM+  + D  V+       +L++LK+SN LLE I KGLN YLEKKRL+FPRFFFLSNDE+LEILSETKDP RVQPHLKKCFEGIA L F   LDI  M SSENE + +  VISTS+ARG VE+WLL+++  M+ S+R  I+     Y    R EWV +W GQ VL +S  YWT+ V +A++ G E L  Y +  N QI EIV LVRG+L+ Q R TL AL+ +DVHARDV+ ++ +++V +ENDF WL QLRYYW E N + ++ N+ +KY YEYLGN+ RLVITPLTDRCYRTL GA HL+L GAPEGPAGTGKTETTKDLAKA+A QCVVFNCSDGLDYIA+GKFFKGLAS GAW+CFDEFNRI+LEVLSVVAQQIL I RAI    +T MFEGTEL+L+  C V ITMNPGYAGRSELPDNLK LFR VAMMVPDYA+I EISLYS GF++AR LAVKIV TYRLCSEQLSSQ HYDYGMRAVK+VL+AAGNLKLKYPDE+E+IL+LRSI+DVNLPKFL+HD+PLF GI SDLFPGV  P  DY +  K + E C K NL++  FF EKI Q YEMMIVRHGFM+VGEPFGGKT    VLA A+  + E+G  E  KV Y  +NPK+ITMGQL+GQFD VSHEW+DG+ A ++R FA++ TPDRKW+IFDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQ+S   +LIFE MDL  ASPATVSRCGM+Y++P+S+GWRP+F+SWL   P  +  D   +M   +FE  +D  +  + K     + PT  I++VK+LLNLID  +    ++  +++   R++  W +  + FA  WSIG   + + R+ FD   REL+ G             E+ P P  +  ++ + P  G +YDY +  E +  G+  W HW++L K   S  +     E +VPT DT +Y +++++ + H +  +FVGPTGTGKS Y  D L+N++  D Y P+ +NFSAQTSANQTQ IIMSKLDRRRKGVFGPP+GK  ++FVDD+NMP +E YGAQPPIELLRQ+ DH NWYDLKDTT I L D+  +GAMGPPGGGRN +TPRFLRH N +++  F D+TMI IFS++++ ++  Q F+ D+      ++QATL+VYK+A++NLLPTPAKSHY+FNLRDFSRVI G+ L     +E+     RLW HE+ RV+YDRL+ D DREW +  ++E   KH  E FD+LF+HL    +  V E+ +RSL++ D+   DA   ++ Y EV ++      VE  +DEYN   K  M+LV+FR+ +EH+SRI RIL  P  +ALLVGVGGSGRQSLTRLAA+MA+  +FQ EISK+Y   EWREDLK +L+K+       VFL +D+QIK ESFLEDI+NLLN GEVPNL+  +EK EV E        +   +  D SP+AL+ FFV R R++LH+V+A SPIG AFR RLR+FP+L+NCCTIDWFQ WPEDAL  VA + LE V+++  +++  + + K FHTS   LSE++   L R NYVTPTSYLELI++F+ LL+ K+ E  + K+RY  GL+KL  AA  +S MQ +L + QP+LV+A K  +  M+ + ++S  A  Q   VK EE I N++A A++A+ +EC  DLAEAIP LE+AL AL+TL PADITIV+TM +PP GV+LVME +C+++ IKP+RVNDP+  GKK+ D+WGPSK+LLG+M FL  L+ +DKDNI  PIM  IR++++TN +F P +++ AS+A EGLC+W+ A+E YD+VAKVVAPKKI L +A ++    M  LN+ +  L+ V+DKL  L ++L+  +  K+ L+ +V+LC+KKL RA++LIGGLGGEKDRW QAA +L   + NL GD+LLS+GV+AYLG FTS +R +    W        IPCS KFSL   LG+PV+I++WNI+GLP D FSI+N +I++N+RRWPLMIDPQ QANKWIKNMEK+  L VIKLTD DF+R LEN IQFG PVLLEN+GEELDP LEPLLLKQ FKQ G   ++LG+SIIEYS +FR YITTKLRNPHYLPE +VKV+LLNFMIT EGL+DQLLGIVV++E+PELE+ + +LI  SANN++ LKE ED IL  LS SEGNILE+E+AI++L+SSK +S++I +KQ   EET++KID AR+ Y PIA HS ILFFSI DL NIDPMYQYSL+WF+NL+  SI +S KS+ L +RL+ L  +FTYSLY NVCRSLFEKDKLLFSF+LCS IL     ++  E+ FLLTGGVGL+N   NP S+WL  KSWDE+CRL+DL  F G ++ F    + W+  YDS +P + ++PD W  +L DSF  + VLRC+RPDKIV AI N+V+E++GKK+IEPPPFDL  SF DS C +PL+F+LSPGADP  ALLKFA+D+GFGG KF S+SLGQGQGPIA +MI    +EGTWV+LQNCHLA SWM  +EK  EE+ PE T+ +FRLWLTSYPS  FPV +LQNGVKMTNEPP GLR N+ +S+++D IS+ EFF G     S ++KLLFGLCFFHA+VQERRKFGP+GWNI Y FN++DLRIS +QL MF+++Y+ V +DA++YLTGECNYGGRVTDDWDRR L+TIL  FY   V  D  YKF  SG Y  PP ++Y  YIE+IK LP    P VFGMH+N DIT++ Q+++LL DS+L+T  + +S GG S+++ + E++ D+L ++P +FD E     YP  Y +SMNTVLVQEM RFN L + IR SLQN+ KAIKGLVVMS +LE +  S+L  KIP MW K SYPSLKPLGSY+ND + RL FL  WF+ G P  FW+SGFYFTQAFLTGV QN+ARKYTIPIDLL FD+E+L   + +  P DGAY+ GLFLDGARW+ +   + E  PKVL + +PVIWLKP K+  I    + Y  P+YKTSER+G LSTTGHSTNFV+ + LPT++P  HW+ RG ALLCQLDD
Sbjct:  138 SMKRSLVQMSLKKPNVPGLESDDLVPFPEEPIGLDF-SQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALH-HEGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIF---NERKSVPKIEQDLK-ESFYNCTTILLSNQIKNL--------------LGRTVEAWVDIFEE-------------GNAKFLPILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDAIINSN---------PQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNEN---HSFDEYGEYIEKFQVIAQKIKCLPNVEY-FHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLIAELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAERDREKKKKTRTDTDEPLPPPEEDDTPKPPAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVDDIQQLLDDQIVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGNDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVDECLRFVSKNCKGVI-PTGSIHLVKNLLNLIDMIMKPHLEKEDVAE--NRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKN-----------ESFPIPKEINRFEVMLPETGLVYDYFY--EHKVRGY--WHHWNDLNKNL-SKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIE--LVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRADLAEAIPALEAALSALDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSTLCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGEELDPSLEPLLLKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILKKQETAEETQKKIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPASSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKL-DSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTSSGGGSSENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 3963          
BLAST of Dynein heavy chain 7 axonemal vs. Planmine SMEST
Match: SMESG000065732.1 (SMESG000065732.1)

HSP 1 Score: 3872.01 bits (10040), Expect = 0.000e+0
Identity = 2041/3941 (51.79%), Postives = 2694/3941 (68.36%), Query Frame = 3
Query:  606 SVKKAIVDFVLKEPREK--ETDD-TPIPEHRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPEIIEKH-----KSTVRNVLIDESVGPTEHIKEFDK--YRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDXXXXXXXXXXXXFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNE--INKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENK-------------------------PIPK-------------KIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAI-TDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPP--LQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDF--SDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKS-------------------EN----------------------------LQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENP-SAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFF-GTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPS-YLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD 12113
            S+K+++V   LK+P     E+DD  P PE    L    + W  SF+   +   K L +  P M ++L L + +F    + DV      + A++ +  + T     E   + +MK W   V NI+   N++K VP ++ Q   E F+NC + L+++ ++NL                R +E+   +  +              N    P   + L  +   ++F P+ +D E L+  + + + + +  +  I++ + S+           P+ +P ++  H     K  +R+        P E+ K   +  Y  LIN E +  I   L+E    HSF+E+ +Y++ +  + +KI+          +  L+C++L   L K    + + LL+RV + HR+ N E+ +++E I + A  +P  ++++ +LI ++ +     M+ L +K+  S  RL +L+D   F+  D+ LN  VF    ++  IFD N K  E  K + +  L  +RE+ I EL  ++ +V+EF   G+M+   + +Y++  + L +KL+ A   +   N EEE F    + +P  +E++    P+++L++  +++    + W+ G    ++ D+++A+V   YR LFK++KQF N+                         P+P              +I +K   ++ EFKE +P+I  L  PG++ RHW ++S I    +    G  L+K++ M L+ ++ +F  IS AA +EF LE  M+KM+ EW  +EF +  YRE+G  IL+SVDDIQ +LDD IVKTQTMRGSPFIKPFE EIK WE KL+   + +D+WLKVQA WLYLEPIFSS DIM QMPEEGR F +VD+ WK+IM+  + D  V+       +L++LK+SN LLE I KGLN YLEKKRL+FPRFFFLSNDE+LEILSETKDP RVQPHLKKCFEGIA L F   LDI  M SSENE + +  VISTS+ARG VE+WLL+++  M+ S+R  I+     Y    R EWV +W GQ VL +S  YWT+ V +A++ G E L  Y +  N QI EIV LVRG+L+ Q R TL AL+ +DVHARDV+ ++ +++V +ENDF WL QLRYYW E N + ++ N+ +KY YEYLGN+ RLVITPLTDRCYRTL GA HL+L GAPEGPAGTGKTETTKDLAKA+A QCVVFNCSDGLDYIA+GKFFKGLAS GAW+CFDEFNRI+LEVLSVVAQQIL I RAI    +T MFEGTEL+L+  C V ITMNPGYAGRSELPDNLK LFR VAMMVPDYA+I EISLYS GF++AR LAVKIV TYRLCSEQLSSQ HYDYGMRAVK+VL+AAGNLKLKYPDE+E+IL+LRSI+DVNLPKFL+HD+PLF GI SDLFPGV  P  DY +  K + E C K NL++  FF EKI Q YEMMIVRHGFM+VGEPFGGKT    VLA A+  + E+G  E  KV Y  +NPK+ITMGQL+GQFD VSHEW+DG+ A ++R FA++ TPDRKW+IFDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQ+S   +LIFE MDL  ASPATVSRCGM+Y++P+S+GWRP+F+SWL   P  +  D   +M   +FE  +D  +  + K     + PT  I++VK+LLNLID  +    ++  +++   R++  W +  + FA  WSIG   + + R+ FD   REL+ G             E+ P P  +  ++ + P  G +YDY +  E +  G+  W HW++L K   S  +     E +VPT DT +Y +++++ + H +  +FVGPTGTGKS Y  D L+N++  D Y P+ +NFSAQTSANQTQ IIMSKLDRRRKGVFGPP+GK  ++FVDD+NMP +E YGAQPPIELLRQ+ DH NWYDLKDTT I L D+  +GAMGPPGGGRN +TPRFLRH N +++  F D+TMI IFS++++ ++  Q F+ D+      ++QATL+VYK+A++NLLPTPAKSHY+FNLRDFSRVI G+ L     +E+     RLW HE+ RV+YDRL+ D DREW +  ++E   KH  E FD+LF+HL    +  V E+ +RSL++ D+   DA   ++ Y EV ++      VE  +DEYN   K  M+LV+FR+ +EH+SRI RIL  P  +ALLVGVGGSGRQSLTRLAA+MA+  +FQ EISK+Y   EWREDLK +L+K+       VFL +D+QIK ESFLEDI+NLLN GEVPNL+  +EK EV E        +   +  D SP+AL+ FFV R R++LH+V+A SPIG AFR RLR+FP+L+NCCTIDWFQ WPEDAL  VA + LE V+++  +++  + + K FHTS   LSE++   L R NYVTPTSYLELI++F+ LL+ K+ E  + K+RY  GL+KL  AA  +S MQ +L + QP+LV+A K  +  M+ + ++S  A  Q   VK EE I N++A A++A+ +EC  DLAEAIP LE+AL AL+TL PADITIV+TM +PP GV+LVME +C+++ IKP+RVNDP+  GKK+ D+WGPSK+LLG+M FL  L+ +DKDNI  PIM  IR++++TN +F P +++ AS+A EGLC+W+ A+E YD+VAKVVAPKKI L +A ++    M  LN+ +  L+ V+DKL  L ++L+  +  K+ L+ +V+LC+KKL RA++LIGGLGGEKDRW QAA +L   + NL GD+LLS+GV+AYLG FTS +R +    W        IPCS KFSL   LG+PV+I++WNI+GLP D FSI+N +I++N+RRWPLMIDPQ QANKWIKNMEK+  L VIKLTD DF+R LEN IQFG PVLLEN+GEELDP LEPLLLKQ FKQ G   ++LG+SIIEYS +FR YITTKLRNPHYLPE +VKV+LLNFMIT EGL+DQLLGIVV++E+PELE+ + +LI  SANN++ LKE ED IL  LS SEGNILE+E+AI++L+SSK +S++I +KQ   EET++KID AR+ Y PIA HS ILFFSI DL NIDPMYQYSL+WF+NL+  SI +S KS                   EN                            L +RL+ L  +FTYSLY NVCRSLFEKDKLLFSF+LCS IL     ++  E+ FLLTGGVGL+N   NP S+WL  KSWDE+CRL+DL  F G ++ F    + W+  YDS +P + ++PD W  +L DSF  + VLRC+RPDKIV AI N+V+E++GKK+IEPPPFDL  SF DS C +PL+F+LSPGADP  ALLKFA+D+GFGG KF S+SLGQGQGPIA +MI    +EGTWV+LQNCHLA SWM  +EK  EE+ PE T+ +FRLWLTSYPS  FPV +LQNGVKMTNEPP GLR N+ +S+++D IS+ EFF G     S ++KLLFGLCFFHA+VQERRKFGP+GWNI Y FN++DLRIS +QL MF+++Y+ V +DA++YLTGECNYGGRVTDDWDRR L+TIL  FY   V  D  YKF  SG Y  PP ++Y  YIE+IK LP    P VFGMH+N DIT++ Q+++LL DS+L+T  + +S GG S+++ + E++ D+L ++P +FD E     YP  Y +SMNTVLVQEM RFN L + IR SLQN+ KAIKGLVVMS +LE +  S+L  KIP MW K SYPSLKPLGSY+ND + RL FL  WF+ G P  FW+SGFYFTQAFLTGV QN+ARKYTIPIDLL FD+E+L   + +  P DGAY+ GLFLDGARW+ +   + E  PKVL + +PVIWLKP K+  I    + Y  P+YKTSER+G LSTTGHSTNFV+ + LPT++P  HW+ RG ALLCQLDD
Sbjct:  138 SMKRSLVQMSLKKPNVPGLESDDLVPFPEEPIGLDF-SQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALH-HEGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIF---NERKSVPKIE-QDLKESFYNCTTILLSNQIKNL--------------LGRTVEAWVDIFEE-------------GNAKFLPILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDAIINSN---------PQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNEN---HSFDEYGEYIEKFQVIAQKIKCLPNVEY-FHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLIAELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAERDREKKKKTRTDTDEPLPPPEEDDTPKPPAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVDDIQQLLDDQIVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGNDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVDECLRFVSKNCKGVI-PTGSIHLVKNLLNLIDMIMKPHLEKEDVAE--NRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKN-----------ESFPIPKEINRFEVMLPETGLVYDYFY--EHKVRGY--WHHWNDLNKNL-SKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIE--LVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRADLAEAIPALEAALSALDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSTLCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGEELDPSLEPLLLKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILKKQETAEETQKKIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKILERRSRYLKDHFQYSIYENVCRSLFARDKLLFSFKLCADLMINKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPASSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKL-DSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTSSGGGSSENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 4010          
BLAST of Dynein heavy chain 7 axonemal vs. Planmine SMEST
Match: SMESG000017294.1 (SMESG000017294.1)

HSP 1 Score: 3112.4 bits (8068), Expect = 0.000e+0
Identity = 1718/3810 (45.09%), Postives = 2402/3810 (63.04%), Query Frame = 3
Query:  876 LQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANM---AEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSD--WAGDKTKIYLNPIILPEI-IEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFE---EFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERL-IFLMDYANFNTSDMNLNISVFHSHNRM-GSIFDXXXXXXXXXXXXFQTNLKFKR------ERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIAXXXXXXXXXXXXHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFXXXXXXXXXXPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYT---ILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAITDIHKKMWADIFERFIDAGIACIXXXXXXELSPTSDINVVKSLLNLIDCQIDAF-----NDEAKISQ-------MDQ------RDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQDYQGLYPHKGTIYDYRF---------------IAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIK-LIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMXXXXXXXXXXXXTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDV---ELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGE-MKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDXXXXXXXXXXXXLEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDK--FSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGXXXXXXXXXXXXKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSAXXXXXXXXXXXXXXXVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSA-WLPPKSWDELCRLDDLSVFHGIRQRFIEQK-DSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYA-PPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDR--NYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLD 12110
            LQ F  T +R  +       K W N  +  +Y   K KL          ++F       M  S++ L LDS+ ++ N++ +       +          G+  P   L +     ++P F++ L+L++    +   ++ F  + +N++D+ ++ + +V ++E  +  D  WA +     L  + + E  ++K +  +R  L    +    +  E++K+ +L N+++ + +     E +   + E   E  K+L +   L + I     + I +G F +  + + + L+K+ + +   +LD +    R+S  +  + ++ I RK    P   E++ EL +++        L +   LD+  E +   L DY        NL+   F++   M G         ++ ++   +   +F++        F E+LD+    V    +  D+ + ++   + + +  +L  A      FN  E  F   VT Y    ++     P+  L+    ++   +   M   +  V+ + V+  V  +Y+T+ K  K F   P  +++A ++K  +EEFK  +PLIQ L  PG+R RHW+ +SD +G ++  +  +  SK ++M L+  I     I+E AGKE+ +E+A+ KM  EW  ++F V++Y+ TGT+IL   D+I  +LDDHIV TQ+M  SP+ KPFE  I  WE+ L   QD++DEWL+ Q  WLYLEPIFSS DI  Q+P EG+++ ++D+ W++IMK    +  V+T+    ++L  LK+ N+LLE + KGL++YLE KR  FPRF+FLS+DELLEILS+TKDPT VQPHL+KCFE IA L F + L+IT M S E E +  +    ++   G VE+W+LE+E  M  S+R+ I +GLV+YK  PR EWV KW GQ V+A    YWT  V DA+ E  +    Y+K+   Q+D + A+VRG ++K  R TL ALIV++VHARDV+ N+I E + N NDF W+ QLRYYW+E N+  + +N+   YGYEYLGNT RLVITPLTDRCY TL GALHL  GGAP GPAGTGKTETTKDL KA A QCVVFNCSD LD++A+GKFFKGLAS GAW+CFDEFNRID+EVLSVVAQQI TIQ+A   + D  MFEG EL L P+CAVFITMNPGYAGR+ELPDNLKALFR VAMMVPDYALIAEISL+S GF +AR L+ KIV T++L SEQLSSQ HYD+GMRAVKSV++AAGNLK +    DE+++ LR+I DVN+PKFL  DL LFNGI SDLFP +     DY  L   I+    K  L+  + F++K  Q++E  +VRHG M+VG    GKT  Y+VL +AL  + +Q   + +  Q     +LNPK+ITMGQLYG+FD ++HEW+DG+L+   R   T+  PD++W IFDGPVDA+WIENMNTVLDDNKKLCL SGEII+L     ++FE  DL VASPATVSRCGMVY+EP+ LG  P    W++ LP AI   H++    +F+ +++  +  + +   +E+ PT++  +  +++ L+D  I  F     + EAK S+        DQ        I   +E  F F+  WS GA+ + + RK FD   R  M+  ++            +P         +P +G +YDYRF                 E  +    KW HW   V  +  I  D K+++IIVPT D V+   +   LL   KP + VGPTGTGK+  I D L   M  + Y    I FSA+T+ANQTQ++I SKLD+RRKGVFGPP+GK II F+DDLNMP  E +G+QPPIEL+RQW D   WYD K     + L+D+ FI +MGPPGGGRNPIT R +RH N +  NE  +++M T+F +IL + I+      +  P    L++A +DVY +  + +LPTPAKSHY FNLRD S+V QG+L+  P ++     + RLW HE  RV+ DRLV DQDREWF N +    N   N+ ++ + K              I  L+Y DF      NK+Y+E  + + + K +E  L+++NQ++   MNLVLF  A+ HV RI+RI++QP  +ALL+G+GGSGRQSLT+LAA MA+YD FQ+E+SK+Y   EWR+DLKRI+  +   +   VFLFSD QIK ESFLED+NN+LN+G+VPNLY  D+     E++    +   +      +   L++ + +RVR  LH V+ MSPIG+ FR RLR+FP+LVNCCTIDWF  WP++AL +VA +FL D+   E+ + +  G + +CK  H S    SEKY  ELSRYNYVTPTSYLEL+  F  +  +K+ E+++ + R + GL+KL      +  +Q+EL   +P+L +A +E   T   +E+ S  A + + +V  EEA+A  +AK  E I+++   DL EA+P L+ +L++L+ L   DIT VR M+ PP+GVRLV+E VC++K +KP ++      G KI+D+W   K LL +  KFL+ L  +DKDNI   +++ I E Y+ ++ F P  I   S AC  +C+WV A+ KY  VAK VAPK+ ALE++  E       L + RA LK V+D++  L E+LE+  RR+ +LENK DLC  +L RA++LIGGL  EK RW  +  +L     N+ G++L+S+G VAYLG FT  +R     +W   +    +P +DK   +L+ T GDPV+IR+W I GLP D  SIEN +I+  SRRWPL IDPQGQAN+WIKN++K+N L VIKL+D DF+R LEN I+FG P L+EN+GEELDP LEP+LLKQTFKQ G++ IKLGD+II Y  DFRFYITTKL NPHY PE S KVT++NF ++P GL+DQLLG+VV+ ERP+LE+ KN+LI  +A  +++LKE+ED+IL  LS +EG+ ++D   I+ L +SK  SNEI  K    E+TE+ IDE R  Y+P+A+ + ILFF +ADLA IDPMYQYSL WF+N+F   I N+ K++ L +R+ N+ +YFT+SLY NVCRSLFEK KLLFSF+L + IL+H+  I   EWRFLL GG        NP+  W+  + W+E+  L  L  F    + FI +  + +K+I+DS+EPH ++LP EW + + D F  + VLRCLR DK+ +A+Q+FV   +G+++IEP   DL   + DS+ T+PL+F+LSPG DP + L KFADD  F   K  ++SLGQGQGP A ++I+  ++ G WV  QNCHLAPSWM  LE+ VE+++ +  H DFRLWLTS PS  FPV ILQNG KMT EPP+G++ N+ +SY S   SD +F  +    + W+ LL  LC FH ++ ER+KFGP+G+NI YEF + DLRI + QL MF+ +Y  V +  LQY  G  NYGGRVTDDWDRR ++ +L  FY  QV  + DY +  SG Y    P  D+ GY+ YI++LP+N  P +FG+H NA+IT    ET  L D +L  Q + S+ GGKS ++IV+EVS ++L  +P  F+ E + ++YP  YEQSMNTVL+QE++R+N LL+ I+SSL+++ KAI+GLVVMS  LE +  S+  +K+P  W  K+YPSLKPL S+V D   R+ F+  W DNG PP+FWISGF+F QAFLTG  QN+ARK  I ID + F ++++        E P DG Y++GLFL+GARWD     + ES PK L   MPVIWL P     IP    Y  P+YKT  R GTLSTTGHSTNFV ++ +PTDK ++HWI RGVALLC L+
Sbjct:  478 LQKFIRTSLRDSK-------KGWFNIYETDFYVYTKSKL----------KKFMELVKYCMQDSMRYLTLDSLTNFVNMINDACYACVKLDQ--------GYEWPNDLLTSSLPPKKNPIFLVDLVLDNAGSHYSTPLDQFPIVCVNLFDKAIQALQNVPQLEQFIMKDISWADNP---LLESVGMEEPQVKKLRENLRETLKKALIPMESYALEYNKFLNLQNQDITEYVKNY--EAQHHTALEIKLEVEKHLNEKEILEQLIP----QYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWI--------LTIPDMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIVPKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNTGTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQFEKDLEITAMFSGEGEKIVFE---KSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVSDAL-ETRDLKGLYVKLL-EQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIEENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQIATIQKAQQQRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSPFQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYP-HRERVQKLFDVYLEETVDFM-RHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLI-----------FLP---------FPEEGLVYDYRFDHGGTLSLNREEEENEEEIIKERKIKWVHWMANVP-EYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMPPE-YISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRA--VAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDFNQKYEDVVK--------------IEPLLYGDFMSVAIENKKYVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDD----LERIYGDMKPIVQDLGLQATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIRGLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTREEAVAAKKAKECEIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQG-DKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKI-EPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAGGSVKAQDLPNPAPEWISDRVWNEILTLASLPAFSKFPEEFIHKYLNDFKRIFDSLEPHREKLPGEWCD-ICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKF-SKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKDKVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTS--FSD-DFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTE-DYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAGGKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYEQSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKVMVKAWPEITEIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVALLCALN 4188          
The following BLAST results are available for this feature:
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAH70.000e+064.75dynein axonemal heavy chain 7 [Source:HGNC Symbol;... [more]
DNAH120.000e+053.71dynein axonemal heavy chain 12 [Source:HGNC Symbol... [more]
DNAH30.000e+052.12dynein axonemal heavy chain 3 [Source:HGNC Symbol;... [more]
DNAH10.000e+045.60dynein axonemal heavy chain 1 [Source:HGNC Symbol;... [more]
DNAH60.000e+040.66dynein axonemal heavy chain 6 [Source:HGNC Symbol;... [more]
back to top
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
che-30.000e+026.46Cytoplasmic dynein 2 heavy chain 1 [Source:UniPro... [more]
dhc-14.005e-16625.44Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-13.179e-16625.54Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-13.179e-16625.54Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-38.782e-6335.24Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G... [more]
back to top
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dhc36C0.000e+055.03gene:FBgn0013810 transcript:FBtr0304742[more]
Dnah30.000e+047.21gene:FBgn0035581 transcript:FBtr0289982[more]
Dhc62B0.000e+044.46gene:FBgn0013811 transcript:FBtr0303106[more]
Dhc16F0.000e+038.98gene:FBgn0283476 transcript:FBtr0074509[more]
kl-20.000e+036.45gene:FBgn0001313 transcript:FBtr0346722[more]
back to top
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah70.000e+064.22dynein, axonemal, heavy chain 7 [Source:ZFIN;Acc:Z... [more]
dnah120.000e+054.25dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:... [more]
CR450723.10.000e+054.18dynein, axonemal, heavy chain 12 [Source:NCBI gene... [more]
dnah120.000e+054.21dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:... [more]
dnah30.000e+053.16dynein axonemal heavy chain 3 [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
olfm40.000e+067.93olfactomedin 4 [Source:Xenbase;Acc:XB-GENE-5725072... [more]
olfm40.000e+068.00olfactomedin 4 [Source:Xenbase;Acc:XB-GENE-5725072... [more]
olfm40.000e+069.46olfactomedin 4 [Source:Xenbase;Acc:XB-GENE-5725072... [more]
olfm40.000e+069.69olfactomedin 4 [Source:Xenbase;Acc:XB-GENE-5725072... [more]
olfm40.000e+070.03olfactomedin 4 [Source:Xenbase;Acc:XB-GENE-5725072... [more]
back to top
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnah7b0.000e+065.05dynein, axonemal, heavy chain 7B [Source:MGI Symbo... [more]
Dnah7a0.000e+065.18dynein, axonemal, heavy chain 7A [Source:MGI Symbo... [more]
Dnah7b0.000e+065.05dynein, axonemal, heavy chain 7B [Source:MGI Symbo... [more]
Dnah7b0.000e+065.05dynein, axonemal, heavy chain 7B [Source:MGI Symbo... [more]
Dnah7c0.000e+065.02dynein, axonemal, heavy chain 7C [Source:MGI Symbo... [more]
back to top
BLAST of Dynein heavy chain 7 axonemal vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q63170|DYH7_RAT0.000e+064.97Dynein heavy chain 7, axonemal OS=Rattus norvegicu... [more]
sp|Q8WXX0|DYH7_HUMAN0.000e+064.75Dynein heavy chain 7, axonemal OS=Homo sapiens OX=... [more]
sp|Q8TD57|DYH3_HUMAN0.000e+052.12Dynein heavy chain 3, axonemal OS=Homo sapiens OX=... [more]
sp|Q8BW94|DYH3_MOUSE0.000e+052.41Dynein heavy chain 3, axonemal OS=Mus musculus OX=... [more]
sp|E9Q8T7|DYH1_MOUSE0.000e+045.51Dynein heavy chain 1, axonemal OS=Mus musculus OX=... [more]
back to top
BLAST of Dynein heavy chain 7 axonemal vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RCL60.000e+070.68Dynein heavy chain 7 axonemal OS=Fasciola hepatica... [more]
A0A267ES380.000e+071.55EF-hand domain-containing protein OS=Macrostomum l... [more]
A0A4Z2D8W90.000e+070.81Dynein heavy chain 7, axonemal OS=Schistosoma japo... [more]
A0A1I8JFF00.000e+072.01EF-hand domain-containing protein OS=Macrostomum l... [more]
K1QK110.000e+070.25Dynein heavy chain 7, axonemal OS=Crassostrea giga... [more]
back to top
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah120.000e+053.59dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:... [more]
dnah20.000e+040.82dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
si:dkeyp-86b9.10.000e+036.17dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
ENSAMXT00000016172.20.000e+035.94pep primary_assembly:Astyanax_mexicanus-2.0:4:1379... [more]
dnah50.000e+033.44dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001140.10.000e+062.63pep scaffold:Pmarinus_7.0:GL478666:370:47701:-1 ge... [more]
DNAH60.000e+042.17dynein axonemal heavy chain 6 [Source:HGNC Symbol;... [more]
ENSPMAT00000003959.10.000e+047.46pep scaffold:Pmarinus_7.0:GL495754:4357:49943:-1 g... [more]
ENSPMAT00000003955.10.000e+047.49pep scaffold:Pmarinus_7.0:GL495754:4342:49943:-1 g... [more]
ENSPMAT00000003938.10.000e+058.76pep scaffold:Pmarinus_7.0:GL495754:984:26133:-1 ge... [more]
back to top
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DYN19.754e-11431.44Cytoplasmic heavy chain dynein; microtubule motor ... [more]
back to top
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO458060.000e+066.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO347270.000e+052.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379610.000e+057.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318000.000e+042.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340770.000e+042.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynein heavy chain 7 axonemal vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5